F475605

General Info

Members Datasets Scaffolds Average Seq Length
692 286 692 131

Family's Representative Sequence

Representative Sequence 3300047315|Ga0495581_0529819|Ga0495581_0529819_152_511
Length 119
Sequence MTKSSTHTTLSRRERQIMDVLYRRGRAIAADVMAELPGEPNYKGHVRHEEEGGRYVYAPAVPRHAARKSALKHLVETFFDGSAEQVVAAVLGGEASRLSDEDLERISGLIDKARKDGSR

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 1.88
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1027405 3300002076 Bacteria 813
2 JGI25406J46586_10001877 3300003203 Bacteria 9875
3 Ga0065712_10011019 3300005290 Bacteria 2889
4 Ga0065715_10647077 3300005293 Unclassified 680
5 Ga0065707_10037617 3300005295 Bacteria 1378
6 Ga0065707_10087131 3300005295 Bacteria 5137
7 Ga0070676_10080082 3300005328 Unclassified 1979
8 Ga0070676_10278467 3300005328 Unclassified 1126
9 Ga0070676_10295884 3300005328 Bacteria 1096
10 Ga0070676_10948899 3300005328 Unclassified 643
11 Ga0070683_100933070 3300005329 Unclassified 833
12 Ga0070690_100006239 3300005330 Bacteria 6764
13 Ga0070690_101306213 3300005330 Unclassified 581
14 Ga0070670_100047733 3300005331 Bacteria 3685
15 Ga0070670_100498057 3300005331 Unclassified 1083
16 Ga0070670_100642463 3300005331 Unclassified 952
17 Ga0070670_101538400 3300005331 Unclassified 611
18 Ga0070677_10005391 3300005333 Bacteria 4211
19 Ga0070677_10060878 3300005333 Unclassified 1557
20 Ga0070677_10133203 3300005333 Bacteria 1137
21 Ga0070677_10317139 3300005333 Unclassified 797
22 Ga0068869_100014923 3300005334 Bacteria 5194
23 Ga0068869_100021682 3300005334 Bacteria 4421
24 Ga0068869_100047647 3300005334 Bacteria 3096
25 Ga0070666_10086334 3300005335 Bacteria 2150
26 Ga0070666_10356900 3300005335 Bacteria 1047
27 Ga0070666_10688440 3300005335 Bacteria 749
28 Ga0070666_10834804 3300005335 Unclassified 680
29 Ga0070680_100074435 3300005336 Unclassified 2794
30 Ga0070682_101159706 3300005337 Bacteria 650
31 Ga0068868_100072354 3300005338 Unclassified 2751
32 Ga0068868_100146867 3300005338 Unclassified 1939
33 Ga0070660_100011473 3300005339 Bacteria 6298
34 Ga0070689_100018439 3300005340 Bacteria 5141
35 Ga0070689_100050709 3300005340 Bacteria 3207
36 Ga0070689_100139028 3300005340 Bacteria 1952
37 Ga0070689_100716880 3300005340 Unclassified 874
38 Ga0070661_100016901 3300005344 Bacteria 5165
39 Ga0070661_100018034 3300005344 Bacteria 5015
40 Ga0070661_101041496 3300005344 Unclassified 680
41 Ga0070692_10796454 3300005345 Bacteria 645
42 Ga0070668_100650695 3300005347 Unclassified 926
43 Ga0070668_102010298 3300005347 Bacteria 533
44 Ga0070669_100051468 3300005353 Bacteria 3010
45 Ga0070669_100240763 3300005353 Bacteria 1437
46 Ga0070669_101108482 3300005353 Unclassified 682
47 Ga0070675_100000107 3300005354 Bacteria 48865
48 Ga0070675_100000193 3300005354 Bacteria 38339
49 Ga0070675_100019586 3300005354 Bacteria 5394
50 Ga0070675_100053387 3300005354 Unclassified 3324
51 Ga0070675_100121849 3300005354 Bacteria 2216
52 Ga0070675_100132602 3300005354 Bacteria 2124
53 Ga0070675_100133300 3300005354 Bacteria 2119
54 Ga0070675_100185626 3300005354 Bacteria 1799
55 Ga0070675_100252066 3300005354 Unclassified 1545
56 Ga0070675_100623763 3300005354 Unclassified 979
57 Ga0070675_100767811 3300005354 Bacteria 880
58 Ga0070671_100022507 3300005355 Bacteria 5146
59 Ga0070671_100088895 3300005355 Bacteria 2586
60 Ga0070671_100750789 3300005355 Unclassified 848
61 Ga0070671_100954950 3300005355 Bacteria 750
62 Ga0070674_100001260 3300005356 Bacteria 13307
63 Ga0070674_100027170 3300005356 Bacteria 3747
64 Ga0070674_100179539 3300005356 Unclassified 1620
65 Ga0070674_100285890 3300005356 Bacteria 1309
66 Ga0070674_100743762 3300005356 Unclassified 842
67 Ga0070674_101877689 3300005356 Unclassified 544
68 Ga0070673_100034896 3300005364 Bacteria 3811
69 Ga0070673_100049478 3300005364 Bacteria 3282
70 Ga0070673_100058374 3300005364 Bacteria 3051
71 Ga0070673_100130882 3300005364 Bacteria 2105
72 Ga0070673_100170280 3300005364 Unclassified 1858
73 Ga0070688_100377455 3300005365 Bacteria 1044
74 Ga0070688_100679154 3300005365 Unclassified 796
75 Ga0070688_101567324 3300005365 Bacteria 537
76 Ga0070659_100132575 3300005366 Unclassified 2024
77 Ga0070659_100171155 3300005366 Bacteria 1779
78 Ga0070659_100214158 3300005366 Bacteria 1588
79 Ga0070659_100313139 3300005366 Bacteria 1311
80 Ga0070659_101008023 3300005366 Bacteria 731
81 Ga0070667_100178096 3300005367 Unclassified 1879
82 Ga0070667_100185181 3300005367 Unclassified 1842
83 Ga0070667_100244639 3300005367 Bacteria 1603
84 Ga0070667_100456383 3300005367 Bacteria 1168
85 Ga0070667_100462003 3300005367 Bacteria 1161
86 Ga0070709_10365065 3300005434 Unclassified 1070
87 Ga0070705_100418671 3300005440 Bacteria 997
88 Ga0070705_100841558 3300005440 Unclassified 733
89 Ga0070700_100932241 3300005441 Unclassified 709
90 Ga0070700_100956549 3300005441 Bacteria 701
91 Ga0070700_101897668 3300005441 Bacteria 515
92 Ga0070694_100512272 3300005444 Bacteria 956
93 Ga0070694_100573197 3300005444 Unclassified 906
94 Ga0070694_101472119 3300005444 Unclassified 576
95 Ga0070694_101488194 3300005444 Unclassified 573
96 Ga0070708_100152042 3300005445 Bacteria 2153
97 Ga0070708_100457719 3300005445 Bacteria 1204
98 Ga0070708_101327413 3300005445 Bacteria 672
99 Ga0070663_100066516 3300005455 Bacteria 2611
100 Ga0070678_100009155 3300005456 Bacteria 5980
101 Ga0070678_100117351 3300005456 Unclassified 2093
102 Ga0070678_100330848 3300005456 Bacteria 1304
103 Ga0070678_100381384 3300005456 Bacteria 1220
104 Ga0070678_101427863 3300005456 Bacteria 647
105 Ga0070678_101440348 3300005456 Bacteria 644
106 Ga0070662_100048201 3300005457 Unclassified 3068
107 Ga0070662_100171859 3300005457 Bacteria 1702
108 Ga0070662_100260287 3300005457 Unclassified 1397
109 Ga0070662_100277827 3300005457 Bacteria 1355
110 Ga0070681_10056175 3300005458 Bacteria 3918
111 Ga0068867_100009442 3300005459 Bacteria 6878
112 Ga0068867_100442858 3300005459 Bacteria 1105
113 Ga0068867_100778871 3300005459 Unclassified 851
114 Ga0068867_100792181 3300005459 Bacteria 844
115 Ga0068867_100954691 3300005459 Unclassified 775
116 Ga0070685_10132567 3300005466 Unclassified 1560
117 Ga0070706_100296921 3300005467 Bacteria 1508
118 Ga0070707_100274130 3300005468 Bacteria 1640
119 Ga0070707_100867348 3300005468 Bacteria 867
120 Ga0070698_100040015 3300005471 Bacteria 4820
121 Ga0070698_102060673 3300005471 Unclassified 524
122 Ga0070699_100126883 3300005518 Bacteria 2247
123 Ga0070679_100039688 3300005530 Bacteria 4679
124 Ga0070684_100003808 3300005535 Bacteria 11401
125 Ga0070684_100887890 3300005535 Unclassified 835
126 Ga0070684_100963414 3300005535 Bacteria 800
127 Ga0070697_100216435 3300005536 Bacteria 1632
128 Ga0070697_100534178 3300005536 Bacteria 1027
129 Ga0068853_100450086 3300005539 Unclassified 1211
130 Ga0068853_102096157 3300005539 Unclassified 548
131 Ga0070672_100017016 3300005543 Bacteria 5221
132 Ga0070672_100141926 3300005543 Bacteria 1982
133 Ga0070672_100152116 3300005543 Unclassified 1915
134 Ga0070672_100643060 3300005543 Unclassified 926
135 Ga0070672_101007377 3300005543 Unclassified 738
136 Ga0070686_100004038 3300005544 Bacteria 8071
137 Ga0070686_100233734 3300005544 Bacteria 1335
138 Ga0070695_100688731 3300005545 Bacteria 810
139 Ga0070696_100347483 3300005546 Viruses 1148
140 Ga0070696_100355754 3300005546 Bacteria 1135
141 Ga0070696_100511438 3300005546 Unclassified 957
142 Ga0070696_100549451 3300005546 Bacteria 925
143 Ga0070696_101899810 3300005546 Unclassified 516
144 Ga0070696_101929535 3300005546 Unclassified 512
145 Ga0070665_100196198 3300005548 Unclassified 2020
146 Ga0070665_100313738 3300005548 Bacteria 1572
147 Ga0070665_100764982 3300005548 Unclassified 979
148 Ga0070665_102200515 3300005548 Bacteria 555
149 Ga0070704_100004623 3300005549 Bacteria 7965
150 Ga0070704_100954454 3300005549 Unclassified 774
151 Ga0070704_101689617 3300005549 Bacteria 585
152 Ga0068855_100012526 3300005563 Bacteria 10237
153 Ga0070664_100003576 3300005564 Bacteria 12546
154 Ga0070664_100107457 3300005564 Unclassified 2433
155 Ga0070664_100438053 3300005564 Unclassified 1198
156 Ga0070664_100529507 3300005564 Bacteria 1088
157 Ga0068857_100945793 3300005577 Bacteria 828
158 Ga0068857_101760565 3300005577 Unclassified 606
159 Ga0068854_100049749 3300005578 Unclassified 2996
160 Ga0070702_100165930 3300005615 Bacteria 1432
161 Ga0070702_100294335 3300005615 Bacteria 1120
162 Ga0070702_100323203 3300005615 Bacteria 1076
163 Ga0070702_100405614 3300005615 Unclassified 976
164 Ga0070702_100561729 3300005615 Unclassified 849
165 Ga0070702_100755618 3300005615 Bacteria 747
166 Ga0068852_100084975 3300005616 Unclassified 2818
167 Ga0068852_100380727 3300005616 Bacteria 1384
168 Ga0068859_100007749 3300005617 Bacteria 10900
169 Ga0068859_100120538 3300005617 Bacteria 2690
170 Ga0068859_100357767 3300005617 Unclassified 1555
171 Ga0068859_100453473 3300005617 Bacteria 1379
172 Ga0068859_102075001 3300005617 Bacteria 628
173 Ga0068864_100021678 3300005618 Bacteria 5381
174 Ga0068864_100157452 3300005618 Bacteria 2062
175 Ga0068864_100236331 3300005618 Unclassified 1692
176 Ga0068861_100463401 3300005719 Unclassified 1138
177 Ga0068861_100815834 3300005719 Unclassified 877
178 Ga0068870_10045775 3300005840 Bacteria 2292
179 Ga0068870_10078996 3300005840 Unclassified 1814
180 Ga0068870_11109988 3300005840 Unclassified 569
181 Ga0068863_100009062 3300005841 Bacteria 9716
182 Ga0068863_100367827 3300005841 Bacteria 1403
183 Ga0068858_100014541 3300005842 Bacteria 7415
184 Ga0068858_100051880 3300005842 Bacteria 3795
185 Ga0068858_100052631 3300005842 Bacteria 3767
186 Ga0068858_101230415 3300005842 Unclassified 736
187 Ga0068860_100019269 3300005843 Bacteria 6623
188 Ga0068860_100039019 3300005843 Bacteria 4543
189 Ga0068860_100103054 3300005843 Bacteria 2724
190 Ga0068860_100255975 3300005843 Bacteria 1705
191 Ga0068862_100409336 3300005844 Unclassified 1270
192 Ga0081539_10000056 3300005985 Bacteria 256522
193 Ga0075363_100352318 3300006048 Bacteria 860
194 Ga0075362_10180931 3300006177 Unclassified 1022
195 Ga0075367_10055839 3300006178 Unclassified 2345
196 Ga0075366_10136742 3300006195 Bacteria 1480
197 Ga0097621_100036402 3300006237 Bacteria 3938
198 Ga0097621_100081707 3300006237 Bacteria 2690
199 Ga0097621_100142642 3300006237 Bacteria 2048
200 Ga0097621_100753060 3300006237 Bacteria 900
201 Ga0097621_100865444 3300006237 Unclassified 840
202 Ga0097621_101995485 3300006237 Unclassified 554
203 Ga0068871_100117506 3300006358 Unclassified 2243
204 Ga0068871_100332427 3300006358 Bacteria 1340
205 Ga0068871_100486426 3300006358 Bacteria 1111
206 Ga0075428_100003026 3300006844 Bacteria 18353
207 Ga0075428_100149414 3300006844 Bacteria 2538
208 Ga0075428_100666418 3300006844 Unclassified 1109
209 Ga0075428_100772308 3300006844 Bacteria 1022
210 Ga0075428_101349215 3300006844 Unclassified 749
211 Ga0075430_100011515 3300006846 Bacteria 7518
212 Ga0075430_100016485 3300006846 Bacteria 6293
213 Ga0075430_100027098 3300006846 Bacteria 4871
214 Ga0075430_100036355 3300006846 Unclassified 4177
215 Ga0075430_100374234 3300006846 Bacteria 1176
216 Ga0075430_100801756 3300006846 Unclassified 776
217 Ga0075430_100904861 3300006846 Unclassified 727
218 Ga0075431_100000804 3300006847 Bacteria 27410
219 Ga0075431_100112182 3300006847 Unclassified 2814
220 Ga0075431_100158037 3300006847 Unclassified 2332
221 Ga0075431_100177343 3300006847 Bacteria 2188
222 Ga0075431_100746045 3300006847 Unclassified 955
223 Ga0075431_101154477 3300006847 Unclassified 738
224 Ga0075433_10030851 3300006852 Bacteria 4577
225 Ga0075433_10255874 3300006852 Bacteria 1553
226 Ga0075433_10283942 3300006852 Bacteria 1466
227 Ga0075433_10804833 3300006852 Bacteria 821
228 Ga0075434_100017800 3300006871 Bacteria 6853
229 Ga0075434_101265786 3300006871 Bacteria 749
230 Ga0075429_100007498 3300006880 Bacteria 9471
231 Ga0075429_100046351 3300006880 Bacteria 3782
232 Ga0075429_100213147 3300006880 Bacteria 1692
233 Ga0068865_100090794 3300006881 Bacteria 2215
234 Ga0075436_100116847 3300006914 Bacteria 1864
235 Ga0097620_100007749 3300006931 Bacteria 10900
236 Ga0097620_100120541 3300006931 Bacteria 2690
237 Ga0097620_100357735 3300006931 Unclassified 1555
238 Ga0097620_100453427 3300006931 Bacteria 1379
239 Ga0097620_102075005 3300006931 Bacteria 628
240 Ga0075435_100342547 3300007076 Unclassified 1281
241 Ga0105240_11467915 3300009093 Unclassified 716
242 Ga0111539_10000056 3300009094 Bacteria 114878
243 Ga0111539_10013747 3300009094 Bacteria 10113
244 Ga0111539_10131239 3300009094 Unclassified 2933
245 Ga0111539_10591288 3300009094 Bacteria 1292
246 Ga0111539_10627069 3300009094 Bacteria 1252
247 Ga0111539_10663193 3300009094 Bacteria 1215
248 Ga0111539_10814643 3300009094 Bacteria 1086
249 Ga0111539_10829274 3300009094 Bacteria 1076
250 Ga0111539_11040997 3300009094 Bacteria 951
251 Ga0111539_12618676 3300009094 Unclassified 585
252 Ga0105247_10164975 3300009101 Bacteria 1469
253 Ga0114129_10006522 3300009147 Bacteria 16559
254 Ga0114129_10010650 3300009147 Bacteria 13111
255 Ga0114129_10011051 3300009147 Bacteria 12860
256 Ga0114129_10017449 3300009147 Bacteria 10220
257 Ga0114129_10020920 3300009147 Bacteria 9295
258 Ga0114129_10044424 3300009147 Bacteria 6251
259 Ga0114129_10118725 3300009147 Bacteria 3643
260 Ga0114129_10143879 3300009147 Bacteria 3267
261 Ga0114129_10265291 3300009147 Bacteria 2299
262 Ga0114129_10288678 3300009147 Bacteria 2190
263 Ga0114129_10346166 3300009147 Bacteria 1970
264 Ga0114129_10880335 3300009147 Bacteria 1136
265 Ga0114129_11008401 3300009147 Bacteria 1048
266 Ga0114129_12032295 3300009147 Bacteria 694
267 Ga0114129_12871494 3300009147 Bacteria 571
268 Ga0114129_13183485 3300009147 Unclassified 534
269 Ga0105243_11169251 3300009148 Bacteria 781
270 Ga0105242_10292374 3300009176 Unclassified 1484
271 Ga0105242_10295764 3300009176 Bacteria 1476
272 Ga0105242_11193204 3300009176 Unclassified 780
273 Ga0105248_10006564 3300009177 Bacteria 12756
274 Ga0105248_10030221 3300009177 Bacteria 6048
275 Ga0105248_10083398 3300009177 Bacteria 3596
276 Ga0105248_10148322 3300009177 Bacteria 2646
277 Ga0105248_10249918 3300009177 Unclassified 1996
278 Ga0105248_10317981 3300009177 Bacteria 1753
279 Ga0105248_11864846 3300009177 Unclassified 682
280 Ga0105238_10136252 3300009551 Bacteria 2433
281 Ga0105249_10022648 3300009553 Bacteria 5629
282 Ga0105249_10660268 3300009553 Bacteria 1104
283 Ga0105246_10241939 3300011119 Unclassified 1427
284 Ga0105246_10585340 3300011119 Unclassified 962
285 Ga0105246_10606086 3300011119 Bacteria 947
286 Ga0105246_12101391 3300011119 Unclassified 547
287 Ga0157325_1023617 3300012485 Bacteria 568
288 Ga0157374_10048504 3300013296 Unclassified 3940
289 Ga0157374_10272313 3300013296 Unclassified 1670
290 Ga0157374_11197781 3300013296 Unclassified 781
291 Ga0157374_11933077 3300013296 Bacteria 616
292 Ga0157378_10129016 3300013297 Bacteria 2339
293 Ga0157378_10761429 3300013297 Bacteria 992
294 Ga0157378_11409869 3300013297 Unclassified 740
295 Ga0157378_12410317 3300013297 Unclassified 578
296 Ga0163162_10013149 3300013306 Bacteria 8082
297 Ga0163162_10082498 3300013306 Bacteria 3287
298 Ga0163162_11373494 3300013306 Unclassified 803
299 Ga0163162_11615031 3300013306 Bacteria 740
300 Ga0163162_12760163 3300013306 Bacteria 565
301 Ga0157375_10043371 3300013308 Unclassified 4362
302 Ga0157375_10113232 3300013308 Bacteria 2814
303 Ga0157375_10171740 3300013308 Unclassified 2316
304 Ga0157375_10182805 3300013308 Bacteria 2249
305 Ga0157375_10501414 3300013308 Bacteria 1378
306 Ga0157375_11094769 3300013308 Unclassified 933
307 Ga0157375_12425179 3300013308 Unclassified 626
308 Ga0163163_10302020 3300014325 Bacteria 1653
309 Ga0163163_11062607 3300014325 Unclassified 873
310 Ga0157380_10052513 3300014326 Bacteria 3228
311 Ga0157380_10091328 3300014326 Bacteria 2514
312 Ga0157380_10335656 3300014326 Bacteria 1408
313 Ga0157380_10458220 3300014326 Bacteria 1227
314 Ga0157380_11070473 3300014326 Bacteria 844
315 Ga0157380_11498466 3300014326 Unclassified 728
316 Ga0157380_11602051 3300014326 Bacteria 707
317 Ga0157377_10028734 3300014745 Bacteria 2995
318 Ga0157377_10052241 3300014745 Bacteria 2307
319 Ga0157377_10405424 3300014745 Unclassified 930
320 Ga0157377_10502348 3300014745 Unclassified 848
321 Ga0157377_10508999 3300014745 Unclassified 843
322 Ga0157377_11635910 3300014745 Unclassified 517
323 Ga0157379_10023491 3300014968 Bacteria 5473
324 Ga0157376_10042880 3300014969 Bacteria 3710
325 Ga0157376_10103296 3300014969 Unclassified 2495
326 Ga0157376_10440333 3300014969 Unclassified 1269
327 Ga0157376_10945802 3300014969 Bacteria 882
328 Ga0163161_10293050 3300017792 Unclassified 1279
329 Ga0163161_10845385 3300017792 Bacteria 772
330 Ga0163161_11040686 3300017792 Unclassified 701
331 Ga0213876_10083391 3300021384 Bacteria 1691
332 Ga0207697_10242877 3300025315 Unclassified 796
333 Ga0207682_10001041 3300025893 Bacteria 12793
334 Ga0207682_10010361 3300025893 Bacteria 3653
335 Ga0207682_10057354 3300025893 Bacteria 1623
336 Ga0207682_10120094 3300025893 Bacteria 1165
337 Ga0207642_10063485 3300025899 Bacteria 1728
338 Ga0207710_10643552 3300025900 Unclassified 555
339 Ga0207688_10028330 3300025901 Bacteria 3081
340 Ga0207688_10274605 3300025901 Unclassified 1026
341 Ga0207680_10251383 3300025903 Bacteria 1221
342 Ga0207680_10430075 3300025903 Unclassified 935
343 Ga0207680_10946072 3300025903 Bacteria 617
344 Ga0207699_10319325 3300025906 Unclassified 1089
345 Ga0207645_10001335 3300025907 Bacteria 20268
346 Ga0207645_10068974 3300025907 Bacteria 2262
347 Ga0207645_10279685 3300025907 Bacteria 1108
348 Ga0207645_10430027 3300025907 Unclassified 890
349 Ga0207645_10722738 3300025907 Archaea 677
350 Ga0207643_10001209 3300025908 Bacteria 15266
351 Ga0207643_10016436 3300025908 Bacteria 4037
352 Ga0207643_11118068 3300025908 Unclassified 508
353 Ga0207705_10038281 3300025909 Bacteria 3433
354 Ga0207705_10490362 3300025909 Bacteria 954
355 Ga0207684_10302415 3300025910 Unclassified 1379
356 Ga0207684_11412796 3300025910 Unclassified 569
357 Ga0207654_10537146 3300025911 Unclassified 829
358 Ga0207707_10216468 3300025912 Bacteria 1668
359 Ga0207662_10939179 3300025918 Bacteria 613
360 Ga0207657_10012933 3300025919 Bacteria 8207
361 Ga0207657_11486621 3300025919 Bacteria 507
362 Ga0207649_11119325 3300025920 Unclassified 621
363 Ga0207652_10081332 3300025921 Bacteria 2833
364 Ga0207646_10439760 3300025922 Bacteria 1177
365 Ga0207681_10679253 3300025923 Unclassified 855
366 Ga0207694_10243159 3300025924 Bacteria 1471
367 Ga0207650_10363380 3300025925 Unclassified 1193
368 Ga0207650_10726227 3300025925 Unclassified 840
369 Ga0207650_11332790 3300025925 Unclassified 611
370 Ga0207659_10000925 3300025926 Bacteria 17486
371 Ga0207659_10013128 3300025926 Bacteria 5298
372 Ga0207659_10035018 3300025926 Unclassified 3467
373 Ga0207659_10092828 3300025926 Bacteria 2258
374 Ga0207659_10102971 3300025926 Unclassified 2156
375 Ga0207659_10477157 3300025926 Bacteria 1053
376 Ga0207659_10531537 3300025926 Bacteria 998
377 Ga0207659_10639488 3300025926 Bacteria 909
378 Ga0207659_11588063 3300025926 Bacteria 558
379 Ga0207659_11636883 3300025926 Bacteria 549
380 Ga0207687_10494209 3300025927 Bacteria 1020
381 Ga0207644_10211609 3300025931 Unclassified 1533
382 Ga0207644_10719682 3300025931 Bacteria 833
383 Ga0207690_10082484 3300025932 Bacteria 2249
384 Ga0207690_11108301 3300025932 Unclassified 660
385 Ga0207706_10001124 3300025933 Bacteria 27217
386 Ga0207706_10226965 3300025933 Bacteria 1634
387 Ga0207686_10462737 3300025934 Unclassified 978
388 Ga0207670_10045336 3300025936 Bacteria 2914
389 Ga0207670_10150115 3300025936 Unclassified 1728
390 Ga0207670_11729907 3300025936 Bacteria 532
391 Ga0207669_10000677 3300025937 Bacteria 14690
392 Ga0207669_10058705 3300025937 Bacteria 2349
393 Ga0207669_10120331 3300025937 Bacteria 1781
394 Ga0207669_10351826 3300025937 Bacteria 1138
395 Ga0207669_11316479 3300025937 Unclassified 614
396 Ga0207704_10124232 3300025938 Bacteria 1773
397 Ga0207704_11427993 3300025938 Unclassified 593
398 Ga0207691_10012757 3300025940 Bacteria 8045
399 Ga0207691_10024821 3300025940 Bacteria 5634
400 Ga0207691_10073346 3300025940 Bacteria 3087
401 Ga0207691_10209872 3300025940 Bacteria 1692
402 Ga0207691_10388181 3300025940 Bacteria 1191
403 Ga0207691_10588657 3300025940 Unclassified 942
404 Ga0207711_10028577 3300025941 Bacteria 4694
405 Ga0207711_10142789 3300025941 Bacteria 2155
406 Ga0207689_10034777 3300025942 Bacteria 4184
407 Ga0207689_10170555 3300025942 Bacteria 1793
408 Ga0207689_10240418 3300025942 Bacteria 1497
409 Ga0207689_10362789 3300025942 Unclassified 1205
410 Ga0207661_11680719 3300025944 Unclassified 580
411 Ga0207679_10112433 3300025945 Unclassified 2152
412 Ga0207679_10985887 3300025945 Bacteria 772
413 Ga0207667_10167366 3300025949 Bacteria 2259
414 Ga0207651_10017149 3300025960 Bacteria 4268
415 Ga0207651_10023469 3300025960 Bacteria 3795
416 Ga0207651_10049718 3300025960 Bacteria 2842
417 Ga0207651_10051639 3300025960 Bacteria 2799
418 Ga0207651_10064739 3300025960 Unclassified 2560
419 Ga0207651_10144493 3300025960 Bacteria 1842
420 Ga0207651_10190060 3300025960 Unclassified 1637
421 Ga0207651_10414316 3300025960 Bacteria 1149
422 Ga0207712_10591755 3300025961 Unclassified 959
423 Ga0207712_11455815 3300025961 Bacteria 613
424 Ga0207668_10328405 3300025972 Bacteria 1272
425 Ga0207640_10077733 3300025981 Bacteria 2257
426 Ga0207640_10085887 3300025981 Unclassified 2165
427 Ga0207658_10228663 3300025986 Bacteria 1569
428 Ga0207658_10246046 3300025986 Unclassified 1517
429 Ga0207658_11557500 3300025986 Bacteria 604
430 Ga0207677_10754550 3300026023 Bacteria 868
431 Ga0207703_10036715 3300026035 Bacteria 3901
432 Ga0207703_10038271 3300026035 Bacteria 3827
433 Ga0207703_10533430 3300026035 Unclassified 1105
434 Ga0207703_12159553 3300026035 Bacteria 533
435 Ga0207639_11260138 3300026041 Bacteria 694
436 Ga0207678_10104883 3300026067 Unclassified 2412
437 Ga0207708_10117783 3300026075 Bacteria 2067
438 Ga0207708_10645933 3300026075 Unclassified 900
439 Ga0207702_10593992 3300026078 Bacteria 1086
440 Ga0207641_10030170 3300026088 Bacteria 4490
441 Ga0207648_10011249 3300026089 Bacteria 8437
442 Ga0207648_10031771 3300026089 Bacteria 4666
443 Ga0207648_10175891 3300026089 Unclassified 1893
444 Ga0207648_10398594 3300026089 Bacteria 1246
445 Ga0207648_10532748 3300026089 Unclassified 1077
446 Ga0207648_10601658 3300026089 Bacteria 1013
447 Ga0207648_10669647 3300026089 Unclassified 960
448 Ga0207676_10022811 3300026095 Bacteria 4608
449 Ga0207676_10081397 3300026095 Bacteria 2631
450 Ga0207676_10129232 3300026095 Unclassified 2145
451 Ga0207674_10105673 3300026116 Bacteria 2793
452 Ga0207675_100459279 3300026118 Bacteria 1263
453 Ga0207675_100691950 3300026118 Unclassified 1028
454 Ga0207683_10003513 3300026121 Bacteria 13673
455 Ga0207683_10075577 3300026121 Bacteria 2982
456 Ga0207683_10112474 3300026121 Bacteria 2438
457 Ga0207683_10117505 3300026121 Bacteria 2385
458 Ga0207683_10380946 3300026121 Bacteria 1297
459 Ga0207698_10907617 3300026142 Unclassified 888
460 Ga0207698_10963931 3300026142 Unclassified 862
461 Ga0207698_11405405 3300026142 Bacteria 713
462 Ga0209981_1043577 3300027378 Unclassified 673
463 Ga0209983_1047510 3300027665 Unclassified 935
464 Ga0207428_10002483 3300027907 Bacteria 18414
465 Ga0268266_10099739 3300028379 Bacteria 2557
466 Ga0268266_10329906 3300028379 Bacteria 1430
467 Ga0268266_10577417 3300028379 Bacteria 1079
468 Ga0268265_10199219 3300028380 Bacteria 1736
469 Ga0268265_12331523 3300028380 Unclassified 542
470 Ga0268264_10056583 3300028381 Bacteria 3279
471 Ga0268264_10059743 3300028381 Bacteria 3195
472 Ga0268264_10781124 3300028381 Unclassified 953
473 Ga0307408_101887569 3300031548 Unclassified 572
474 Ga0307405_10591733 3300031731 Unclassified 904
475 Ga0307413_11027854 3300031824 Unclassified 708
476 Ga0307407_11641427 3300031903 Bacteria 511
477 Ga0307412_11284238 3300031911 Bacteria 658
478 Ga0307409_100269973 3300031995 Bacteria 1566
479 Ga0307416_100396903 3300032002 Bacteria 1415
480 Ga0307411_11221541 3300032005 Unclassified 682
481 Ga0307415_101016024 3300032126 Bacteria 772
482 Ga0373945_0160706 3300035116 Bacteria 916
483 Ga0373956_0394287 3300035119 Bacteria 660
484 Ga0373943_0056281 3300035170 Bacteria 1951
485 Ga0373955_0216570 3300035172 Bacteria 1143
486 Ga0373955_0495469 3300035172 Unclassified 746
487 Ga0373955_1031132 3300035172 Bacteria 507
488 Ga0373935_0499540 3300035692 Bacteria 883
489 Ga0373927_0674316 3300035695 Unclassified 683
490 Ga0373947_0196793 3300035725 Unclassified 1317
491 Ga0373947_0215753 3300035725 Bacteria 1260
492 Ga0373937_0125331 3300036401 Bacteria 2396
493 Ga0373937_0153757 3300036401 Unclassified 2156
494 Ga0373937_0549893 3300036401 Bacteria 1097
495 Ga0373937_0610388 3300036401 Bacteria 1035
496 Ga0395905_1144235 3300037471 Bacteria 682
497 Ga0436364_0627217 3300037853 Bacteria 6369
498 Ga0395901_1364144 3300038443 Bacteria 669
499 Ga0436365_1573372 3300039437 Bacteria 871
500 Ga0436365_1784715 3300039437 Unclassified 731
501 Ga0436360_0735281 3300039438 Bacteria 2144
502 Ga0451807_0831803 3300041486 Bacteria 563
503 Ga0439445_0255895 3300042004 Bacteria 523
504 Ga0439449_0258659 3300042007 Bacteria 655
505 Ga0439462_0175885 3300042015 Bacteria 606
506 Ga0450920_051942 3300042122 Bacteria 823
507 Ga0439434_0281985 3300042435 Bacteria 572
508 Ga0439435_0010420 3300042436 Bacteria 2207
509 Ga0439435_0071066 3300042436 Bacteria 1030
510 Ga0439444_0004617 3300042437 Bacteria 2011
511 Ga0451577_0060549 3300042876 Bacteria 3375
512 Ga0453684_0074567 3300044712 Bacteria 4270
513 Ga0466971_0329145 3300044719 Bacteria 737
514 Ga0466959_0115549 3300045049 Bacteria 1912
515 Ga0451576_0224467 3300045051 Bacteria 1961
516 Ga0451576_0526067 3300045051 Unclassified 1242
517 Ga0466958_0662926 3300045836 Bacteria 679
518 Ga0466967_1004699 3300045976 Bacteria 831
519 Ga0495603_0031800 3300046455 Bacteria 3177
520 Ga0495590_0157037 3300046457 Unclassified 826
521 Ga0495629_1088653 3300046459 Bacteria 517
522 Ga0495638_0095954 3300046460 Bacteria 1780
523 Ga0495580_0058076 3300046472 Bacteria 2723
524 Ga0495639_0024327 3300046475 Bacteria 2666
525 Ga0495594_0032745 3300046499 Bacteria 2823
526 Ga0495586_0060054 3300046535 Bacteria 2067
527 Ga0495598_0216924 3300046537 Bacteria 697
528 Ga0495598_0260163 3300046537 Unclassified 645
529 Ga0495621_0065301 3300046539 Bacteria 1329
530 Ga0495621_0097705 3300046539 Bacteria 1114
531 Ga0495656_0140006 3300046615 Bacteria 1160
532 Ga0495656_0347763 3300046615 Bacteria 768
533 Ga0495656_0353031 3300046615 Bacteria 762
534 Ga0495635_0147991 3300046663 Bacteria 1599
535 Ga0495659_0056994 3300046664 Bacteria 1435
536 Ga0495659_0166005 3300046664 Bacteria 893
537 Ga0495588_0287779 3300046674 Bacteria 866
538 Ga0495599_0552747 3300046678 Bacteria 674
539 Ga0495658_0173323 3300046683 Bacteria 1336
540 Ga0495670_0214416 3300046691 Bacteria 1022
541 Ga0495581_0529819 3300047315 Bacteria 684
542 Ga0495674_0348200 3300047319 Bacteria 1203
543 Ga0495676_0727590 3300047321 Bacteria 641
544 Ga0495675_0220786 3300047444 Bacteria 1147
545 Ga0496102_1044863 3300048905 Unclassified 737
546 Ga0496104_0280830 3300048907 Bacteria 1578
547 Ga0496105_1175988 3300048908 Bacteria 566
548 Ga0496106_0121479 3300048909 Bacteria 2042
549 Ga0496108_0658058 3300048911 Bacteria 910
550 Ga0496109_0190521 3300048912 Bacteria 1927
551 Ga0496109_0365360 3300048912 Unclassified 1363
552 Ga0496109_0632373 3300048912 Bacteria 1007
553 Ga0496109_1831088 3300048912 Bacteria 540
554 Ga0496110_1108163 3300048913 Bacteria 700
555 Ga0496113_0137539 3300048916 Bacteria 1920
556 Ga0496114_1773660 3300048917 Unclassified 505
557 Ga0501291_171953 3300049514 Bacteria 501
558 Ga0501031_0125244 3300049568 Bacteria 1678
559 Ga0501031_0175078 3300049568 Bacteria 1402
560 Ga0501033_0121742 3300049570 Unclassified 1893
561 Ga0501033_0728871 3300049570 Bacteria 673
562 Ga0501034_0188605 3300049571 Bacteria 2025
563 Ga0501039_0128158 3300049575 Bacteria 1991
564 Ga0501039_0169871 3300049575 Bacteria 1714
565 Ga0501039_0247032 3300049575 Bacteria 1403
566 Ga0501039_1003327 3300049575 Bacteria 649
567 Ga0501040_0008884 3300049576 Bacteria 6533
568 Ga0501040_0168715 3300049576 Bacteria 1549
569 Ga0501040_0716446 3300049576 Unclassified 724
570 Ga0501041_0032039 3300049577 Bacteria 3177
571 Ga0501041_0112275 3300049577 Bacteria 1691
572 Ga0501041_0814375 3300049577 Unclassified 599
573 Ga0501042_0004742 3300049578 Bacteria 8680
574 Ga0501042_0582566 3300049578 Bacteria 813
575 Ga0501043_0722649 3300049579 Unclassified 726
576 Ga0501046_0020141 3300049580 Bacteria 5522
577 Ga0501046_0963926 3300049580 Bacteria 593
578 Ga0501047_0048818 3300049581 Bacteria 4087
579 Ga0501047_0205863 3300049581 Bacteria 1827
580 Ga0501048_0081154 3300049582 Bacteria 2288
581 Ga0501048_0246255 3300049582 Unclassified 1268
582 Ga0501068_0085332 3300049584 Bacteria 1943
583 Ga0501068_0256125 3300049584 Unclassified 1116
584 Ga0501068_1130821 3300049584 Unclassified 518
585 Ga0501070_0856183 3300049586 Bacteria 711
586 Ga0501071_0094587 3300049587 Bacteria 2198
587 Ga0501071_0504247 3300049587 Unclassified 928
588 Ga0501072_0058925 3300049588 Bacteria 3027
589 Ga0501072_0101766 3300049588 Unclassified 2283
590 Ga0501072_0108370 3300049588 Bacteria 2210
591 Ga0501072_0141018 3300049588 Bacteria 1921
592 Ga0501072_0258397 3300049588 Unclassified 1387
593 Ga0501072_0542305 3300049588 Bacteria 919
594 Ga0501072_0940035 3300049588 Bacteria 675
595 Ga0501074_0064981 3300049590 Bacteria 2627
596 Ga0501074_1037766 3300049590 Unclassified 576
597 Ga0501075_0006605 3300049591 Bacteria 7993
598 Ga0501075_0007722 3300049591 Bacteria 7468
599 Ga0501075_0109865 3300049591 Bacteria 2096
600 Ga0501075_0273958 3300049591 Unclassified 1286
601 Ga0501076_0027446 3300049592 Bacteria 4416
602 Ga0501076_0031465 3300049592 Bacteria 4138
603 Ga0501076_0435472 3300049592 Bacteria 1079
604 Ga0501077_0087326 3300049593 Bacteria 1977
605 Ga0501077_0272436 3300049593 Bacteria 1077
606 Ga0501202_031298 3300049652 Unclassified 1111
607 Ga0501079_0094366 3300049741 Unclassified 2318
608 Ga0501080_0735213 3300049742 Unclassified 869
609 Ga0501081_0010128 3300049743 Bacteria 6151
610 Ga0501081_0318735 3300049743 Bacteria 1142
611 Ga0501081_0433806 3300049743 Unclassified 975
612 Ga0501083_0177623 3300049744 Unclassified 1391
613 Ga0501083_0441185 3300049744 Unclassified 847
614 Ga0501083_0529277 3300049744 Bacteria 767
615 Ga0501035_1407961 3300049822 Bacteria 534
616 Ga0501045_0130429 3300049824 Bacteria 1868
617 Ga0501045_0356571 3300049824 Bacteria 1088
618 Ga0501045_1254058 3300049824 Bacteria 540
619 nmdc:mga03n38_475640_c1 3300050490 Bacteria 698
620 nmdc:mga00v17_266342_c1 3300050491 Unclassified 1112
621 nmdc:mga06z11_127425_c1 3300050494 Unclassified 1426
622 nmdc:mga05p37_147825_c1 3300050507 Bacteria 2876
623 nmdc:mga05p37_162599_c1 3300050507 Bacteria 2726
624 nmdc:mga05p37_18473_c1 3300050507 Bacteria 8423
625 nmdc:mga05p37_21673_c1 3300050507 Bacteria 7784
626 nmdc:mga05p37_249633_c1 3300050507 Bacteria 2129
627 nmdc:mga05p37_279883_c1 3300050507 Unclassified 1990
628 nmdc:mga05p37_570537_c1 3300050507 Bacteria 1284
629 nmdc:mga05p37_6982_c1 3300050507 Bacteria 13308
630 nmdc:mga05p37_940374_c1 3300050507 Bacteria 926
631 nmdc:mga09592_103866_c1 3300050508 Unclassified 2435
632 nmdc:mga09592_282052_c1 3300050508 Bacteria 1441
633 nmdc:mga09592_45734_c2 3300050508 Bacteria 2740
634 nmdc:mga09592_5892_c1 3300050508 Bacteria 9998
635 nmdc:mga0qj67_197595_c1 3300050509 Unclassified 1634
636 nmdc:mga0qj67_272179_c1 3300050509 Bacteria 1373
637 nmdc:mga0qj67_292942_c1 3300050509 Bacteria 1319
638 nmdc:mga0qj67_41466_c1 3300050509 Bacteria 3621
639 nmdc:mga0qj67_5884_c1 3300050509 Bacteria 8984
640 nmdc:mga0qj67_78764_c1 3300050509 Unclassified 2638
641 nmdc:mga0qj67_802710_c1 3300050509 Unclassified 745
642 nmdc:mga06r32_13675_c1 3300050510 Bacteria 7360
643 nmdc:mga06r32_1410425_c1 3300050510 Bacteria 638
644 nmdc:mga06r32_146341_c1 3300050510 Unclassified 2340
645 nmdc:mga06r32_15513_c1 3300050510 Bacteria 6919
646 nmdc:mga06r32_23758_c1 3300050510 Bacteria 5678
647 nmdc:mga06r32_328374_c1 3300050510 Bacteria 1515
648 nmdc:mga06r32_34369_c1 3300050510 Bacteria 4780
649 nmdc:mga06r32_91349_c1 3300050510 Unclassified 2975
650 nmdc:mga08y16_1311_c1 3300050511 Bacteria 24756
651 nmdc:mga08y16_166464_c1 3300050511 Bacteria 2290
652 nmdc:mga08y16_40988_c1 3300050511 Bacteria 4851
653 nmdc:mga08y16_543577_c1 3300050511 Bacteria 1176
654 nmdc:mga08y16_79329_c1 3300050511 Unclassified 3421
655 nmdc:mga08y16_801129_c1 3300050511 Bacteria 935
656 nmdc:mga0n895_1075076_c1 3300050512 Bacteria 783
657 nmdc:mga0n895_1406937_c1 3300050512 Bacteria 666
658 nmdc:mga0n895_272820_c1 3300050512 Unclassified 1716
659 nmdc:mga0n895_475166_c1 3300050512 Bacteria 1261
660 nmdc:mga0rr50_181166_c1 3300050513 Unclassified 1722
661 nmdc:mga0rr50_284589_c1 3300050513 Bacteria 1380
662 nmdc:mga08x19_119768_c1 3300050514 Unclassified 1764
663 nmdc:mga08x19_276269_c1 3300050514 Bacteria 1163
664 nmdc:mga0a205_142561_c1 3300050515 Bacteria 2296
665 nmdc:mga0a205_200356_c2 3300050515 Bacteria 1589
666 nmdc:mga0a205_38006_c1 3300050515 Bacteria 4630
667 nmdc:mga0a205_631535_c1 3300050515 Bacteria 923
668 nmdc:mga0a205_68965_c1 3300050515 Bacteria 3415
669 Ga0495612_0413687 3300053078 Bacteria 614
670 Ga0495619_0154142 3300053085 Bacteria 1585
671 Ga0495619_0371143 3300053085 Bacteria 989
672 Ga0500641_0000772 3300053096 Bacteria 11618
673 Ga0500568_0018910 3300053139 Bacteria 3005
674 Ga0500616_0000188 3300053153 Bacteria 101183
675 Ga0500645_000164 3300053730 Bacteria 51803
676 Ga0501084_0015972 3300054114 Bacteria 6231
677 Ga0501084_0469648 3300054114 Bacteria 1063
678 Ga0501084_0476149 3300054114 Bacteria 1055
679 Ga0590071_013126 3300059421 Bacteria 1941
680 Ga0590071_017054 3300059421 Bacteria 1704
681 Ga0590074_040236 3300059423 Bacteria 840
682 Ga0590075_003202 3300059424 Bacteria 3895
683 Ga0590075_006059 3300059424 Bacteria 2862
684 Ga0590077_006077 3300059426 Bacteria 2476
685 Ga0590077_037794 3300059426 Unclassified 1067
686 Ga0501082_0057336 3300060353 Bacteria 3356
687 Ga0501082_0061054 3300060353 Bacteria 3245
688 Ga0501082_0774658 3300060353 Unclassified 839
689 Ga0466962_0202268 3300061719 Bacteria 971
690 Ga0530510_0026022 3300061734 Bacteria 4185
691 Ga0530510_0085223 3300061734 Bacteria 2302
692 Ga0530510_1027148 3300061734 Unclassified 631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_11412796 Ga0207684_114127961 106
2 3300006048 Ga0075363_100352318 Ga0075363_1003523182 112
3 3300006177 Ga0075362_10180931 Ga0075362_101809312 112
4 3300006178 Ga0075367_10055839 Ga0075367_100558392 112
5 3300006195 Ga0075366_10136742 Ga0075366_101367422 112
6 3300032126 Ga0307415_101016024 Ga0307415_1010160242 112
7 3300006871 Ga0075434_101265786 Ga0075434_1012657862 113
8 3300026089 Ga0207648_10532748 Ga0207648_105327482 113
9 3300049586 Ga0501070_0856183 Ga0501070_0856183_36_407 113
10 3300049588 Ga0501072_0108370 Ga0501072_0108370_1812_2183 113
11 3300049743 Ga0501081_0318735 Ga0501081_0318735_709_1080 113
12 3300050515 nmdc:mga0a205_631535_c1 nmdc:mga0a205_631535_c1_532_894 113
13 3300054114 Ga0501084_0476149 Ga0501084_0476149_34_405 113
14 3300046664 Ga0495659_0166005 Ga0495659_0166005_130_498 116
15 3300013297 Ga0157378_10761429 Ga0157378_107614292 117
16 3300047315 Ga0495581_0529819 Ga0495581_0529819_152_511 117
17 3300005353 Ga0070669_101108482 Ga0070669_1011084822 119
18 3300005354 Ga0070675_100053387 Ga0070675_1000533872 119
19 3300005356 Ga0070674_101877689 Ga0070674_1018776891 119
20 3300013297 Ga0157378_12410317 Ga0157378_124103171 119
21 3300014326 Ga0157380_10458220 Ga0157380_104582202 119
22 3300014745 Ga0157377_10508999 Ga0157377_105089992 119
23 3300025926 Ga0207659_10531537 Ga0207659_105315372 119
24 3300050511 nmdc:mga08y16_166464_c1 nmdc:mga08y16_166464_c1_783_1145 119
25 3300013296 Ga0157374_11197781 Ga0157374_111977811 122
26 3300046472 Ga0495580_0058076 Ga0495580_0058076_1361_1807 122
27 3300046475 Ga0495639_0024327 Ga0495639_0024327_392_838 122
28 3300049575 Ga0501039_0169871 Ga0501039_0169871_613_999 123
29 3300049577 Ga0501041_0112275 Ga0501041_0112275_98_484 123
30 3300049578 Ga0501042_0004742 Ga0501042_0004742_8193_8579 123
31 3300049584 Ga0501068_0085332 Ga0501068_0085332_1526_1912 123
32 3300049587 Ga0501071_0094587 Ga0501071_0094587_195_581 123
33 3300049590 Ga0501074_0064981 Ga0501074_0064981_1756_2142 123
34 3300049591 Ga0501075_0007722 Ga0501075_0007722_1464_1850 123
35 3300049592 Ga0501076_0031465 Ga0501076_0031465_3586_3972 123
36 3300049593 Ga0501077_0087326 Ga0501077_0087326_539_925 123
37 3300049824 Ga0501045_0356571 Ga0501045_0356571_621_1007 123
38 3300060353 Ga0501082_0057336 Ga0501082_0057336_2798_3184 123
39 3300061734 Ga0530510_0085223 Ga0530510_0085223_372_758 123
40 3300005535 Ga0070684_100887890 Ga0070684_1008878902 124
41 3300011119 Ga0105246_12101391 Ga0105246_121013911 124
42 3300021384 Ga0213876_10083391 Ga0213876_100833912 124
43 3300035172 Ga0373955_0495469 Ga0373955_0495469_108_551 124
44 3300036401 Ga0373937_0125331 Ga0373937_0125331_1246_1689 124
45 3300039437 Ga0436365_1573372 Ga0436365_1573372_259_645 124
46 3300046691 Ga0495670_0214416 Ga0495670_0214416_349_735 124
47 3300005293 Ga0065715_10647077 Ga0065715_106470771 125
48 3300005333 Ga0070677_10317139 Ga0070677_103171391 125
49 3300005335 Ga0070666_10834804 Ga0070666_108348042 125
50 3300005340 Ga0070689_100139028 Ga0070689_1001390282 125
51 3300005355 Ga0070671_100088895 Ga0070671_1000888952 125
52 3300005543 Ga0070672_100152116 Ga0070672_1001521162 125
53 3300005615 Ga0070702_100294335 Ga0070702_1002943351 125
54 3300005842 Ga0068858_100051880 Ga0068858_1000518802 125
55 3300005843 Ga0068860_100103054 Ga0068860_1001030542 125
56 3300006237 Ga0097621_101995485 Ga0097621_1019954851 125
57 3300009101 Ga0105247_10164975 Ga0105247_101649752 125
58 3300009176 Ga0105242_11193204 Ga0105242_111932042 125
59 3300009177 Ga0105248_10006564 Ga0105248_100065645 125
60 3300013297 Ga0157378_10129016 Ga0157378_101290162 125
61 3300013306 Ga0163162_10082498 Ga0163162_100824982 125
62 3300013308 Ga0157375_10171740 Ga0157375_101717403 125
63 3300014968 Ga0157379_10023491 Ga0157379_100234913 125
64 3300025900 Ga0207710_10643552 Ga0207710_106435521 125
65 3300025903 Ga0207680_10430075 Ga0207680_104300752 125
66 3300025931 Ga0207644_10211609 Ga0207644_102116092 125
67 3300025934 Ga0207686_10462737 Ga0207686_104627372 125
68 3300025936 Ga0207670_10150115 Ga0207670_101501152 125
69 3300025940 Ga0207691_10012757 Ga0207691_100127573 125
70 3300025941 Ga0207711_10142789 Ga0207711_101427892 125
71 3300025960 Ga0207651_10190060 Ga0207651_101900602 125
72 3300026035 Ga0207703_10533430 Ga0207703_105334302 125
73 3300028381 Ga0268264_10059743 Ga0268264_100597432 125
74 3300039437 Ga0436365_1784715 Ga0436365_1784715_261_650 125
75 3300049570 Ga0501033_0728871 Ga0501033_0728871_104_517 125
76 3300049577 Ga0501041_0814375 Ga0501041_0814375_14_427 125
77 3300049588 Ga0501072_0141018 Ga0501072_0141018_1044_1457 125
78 3300003203 JGI25406J46586_10001877 JGI25406J46586_100018777 126
79 3300005355 Ga0070671_100954950 Ga0070671_1009549502 126
80 3300005536 Ga0070697_100534178 Ga0070697_1005341782 126
81 3300005617 Ga0068859_100357767 Ga0068859_1003577672 126
82 3300005841 Ga0068863_100009062 Ga0068863_1000090623 126
83 3300005985 Ga0081539_10000056 Ga0081539_1000005635 126
84 3300006237 Ga0097621_100036402 Ga0097621_1000364024 126
85 3300006852 Ga0075433_10804833 Ga0075433_108048332 126
86 3300006880 Ga0075429_100213147 Ga0075429_1002131472 126
87 3300006931 Ga0097620_100357735 Ga0097620_1003577352 126
88 3300009093 Ga0105240_11467915 Ga0105240_114679152 126
89 3300009094 Ga0111539_11040997 Ga0111539_110409971 126
90 3300009147 Ga0114129_10017449 Ga0114129_100174494 126
91 3300009147 Ga0114129_10346166 Ga0114129_103461662 126
92 3300009176 Ga0105242_10295764 Ga0105242_102957642 126
93 3300009177 Ga0105248_10148322 Ga0105248_101483222 126
94 3300014969 Ga0157376_10042880 Ga0157376_100428802 126
95 3300025931 Ga0207644_10719682 Ga0207644_107196822 126
96 3300035725 Ga0373947_0215753 Ga0373947_0215753_184_564 126
97 3300046535 Ga0495586_0060054 Ga0495586_0060054_475_867 126
98 3300046615 Ga0495656_0140006 Ga0495656_0140006_267_653 126
99 3300048912 Ga0496109_1831088 Ga0496109_1831088_116_508 126
100 3300049575 Ga0501039_1003327 Ga0501039_1003327_177_590 126
101 3300050507 nmdc:mga05p37_18473_c1 nmdc:mga05p37_18473_c1_6572_6958 126
102 3300050512 nmdc:mga0n895_1075076_c1 nmdc:mga0n895_1075076_c1_169_564 126
103 3300050512 nmdc:mga0n895_475166_c1 nmdc:mga0n895_475166_c1_327_713 126
104 3300050513 nmdc:mga0rr50_284589_c1 nmdc:mga0rr50_284589_c1_509_904 126
105 3300050514 nmdc:mga08x19_276269_c1 nmdc:mga08x19_276269_c1_627_1022 126
106 3300005564 Ga0070664_100529507 Ga0070664_1005295071 127
107 3300025912 Ga0207707_10216468 Ga0207707_102164682 127
108 3300025918 Ga0207662_10939179 Ga0207662_109391791 127
109 3300025919 Ga0207657_11486621 Ga0207657_114866211 127
110 3300025945 Ga0207679_10985887 Ga0207679_109858871 127
111 3300031548 Ga0307408_101887569 Ga0307408_1018875691 127
112 3300031731 Ga0307405_10591733 Ga0307405_105917331 127
113 3300032002 Ga0307416_100396903 Ga0307416_1003969032 127
114 3300038443 Ga0395901_1364144 Ga0395901_1364144_33_425 127
115 3300044719 Ga0466971_0329145 Ga0466971_0329145_20_406 127
116 3300045049 Ga0466959_0115549 Ga0466959_0115549_152_538 127
117 3300045836 Ga0466958_0662926 Ga0466958_0662926_148_534 127
118 3300046537 Ga0495598_0216924 Ga0495598_0216924_231_617 127
119 3300049584 Ga0501068_1130821 Ga0501068_1130821_49_468 127
120 3300059421 Ga0590071_013126 Ga0590071_013126_243_659 127
121 3300059424 Ga0590075_003202 Ga0590075_003202_486_902 127
122 3300059426 Ga0590077_037794 Ga0590077_037794_311_727 127
123 3300061719 Ga0466962_0202268 Ga0466962_0202268_354_740 127
124 3300061734 Ga0530510_1027148 Ga0530510_1027148_16_435 127
125 3300005328 Ga0070676_10278467 Ga0070676_102784672 128
126 3300005328 Ga0070676_10948899 Ga0070676_109488992 128
127 3300005329 Ga0070683_100933070 Ga0070683_1009330701 128
128 3300005330 Ga0070690_100006239 Ga0070690_1000062392 128
129 3300005330 Ga0070690_101306213 Ga0070690_1013062132 128
130 3300005331 Ga0070670_100047733 Ga0070670_1000477333 128
131 3300005331 Ga0070670_100498057 Ga0070670_1004980571 128
132 3300005333 Ga0070677_10005391 Ga0070677_100053914 128
133 3300005333 Ga0070677_10133203 Ga0070677_101332032 128
134 3300005334 Ga0068869_100014923 Ga0068869_1000149231 128
135 3300005335 Ga0070666_10688440 Ga0070666_106884402 128
136 3300005338 Ga0068868_100146867 Ga0068868_1001468672 128
137 3300005340 Ga0070689_100716880 Ga0070689_1007168802 128
138 3300005344 Ga0070661_100018034 Ga0070661_1000180342 128
139 3300005347 Ga0070668_102010298 Ga0070668_1020102981 128
140 3300005354 Ga0070675_100000107 Ga0070675_10000010722 128
141 3300005354 Ga0070675_100132602 Ga0070675_1001326021 128
142 3300005354 Ga0070675_100133300 Ga0070675_1001333002 128
143 3300005354 Ga0070675_100252066 Ga0070675_1002520662 128
144 3300005355 Ga0070671_100022507 Ga0070671_1000225076 128
145 3300005356 Ga0070674_100285890 Ga0070674_1002858902 128
146 3300005364 Ga0070673_100034896 Ga0070673_1000348962 128
147 3300005365 Ga0070688_100377455 Ga0070688_1003774552 128
148 3300005365 Ga0070688_101567324 Ga0070688_1015673241 128
149 3300005366 Ga0070659_100132575 Ga0070659_1001325752 128
150 3300005367 Ga0070667_100178096 Ga0070667_1001780962 128
151 3300005441 Ga0070700_100956549 Ga0070700_1009565491 128
152 3300005444 Ga0070694_101488194 Ga0070694_1014881941 128
153 3300005445 Ga0070708_100457719 Ga0070708_1004577191 128
154 3300005455 Ga0070663_100066516 Ga0070663_1000665163 128
155 3300005456 Ga0070678_100009155 Ga0070678_1000091555 128
156 3300005456 Ga0070678_100117351 Ga0070678_1001173512 128
157 3300005456 Ga0070678_100330848 Ga0070678_1003308482 128
158 3300005456 Ga0070678_100381384 Ga0070678_1003813842 128
159 3300005457 Ga0070662_100260287 Ga0070662_1002602872 128
160 3300005459 Ga0068867_100009442 Ga0068867_1000094422 128
161 3300005459 Ga0068867_100442858 Ga0068867_1004428582 128
162 3300005459 Ga0068867_100778871 Ga0068867_1007788711 128
163 3300005468 Ga0070707_100867348 Ga0070707_1008673482 128
164 3300005471 Ga0070698_102060673 Ga0070698_1020606731 128
165 3300005518 Ga0070699_100126883 Ga0070699_1001268831 128
166 3300005535 Ga0070684_100963414 Ga0070684_1009634142 128
167 3300005536 Ga0070697_100216435 Ga0070697_1002164352 128
168 3300005539 Ga0068853_102096157 Ga0068853_1020961571 128
169 3300005543 Ga0070672_100141926 Ga0070672_1001419262 128
170 3300005544 Ga0070686_100004038 Ga0070686_10000403812 128
171 3300005545 Ga0070695_100688731 Ga0070695_1006887312 128
172 3300005546 Ga0070696_101899810 Ga0070696_1018998101 128
173 3300005546 Ga0070696_101929535 Ga0070696_1019295351 128
174 3300005548 Ga0070665_100196198 Ga0070665_1001961982 128
175 3300005549 Ga0070704_101689617 Ga0070704_1016896171 128
176 3300005564 Ga0070664_100003576 Ga0070664_10000357610 128
177 3300005615 Ga0070702_100755618 Ga0070702_1007556182 128
178 3300005616 Ga0068852_100084975 Ga0068852_1000849752 128
179 3300005618 Ga0068864_100236331 Ga0068864_1002363312 128
180 3300005841 Ga0068863_100367827 Ga0068863_1003678272 128
181 3300005842 Ga0068858_100052631 Ga0068858_1000526312 128
182 3300005843 Ga0068860_100019269 Ga0068860_1000192692 128
183 3300006237 Ga0097621_100081707 Ga0097621_1000817074 128
184 3300006237 Ga0097621_100865444 Ga0097621_1008654442 128
185 3300006358 Ga0068871_100117506 Ga0068871_1001175062 128
186 3300006846 Ga0075430_100011515 Ga0075430_1000115153 128
187 3300006846 Ga0075430_100904861 Ga0075430_1009048612 128
188 3300006847 Ga0075431_100158037 Ga0075431_1001580372 128
189 3300006847 Ga0075431_100746045 Ga0075431_1007460452 128
190 3300006852 Ga0075433_10030851 Ga0075433_100308515 128
191 3300006852 Ga0075433_10283942 Ga0075433_102839422 128
192 3300006871 Ga0075434_100017800 Ga0075434_1000178002 128
193 3300006881 Ga0068865_100090794 Ga0068865_1000907943 128
194 3300007076 Ga0075435_100342547 Ga0075435_1003425472 128
195 3300009094 Ga0111539_10591288 Ga0111539_105912882 128
196 3300009094 Ga0111539_10829274 Ga0111539_108292742 128
197 3300009094 Ga0111539_12618676 Ga0111539_126186762 128
198 3300009147 Ga0114129_10006522 Ga0114129_1000652215 128
199 3300009147 Ga0114129_13183485 Ga0114129_131834851 128
200 3300009176 Ga0105242_10292374 Ga0105242_102923742 128
201 3300009177 Ga0105248_10317981 Ga0105248_103179812 128
202 3300009177 Ga0105248_11864846 Ga0105248_118648461 128
203 3300009551 Ga0105238_10136252 Ga0105238_101362523 128
204 3300011119 Ga0105246_10241939 Ga0105246_102419392 128
205 3300013296 Ga0157374_11933077 Ga0157374_119330771 128
206 3300013306 Ga0163162_11615031 Ga0163162_116150312 128
207 3300013308 Ga0157375_10501414 Ga0157375_105014142 128
208 3300013308 Ga0157375_11094769 Ga0157375_110947691 128
209 3300014326 Ga0157380_11498466 Ga0157380_114984662 128
210 3300014326 Ga0157380_11602051 Ga0157380_116020511 128
211 3300017792 Ga0163161_10293050 Ga0163161_102930502 128
212 3300025893 Ga0207682_10001041 Ga0207682_100010418 128
213 3300025893 Ga0207682_10120094 Ga0207682_101200942 128
214 3300025901 Ga0207688_10274605 Ga0207688_102746052 128
215 3300025903 Ga0207680_10946072 Ga0207680_109460722 128
216 3300025907 Ga0207645_10001335 Ga0207645_100013352 128
217 3300025907 Ga0207645_10430027 Ga0207645_104300271 128
218 3300025923 Ga0207681_10679253 Ga0207681_106792532 128
219 3300025926 Ga0207659_10000925 Ga0207659_100009256 128
220 3300025926 Ga0207659_10102971 Ga0207659_101029713 128
221 3300025926 Ga0207659_10477157 Ga0207659_104771572 128
222 3300025926 Ga0207659_11588063 Ga0207659_115880631 128
223 3300025926 Ga0207659_11636883 Ga0207659_116368831 128
224 3300025933 Ga0207706_10001124 Ga0207706_100011243 128
225 3300025936 Ga0207670_11729907 Ga0207670_117299072 128
226 3300025937 Ga0207669_10058705 Ga0207669_100587052 128
227 3300025937 Ga0207669_10120331 Ga0207669_101203312 128
228 3300025938 Ga0207704_11427993 Ga0207704_114279931 128
229 3300025940 Ga0207691_10209872 Ga0207691_102098722 128
230 3300025940 Ga0207691_10388181 Ga0207691_103881812 128
231 3300025960 Ga0207651_10017149 Ga0207651_100171494 128
232 3300025960 Ga0207651_10049718 Ga0207651_100497184 128
233 3300025960 Ga0207651_10414316 Ga0207651_104143162 128
234 3300025961 Ga0207712_11455815 Ga0207712_114558151 128
235 3300025981 Ga0207640_10085887 Ga0207640_100858873 128
236 3300025986 Ga0207658_10246046 Ga0207658_102460462 128
237 3300026035 Ga0207703_10036715 Ga0207703_100367152 128
238 3300026035 Ga0207703_12159553 Ga0207703_121595532 128
239 3300026041 Ga0207639_11260138 Ga0207639_112601381 128
240 3300026067 Ga0207678_10104883 Ga0207678_101048832 128
241 3300026088 Ga0207641_10030170 Ga0207641_100301702 128
242 3300026089 Ga0207648_10011249 Ga0207648_100112492 128
243 3300026089 Ga0207648_10398594 Ga0207648_103985942 128
244 3300026089 Ga0207648_10669647 Ga0207648_106696472 128
245 3300026095 Ga0207676_10129232 Ga0207676_101292324 128
246 3300026121 Ga0207683_10003513 Ga0207683_100035135 128
247 3300026121 Ga0207683_10380946 Ga0207683_103809462 128
248 3300026142 Ga0207698_10907617 Ga0207698_109076171 128
249 3300026142 Ga0207698_10963931 Ga0207698_109639312 128
250 3300027378 Ga0209981_1043577 Ga0209981_10435772 128
251 3300027665 Ga0209983_1047510 Ga0209983_10475101 128
252 3300028379 Ga0268266_10099739 Ga0268266_100997392 128
253 3300028379 Ga0268266_10329906 Ga0268266_103299062 128
254 3300031824 Ga0307413_11027854 Ga0307413_110278541 128
255 3300031903 Ga0307407_11641427 Ga0307407_116414271 128
256 3300035170 Ga0373943_0056281 Ga0373943_0056281_1204_1593 128
257 3300035692 Ga0373935_0499540 Ga0373935_0499540_235_639 128
258 3300035695 Ga0373927_0674316 Ga0373927_0674316_225_614 128
259 3300035725 Ga0373947_0196793 Ga0373947_0196793_307_696 128
260 3300037853 Ga0436364_0627217 Ga0436364_0627217_1421_1810 128
261 3300039438 Ga0436360_0735281 Ga0436360_0735281_1694_2083 128
262 3300042004 Ga0439445_0255895 Ga0439445_0255895_29_463 128
263 3300042007 Ga0439449_0258659 Ga0439449_0258659_135_569 128
264 3300042015 Ga0439462_0175885 Ga0439462_0175885_109_507 128
265 3300042436 Ga0439435_0010420 Ga0439435_0010420_350_739 128
266 3300042436 Ga0439435_0071066 Ga0439435_0071066_581_970 128
267 3300042876 Ga0451577_0060549 Ga0451577_0060549_503_895 128
268 3300044712 Ga0453684_0074567 Ga0453684_0074567_2379_2771 128
269 3300045051 Ga0451576_0526067 Ga0451576_0526067_128_517 128
270 3300046455 Ga0495603_0031800 Ga0495603_0031800_1313_1702 128
271 3300046460 Ga0495638_0095954 Ga0495638_0095954_1256_1690 128
272 3300046499 Ga0495594_0032745 Ga0495594_0032745_1270_1659 128
273 3300046664 Ga0495659_0056994 Ga0495659_0056994_693_1082 128
274 3300046674 Ga0495588_0287779 Ga0495588_0287779_137_565 128
275 3300046683 Ga0495658_0173323 Ga0495658_0173323_616_1005 128
276 3300047321 Ga0495676_0727590 Ga0495676_0727590_10_399 128
277 3300048908 Ga0496105_1175988 Ga0496105_1175988_114_524 128
278 3300048909 Ga0496106_0121479 Ga0496106_0121479_522_911 128
279 3300048911 Ga0496108_0658058 Ga0496108_0658058_390_809 128
280 3300048912 Ga0496109_0365360 Ga0496109_0365360_555_974 128
281 3300048913 Ga0496110_1108163 Ga0496110_1108163_279_668 128
282 3300048917 Ga0496114_1773660 Ga0496114_1773660_43_432 128
283 3300049580 Ga0501046_0963926 Ga0501046_0963926_113_502 128
284 3300049581 Ga0501047_0048818 Ga0501047_0048818_3687_4076 128
285 3300049588 Ga0501072_0940035 Ga0501072_0940035_265_654 128
286 3300050490 nmdc:mga03n38_475640_c1 nmdc:mga03n38_475640_c1_176_607 128
287 3300050491 nmdc:mga00v17_266342_c1 nmdc:mga00v17_266342_c1_591_1022 128
288 3300050494 nmdc:mga06z11_127425_c1 nmdc:mga06z11_127425_c1_574_1005 128
289 3300050507 nmdc:mga05p37_279883_c1 nmdc:mga05p37_279883_c1_1467_1871 128
290 3300050508 nmdc:mga09592_103866_c1 nmdc:mga09592_103866_c1_37_426 128
291 3300050509 nmdc:mga0qj67_41466_c1 nmdc:mga0qj67_41466_c1_2834_3223 128
292 3300050509 nmdc:mga0qj67_802710_c1 nmdc:mga0qj67_802710_c1_309_713 128
293 3300050510 nmdc:mga06r32_146341_c1 nmdc:mga06r32_146341_c1_518_922 128
294 3300050510 nmdc:mga06r32_34369_c1 nmdc:mga06r32_34369_c1_4240_4629 128
295 3300050511 nmdc:mga08y16_79329_c1 nmdc:mga08y16_79329_c1_1070_1474 128
296 3300050512 nmdc:mga0n895_272820_c1 nmdc:mga0n895_272820_c1_451_840 128
297 3300050513 nmdc:mga0rr50_181166_c1 nmdc:mga0rr50_181166_c1_151_540 128
298 3300050515 nmdc:mga0a205_142561_c1 nmdc:mga0a205_142561_c1_991_1380 128
299 3300050515 nmdc:mga0a205_38006_c1 nmdc:mga0a205_38006_c1_3173_3562 128
300 3300053139 Ga0500568_0018910 Ga0500568_0018910_991_1422 128
301 3300053153 Ga0500616_0000188 Ga0500616_0000188_80913_81302 128
302 3300053730 Ga0500645_000164 Ga0500645_000164_24021_24410 128
303 3300002076 JGI24749J21850_1027405 JGI24749J21850_10274052 129
304 3300005290 Ga0065712_10011019 Ga0065712_100110195 129
305 3300005295 Ga0065707_10037617 Ga0065707_100376172 129
306 3300005295 Ga0065707_10087131 Ga0065707_100871315 129
307 3300005328 Ga0070676_10080082 Ga0070676_100800822 129
308 3300005328 Ga0070676_10295884 Ga0070676_102958842 129
309 3300005331 Ga0070670_100642463 Ga0070670_1006424632 129
310 3300005331 Ga0070670_101538400 Ga0070670_1015384002 129
311 3300005333 Ga0070677_10060878 Ga0070677_100608782 129
312 3300005334 Ga0068869_100021682 Ga0068869_1000216821 129
313 3300005334 Ga0068869_100047647 Ga0068869_1000476472 129
314 3300005335 Ga0070666_10086334 Ga0070666_100863342 129
315 3300005335 Ga0070666_10356900 Ga0070666_103569002 129
316 3300005336 Ga0070680_100074435 Ga0070680_1000744354 129
317 3300005337 Ga0070682_101159706 Ga0070682_1011597061 129
318 3300005338 Ga0068868_100072354 Ga0068868_1000723544 129
319 3300005339 Ga0070660_100011473 Ga0070660_1000114732 129
320 3300005340 Ga0070689_100018439 Ga0070689_1000184393 129
321 3300005340 Ga0070689_100050709 Ga0070689_1000507093 129
322 3300005344 Ga0070661_100016901 Ga0070661_1000169015 129
323 3300005344 Ga0070661_101041496 Ga0070661_1010414961 129
324 3300005345 Ga0070692_10796454 Ga0070692_107964541 129
325 3300005347 Ga0070668_100650695 Ga0070668_1006506952 129
326 3300005353 Ga0070669_100051468 Ga0070669_1000514682 129
327 3300005353 Ga0070669_100240763 Ga0070669_1002407632 129
328 3300005354 Ga0070675_100000193 Ga0070675_10000019327 129
329 3300005354 Ga0070675_100019586 Ga0070675_1000195868 129
330 3300005354 Ga0070675_100121849 Ga0070675_1001218492 129
331 3300005354 Ga0070675_100185626 Ga0070675_1001856262 129
332 3300005354 Ga0070675_100623763 Ga0070675_1006237631 129
333 3300005354 Ga0070675_100767811 Ga0070675_1007678112 129
334 3300005355 Ga0070671_100750789 Ga0070671_1007507892 129
335 3300005356 Ga0070674_100001260 Ga0070674_10000126012 129
336 3300005356 Ga0070674_100027170 Ga0070674_1000271706 129
337 3300005356 Ga0070674_100179539 Ga0070674_1001795392 129
338 3300005356 Ga0070674_100743762 Ga0070674_1007437621 129
339 3300005364 Ga0070673_100049478 Ga0070673_1000494783 129
340 3300005364 Ga0070673_100058374 Ga0070673_1000583742 129
341 3300005364 Ga0070673_100130882 Ga0070673_1001308822 129
342 3300005364 Ga0070673_100170280 Ga0070673_1001702802 129
343 3300005365 Ga0070688_100679154 Ga0070688_1006791542 129
344 3300005366 Ga0070659_100171155 Ga0070659_1001711552 129
345 3300005366 Ga0070659_100214158 Ga0070659_1002141582 129
346 3300005366 Ga0070659_100313139 Ga0070659_1003131391 129
347 3300005366 Ga0070659_101008023 Ga0070659_1010080232 129
348 3300005367 Ga0070667_100185181 Ga0070667_1001851812 129
349 3300005367 Ga0070667_100244639 Ga0070667_1002446392 129
350 3300005367 Ga0070667_100456383 Ga0070667_1004563831 129
351 3300005367 Ga0070667_100462003 Ga0070667_1004620032 129
352 3300005434 Ga0070709_10365065 Ga0070709_103650652 129
353 3300005440 Ga0070705_100418671 Ga0070705_1004186712 129
354 3300005440 Ga0070705_100841558 Ga0070705_1008415582 129
355 3300005441 Ga0070700_100932241 Ga0070700_1009322411 129
356 3300005441 Ga0070700_101897668 Ga0070700_1018976681 129
357 3300005444 Ga0070694_100512272 Ga0070694_1005122722 129
358 3300005444 Ga0070694_100573197 Ga0070694_1005731971 129
359 3300005444 Ga0070694_101472119 Ga0070694_1014721191 129
360 3300005445 Ga0070708_100152042 Ga0070708_1001520423 129
361 3300005445 Ga0070708_101327413 Ga0070708_1013274132 129
362 3300005456 Ga0070678_101427863 Ga0070678_1014278631 129
363 3300005456 Ga0070678_101440348 Ga0070678_1014403481 129
364 3300005457 Ga0070662_100048201 Ga0070662_1000482011 129
365 3300005457 Ga0070662_100171859 Ga0070662_1001718593 129
366 3300005457 Ga0070662_100277827 Ga0070662_1002778272 129
367 3300005458 Ga0070681_10056175 Ga0070681_100561755 129
368 3300005459 Ga0068867_100792181 Ga0068867_1007921811 129
369 3300005459 Ga0068867_100954691 Ga0068867_1009546912 129
370 3300005466 Ga0070685_10132567 Ga0070685_101325672 129
371 3300005467 Ga0070706_100296921 Ga0070706_1002969212 129
372 3300005468 Ga0070707_100274130 Ga0070707_1002741302 129
373 3300005471 Ga0070698_100040015 Ga0070698_1000400154 129
374 3300005530 Ga0070679_100039688 Ga0070679_1000396885 129
375 3300005535 Ga0070684_100003808 Ga0070684_10000380815 129
376 3300005539 Ga0068853_100450086 Ga0068853_1004500862 129
377 3300005543 Ga0070672_100017016 Ga0070672_1000170163 129
378 3300005543 Ga0070672_100643060 Ga0070672_1006430602 129
379 3300005543 Ga0070672_101007377 Ga0070672_1010073772 129
380 3300005544 Ga0070686_100233734 Ga0070686_1002337342 129
381 3300005546 Ga0070696_100347483 Ga0070696_1003474832 129
382 3300005546 Ga0070696_100355754 Ga0070696_1003557541 129
383 3300005546 Ga0070696_100511438 Ga0070696_1005114381 129
384 3300005546 Ga0070696_100549451 Ga0070696_1005494511 129
385 3300005548 Ga0070665_100313738 Ga0070665_1003137382 129
386 3300005548 Ga0070665_100764982 Ga0070665_1007649821 129
387 3300005548 Ga0070665_102200515 Ga0070665_1022005151 129
388 3300005549 Ga0070704_100004623 Ga0070704_1000046233 129
389 3300005549 Ga0070704_100954454 Ga0070704_1009544542 129
390 3300005563 Ga0068855_100012526 Ga0068855_10001252610 129
391 3300005564 Ga0070664_100107457 Ga0070664_1001074573 129
392 3300005564 Ga0070664_100438053 Ga0070664_1004380532 129
393 3300005577 Ga0068857_100945793 Ga0068857_1009457931 129
394 3300005577 Ga0068857_101760565 Ga0068857_1017605651 129
395 3300005578 Ga0068854_100049749 Ga0068854_1000497492 129
396 3300005615 Ga0070702_100165930 Ga0070702_1001659302 129
397 3300005615 Ga0070702_100323203 Ga0070702_1003232032 129
398 3300005615 Ga0070702_100405614 Ga0070702_1004056142 129
399 3300005615 Ga0070702_100561729 Ga0070702_1005617291 129
400 3300005616 Ga0068852_100380727 Ga0068852_1003807271 129
401 3300005617 Ga0068859_100007749 Ga0068859_1000077494 129
402 3300005617 Ga0068859_100120538 Ga0068859_1001205383 129
403 3300005617 Ga0068859_100453473 Ga0068859_1004534732 129
404 3300005617 Ga0068859_102075001 Ga0068859_1020750011 129
405 3300005618 Ga0068864_100021678 Ga0068864_1000216784 129
406 3300005618 Ga0068864_100157452 Ga0068864_1001574522 129
407 3300005719 Ga0068861_100463401 Ga0068861_1004634012 129
408 3300005719 Ga0068861_100815834 Ga0068861_1008158342 129
409 3300005840 Ga0068870_10045775 Ga0068870_100457752 129
410 3300005840 Ga0068870_10078996 Ga0068870_100789962 129
411 3300005840 Ga0068870_11109988 Ga0068870_111099881 129
412 3300005842 Ga0068858_100014541 Ga0068858_1000145414 129
413 3300005842 Ga0068858_101230415 Ga0068858_1012304151 129
414 3300005843 Ga0068860_100039019 Ga0068860_1000390192 129
415 3300005843 Ga0068860_100255975 Ga0068860_1002559752 129
416 3300005844 Ga0068862_100409336 Ga0068862_1004093362 129
417 3300006237 Ga0097621_100142642 Ga0097621_1001426423 129
418 3300006237 Ga0097621_100753060 Ga0097621_1007530602 129
419 3300006358 Ga0068871_100332427 Ga0068871_1003324272 129
420 3300006358 Ga0068871_100486426 Ga0068871_1004864262 129
421 3300006844 Ga0075428_100003026 Ga0075428_1000030268 129
422 3300006844 Ga0075428_100149414 Ga0075428_1001494144 129
423 3300006844 Ga0075428_100666418 Ga0075428_1006664182 129
424 3300006844 Ga0075428_100772308 Ga0075428_1007723082 129
425 3300006844 Ga0075428_101349215 Ga0075428_1013492152 129
426 3300006846 Ga0075430_100016485 Ga0075430_1000164853 129
427 3300006846 Ga0075430_100027098 Ga0075430_1000270987 129
428 3300006846 Ga0075430_100036355 Ga0075430_1000363553 129
429 3300006846 Ga0075430_100374234 Ga0075430_1003742342 129
430 3300006846 Ga0075430_100801756 Ga0075430_1008017562 129
431 3300006847 Ga0075431_100000804 Ga0075431_1000008048 129
432 3300006847 Ga0075431_100112182 Ga0075431_1001121822 129
433 3300006847 Ga0075431_100177343 Ga0075431_1001773432 129
434 3300006847 Ga0075431_101154477 Ga0075431_1011544771 129
435 3300006852 Ga0075433_10255874 Ga0075433_102558742 129
436 3300006880 Ga0075429_100007498 Ga0075429_1000074982 129
437 3300006880 Ga0075429_100046351 Ga0075429_1000463513 129
438 3300006914 Ga0075436_100116847 Ga0075436_1001168472 129
439 3300006931 Ga0097620_100007749 Ga0097620_1000077494 129
440 3300006931 Ga0097620_100120541 Ga0097620_1001205413 129
441 3300006931 Ga0097620_100453427 Ga0097620_1004534272 129
442 3300006931 Ga0097620_102075005 Ga0097620_1020750051 129
443 3300009094 Ga0111539_10000056 Ga0111539_1000005683 129
444 3300009094 Ga0111539_10013747 Ga0111539_100137474 129
445 3300009094 Ga0111539_10131239 Ga0111539_101312391 129
446 3300009094 Ga0111539_10627069 Ga0111539_106270692 129
447 3300009094 Ga0111539_10663193 Ga0111539_106631932 129
448 3300009094 Ga0111539_10814643 Ga0111539_108146431 129
449 3300009147 Ga0114129_10010650 Ga0114129_100106508 129
450 3300009147 Ga0114129_10011051 Ga0114129_100110516 129
451 3300009147 Ga0114129_10020920 Ga0114129_100209203 129
452 3300009147 Ga0114129_10044424 Ga0114129_100444242 129
453 3300009147 Ga0114129_10118725 Ga0114129_101187253 129
454 3300009147 Ga0114129_10143879 Ga0114129_101438791 129
455 3300009147 Ga0114129_10265291 Ga0114129_102652913 129
456 3300009147 Ga0114129_10288678 Ga0114129_102886783 129
457 3300009147 Ga0114129_10880335 Ga0114129_108803352 129
458 3300009147 Ga0114129_11008401 Ga0114129_110084012 129
459 3300009147 Ga0114129_12032295 Ga0114129_120322951 129
460 3300009147 Ga0114129_12871494 Ga0114129_128714942 129
461 3300009148 Ga0105243_11169251 Ga0105243_111692512 129
462 3300009177 Ga0105248_10030221 Ga0105248_100302215 129
463 3300009177 Ga0105248_10083398 Ga0105248_100833982 129
464 3300009177 Ga0105248_10249918 Ga0105248_102499182 129
465 3300009553 Ga0105249_10022648 Ga0105249_100226482 129
466 3300009553 Ga0105249_10660268 Ga0105249_106602682 129
467 3300011119 Ga0105246_10585340 Ga0105246_105853402 129
468 3300011119 Ga0105246_10606086 Ga0105246_106060862 129
469 3300012485 Ga0157325_1023617 Ga0157325_10236172 129
470 3300013296 Ga0157374_10048504 Ga0157374_100485042 129
471 3300013296 Ga0157374_10272313 Ga0157374_102723132 129
472 3300013297 Ga0157378_11409869 Ga0157378_114098692 129
473 3300013306 Ga0163162_10013149 Ga0163162_100131492 129
474 3300013306 Ga0163162_11373494 Ga0163162_113734941 129
475 3300013306 Ga0163162_12760163 Ga0163162_127601632 129
476 3300013308 Ga0157375_10043371 Ga0157375_100433718 129
477 3300013308 Ga0157375_10113232 Ga0157375_101132324 129
478 3300013308 Ga0157375_10182805 Ga0157375_101828052 129
479 3300013308 Ga0157375_12425179 Ga0157375_124251792 129
480 3300014325 Ga0163163_10302020 Ga0163163_103020202 129
481 3300014325 Ga0163163_11062607 Ga0163163_110626071 129
482 3300014326 Ga0157380_10052513 Ga0157380_100525136 129
483 3300014326 Ga0157380_10091328 Ga0157380_100913284 129
484 3300014326 Ga0157380_10335656 Ga0157380_103356562 129
485 3300014326 Ga0157380_11070473 Ga0157380_110704732 129
486 3300014745 Ga0157377_10028734 Ga0157377_100287343 129
487 3300014745 Ga0157377_10052241 Ga0157377_100522412 129
488 3300014745 Ga0157377_10405424 Ga0157377_104054241 129
489 3300014745 Ga0157377_10502348 Ga0157377_105023482 129
490 3300014745 Ga0157377_11635910 Ga0157377_116359102 129
491 3300014969 Ga0157376_10103296 Ga0157376_101032962 129
492 3300014969 Ga0157376_10440333 Ga0157376_104403332 129
493 3300014969 Ga0157376_10945802 Ga0157376_109458022 129
494 3300017792 Ga0163161_10845385 Ga0163161_108453851 129
495 3300017792 Ga0163161_11040686 Ga0163161_110406862 129
496 3300025315 Ga0207697_10242877 Ga0207697_102428771 129
497 3300025893 Ga0207682_10010361 Ga0207682_100103612 129
498 3300025893 Ga0207682_10057354 Ga0207682_100573541 129
499 3300025899 Ga0207642_10063485 Ga0207642_100634852 129
500 3300025901 Ga0207688_10028330 Ga0207688_100283303 129
501 3300025903 Ga0207680_10251383 Ga0207680_102513832 129
502 3300025906 Ga0207699_10319325 Ga0207699_103193252 129
503 3300025907 Ga0207645_10068974 Ga0207645_100689742 129
504 3300025907 Ga0207645_10279685 Ga0207645_102796852 129
505 3300025907 Ga0207645_10722738 Ga0207645_107227381 129
506 3300025908 Ga0207643_10001209 Ga0207643_100012093 129
507 3300025908 Ga0207643_10016436 Ga0207643_100164363 129
508 3300025908 Ga0207643_11118068 Ga0207643_111180681 129
509 3300025909 Ga0207705_10038281 Ga0207705_100382812 129
510 3300025909 Ga0207705_10490362 Ga0207705_104903622 129
511 3300025910 Ga0207684_10302415 Ga0207684_103024152 129
512 3300025911 Ga0207654_10537146 Ga0207654_105371462 129
513 3300025919 Ga0207657_10012933 Ga0207657_100129333 129
514 3300025920 Ga0207649_11119325 Ga0207649_111193251 129
515 3300025921 Ga0207652_10081332 Ga0207652_100813323 129
516 3300025922 Ga0207646_10439760 Ga0207646_104397603 129
517 3300025924 Ga0207694_10243159 Ga0207694_102431592 129
518 3300025925 Ga0207650_10363380 Ga0207650_103633801 129
519 3300025925 Ga0207650_10726227 Ga0207650_107262272 129
520 3300025925 Ga0207650_11332790 Ga0207650_113327902 129
521 3300025926 Ga0207659_10013128 Ga0207659_100131285 129
522 3300025926 Ga0207659_10035018 Ga0207659_100350183 129
523 3300025926 Ga0207659_10092828 Ga0207659_100928282 129
524 3300025926 Ga0207659_10639488 Ga0207659_106394882 129
525 3300025927 Ga0207687_10494209 Ga0207687_104942092 129
526 3300025932 Ga0207690_10082484 Ga0207690_100824842 129
527 3300025932 Ga0207690_11108301 Ga0207690_111083011 129
528 3300025933 Ga0207706_10226965 Ga0207706_102269651 129
529 3300025936 Ga0207670_10045336 Ga0207670_100453362 129
530 3300025937 Ga0207669_10000677 Ga0207669_100006775 129
531 3300025937 Ga0207669_10351826 Ga0207669_103518262 129
532 3300025937 Ga0207669_11316479 Ga0207669_113164791 129
533 3300025938 Ga0207704_10124232 Ga0207704_101242322 129
534 3300025940 Ga0207691_10024821 Ga0207691_100248215 129
535 3300025940 Ga0207691_10073346 Ga0207691_100733462 129
536 3300025940 Ga0207691_10588657 Ga0207691_105886572 129
537 3300025941 Ga0207711_10028577 Ga0207711_100285773 129
538 3300025942 Ga0207689_10034777 Ga0207689_100347772 129
539 3300025942 Ga0207689_10170555 Ga0207689_101705551 129
540 3300025942 Ga0207689_10240418 Ga0207689_102404182 129
541 3300025942 Ga0207689_10362789 Ga0207689_103627892 129
542 3300025944 Ga0207661_11680719 Ga0207661_116807191 129
543 3300025945 Ga0207679_10112433 Ga0207679_101124332 129
544 3300025949 Ga0207667_10167366 Ga0207667_101673662 129
545 3300025960 Ga0207651_10023469 Ga0207651_100234693 129
546 3300025960 Ga0207651_10051639 Ga0207651_100516391 129
547 3300025960 Ga0207651_10064739 Ga0207651_100647392 129
548 3300025960 Ga0207651_10144493 Ga0207651_101444932 129
549 3300025961 Ga0207712_10591755 Ga0207712_105917552 129
550 3300025972 Ga0207668_10328405 Ga0207668_103284052 129
551 3300025981 Ga0207640_10077733 Ga0207640_100777332 129
552 3300025986 Ga0207658_10228663 Ga0207658_102286633 129
553 3300025986 Ga0207658_11557500 Ga0207658_115575002 129
554 3300026023 Ga0207677_10754550 Ga0207677_107545502 129
555 3300026035 Ga0207703_10038271 Ga0207703_100382711 129
556 3300026075 Ga0207708_10117783 Ga0207708_101177832 129
557 3300026075 Ga0207708_10645933 Ga0207708_106459332 129
558 3300026078 Ga0207702_10593992 Ga0207702_105939922 129
559 3300026089 Ga0207648_10031771 Ga0207648_100317715 129
560 3300026089 Ga0207648_10175891 Ga0207648_101758912 129
561 3300026089 Ga0207648_10601658 Ga0207648_106016582 129
562 3300026095 Ga0207676_10022811 Ga0207676_100228114 129
563 3300026095 Ga0207676_10081397 Ga0207676_100813974 129
564 3300026116 Ga0207674_10105673 Ga0207674_101056732 129
565 3300026118 Ga0207675_100459279 Ga0207675_1004592792 129
566 3300026118 Ga0207675_100691950 Ga0207675_1006919502 129
567 3300026121 Ga0207683_10075577 Ga0207683_100755772 129
568 3300026121 Ga0207683_10112474 Ga0207683_101124742 129
569 3300026121 Ga0207683_10117505 Ga0207683_101175052 129
570 3300026142 Ga0207698_11405405 Ga0207698_114054051 129
571 3300027907 Ga0207428_10002483 Ga0207428_1000248312 129
572 3300028379 Ga0268266_10577417 Ga0268266_105774171 129
573 3300028380 Ga0268265_10199219 Ga0268265_101992192 129
574 3300028380 Ga0268265_12331523 Ga0268265_123315232 129
575 3300028381 Ga0268264_10056583 Ga0268264_100565832 129
576 3300028381 Ga0268264_10781124 Ga0268264_107811242 129
577 3300031911 Ga0307412_11284238 Ga0307412_112842381 129
578 3300031995 Ga0307409_100269973 Ga0307409_1002699732 129
579 3300032005 Ga0307411_11221541 Ga0307411_112215412 129
580 3300035116 Ga0373945_0160706 Ga0373945_0160706_412_807 129
581 3300035119 Ga0373956_0394287 Ga0373956_0394287_133_525 129
582 3300035172 Ga0373955_0216570 Ga0373955_0216570_697_1089 129
583 3300035172 Ga0373955_1031132 Ga0373955_1031132_25_417 129
584 3300036401 Ga0373937_0153757 Ga0373937_0153757_1243_1638 129
585 3300036401 Ga0373937_0549893 Ga0373937_0549893_195_593 129
586 3300036401 Ga0373937_0610388 Ga0373937_0610388_581_973 129
587 3300037471 Ga0395905_1144235 Ga0395905_1144235_56_448 129
588 3300041486 Ga0451807_0831803 Ga0451807_0831803_96_488 129
589 3300042122 Ga0450920_051942 Ga0450920_051942_331_732 129
590 3300042435 Ga0439434_0281985 Ga0439434_0281985_52_444 129
591 3300042437 Ga0439444_0004617 Ga0439444_0004617_988_1407 129
592 3300045051 Ga0451576_0224467 Ga0451576_0224467_1459_1851 129
593 3300045976 Ga0466967_1004699 Ga0466967_1004699_284_676 129
594 3300046457 Ga0495590_0157037 Ga0495590_0157037_18_410 129
595 3300046459 Ga0495629_1088653 Ga0495629_1088653_52_447 129
596 3300046537 Ga0495598_0260163 Ga0495598_0260163_46_438 129
597 3300046539 Ga0495621_0065301 Ga0495621_0065301_51_443 129
598 3300046539 Ga0495621_0097705 Ga0495621_0097705_34_453 129
599 3300046615 Ga0495656_0347763 Ga0495656_0347763_43_435 129
600 3300046615 Ga0495656_0353031 Ga0495656_0353031_36_428 129
601 3300046663 Ga0495635_0147991 Ga0495635_0147991_146_541 129
602 3300046678 Ga0495599_0552747 Ga0495599_0552747_83_475 129
603 3300047319 Ga0495674_0348200 Ga0495674_0348200_336_755 129
604 3300047444 Ga0495675_0220786 Ga0495675_0220786_211_603 129
605 3300048905 Ga0496102_1044863 Ga0496102_1044863_315_707 129
606 3300048907 Ga0496104_0280830 Ga0496104_0280830_1086_1481 129
607 3300048912 Ga0496109_0190521 Ga0496109_0190521_854_1249 129
608 3300048912 Ga0496109_0632373 Ga0496109_0632373_361_750 129
609 3300048916 Ga0496113_0137539 Ga0496113_0137539_1223_1618 129
610 3300049514 Ga0501291_171953 Ga0501291_171953_76_468 129
611 3300049568 Ga0501031_0125244 Ga0501031_0125244_188_589 129
612 3300049568 Ga0501031_0175078 Ga0501031_0175078_736_1128 129
613 3300049570 Ga0501033_0121742 Ga0501033_0121742_531_923 129
614 3300049571 Ga0501034_0188605 Ga0501034_0188605_1263_1655 129
615 3300049575 Ga0501039_0128158 Ga0501039_0128158_491_892 129
616 3300049575 Ga0501039_0247032 Ga0501039_0247032_610_1002 129
617 3300049576 Ga0501040_0008884 Ga0501040_0008884_5233_5625 129
618 3300049576 Ga0501040_0168715 Ga0501040_0168715_1060_1461 129
619 3300049576 Ga0501040_0716446 Ga0501040_0716446_52_471 129
620 3300049577 Ga0501041_0032039 Ga0501041_0032039_1306_1707 129
621 3300049578 Ga0501042_0582566 Ga0501042_0582566_182_583 129
622 3300049579 Ga0501043_0722649 Ga0501043_0722649_148_540 129
623 3300049580 Ga0501046_0020141 Ga0501046_0020141_26_418 129
624 3300049581 Ga0501047_0205863 Ga0501047_0205863_1161_1553 129
625 3300049582 Ga0501048_0081154 Ga0501048_0081154_676_1077 129
626 3300049582 Ga0501048_0246255 Ga0501048_0246255_56_448 129
627 3300049584 Ga0501068_0256125 Ga0501068_0256125_40_432 129
628 3300049587 Ga0501071_0504247 Ga0501071_0504247_183_575 129
629 3300049588 Ga0501072_0058925 Ga0501072_0058925_898_1299 129
630 3300049588 Ga0501072_0101766 Ga0501072_0101766_214_606 129
631 3300049588 Ga0501072_0258397 Ga0501072_0258397_82_501 129
632 3300049588 Ga0501072_0542305 Ga0501072_0542305_98_490 129
633 3300049590 Ga0501074_1037766 Ga0501074_1037766_37_429 129
634 3300049591 Ga0501075_0006605 Ga0501075_0006605_2431_2823 129
635 3300049591 Ga0501075_0109865 Ga0501075_0109865_1119_1520 129
636 3300049591 Ga0501075_0273958 Ga0501075_0273958_863_1255 129
637 3300049592 Ga0501076_0027446 Ga0501076_0027446_509_910 129
638 3300049592 Ga0501076_0435472 Ga0501076_0435472_214_606 129
639 3300049593 Ga0501077_0272436 Ga0501077_0272436_133_525 129
640 3300049652 Ga0501202_031298 Ga0501202_031298_126_518 129
641 3300049741 Ga0501079_0094366 Ga0501079_0094366_1688_2080 129
642 3300049742 Ga0501080_0735213 Ga0501080_0735213_149_541 129
643 3300049743 Ga0501081_0010128 Ga0501081_0010128_4828_5220 129
644 3300049743 Ga0501081_0433806 Ga0501081_0433806_452_871 129
645 3300049744 Ga0501083_0177623 Ga0501083_0177623_301_693 129
646 3300049744 Ga0501083_0441185 Ga0501083_0441185_192_584 129
647 3300049744 Ga0501083_0529277 Ga0501083_0529277_180_581 129
648 3300049822 Ga0501035_1407961 Ga0501035_1407961_111_503 129
649 3300049824 Ga0501045_0130429 Ga0501045_0130429_1374_1775 129
650 3300049824 Ga0501045_1254058 Ga0501045_1254058_76_495 129
651 3300050507 nmdc:mga05p37_147825_c1 nmdc:mga05p37_147825_c1_381_791 129
652 3300050507 nmdc:mga05p37_162599_c1 nmdc:mga05p37_162599_c1_413_832 129
653 3300050507 nmdc:mga05p37_21673_c1 nmdc:mga05p37_21673_c1_5749_6168 129
654 3300050507 nmdc:mga05p37_249633_c1 nmdc:mga05p37_249633_c1_463_867 129
655 3300050507 nmdc:mga05p37_570537_c1 nmdc:mga05p37_570537_c1_864_1256 129
656 3300050507 nmdc:mga05p37_6982_c1 nmdc:mga05p37_6982_c1_5334_5726 129
657 3300050507 nmdc:mga05p37_940374_c1 nmdc:mga05p37_940374_c1_88_480 129
658 3300050508 nmdc:mga09592_282052_c1 nmdc:mga09592_282052_c1_803_1195 129
659 3300050508 nmdc:mga09592_45734_c2 nmdc:mga09592_45734_c2_2005_2424 129
660 3300050508 nmdc:mga09592_5892_c1 nmdc:mga09592_5892_c1_1530_1949 129
661 3300050509 nmdc:mga0qj67_197595_c1 nmdc:mga0qj67_197595_c1_415_807 129
662 3300050509 nmdc:mga0qj67_272179_c1 nmdc:mga0qj67_272179_c1_627_1019 129
663 3300050509 nmdc:mga0qj67_292942_c1 nmdc:mga0qj67_292942_c1_63_455 129
664 3300050509 nmdc:mga0qj67_5884_c1 nmdc:mga0qj67_5884_c1_1284_1703 129
665 3300050509 nmdc:mga0qj67_78764_c1 nmdc:mga0qj67_78764_c1_1256_1675 129
666 3300050510 nmdc:mga06r32_13675_c1 nmdc:mga06r32_13675_c1_5403_5795 129
667 3300050510 nmdc:mga06r32_1410425_c1 nmdc:mga06r32_1410425_c1_168_560 129
668 3300050510 nmdc:mga06r32_15513_c1 nmdc:mga06r32_15513_c1_170_589 129
669 3300050510 nmdc:mga06r32_23758_c1 nmdc:mga06r32_23758_c1_319_711 129
670 3300050510 nmdc:mga06r32_328374_c1 nmdc:mga06r32_328374_c1_180_572 129
671 3300050510 nmdc:mga06r32_91349_c1 nmdc:mga06r32_91349_c1_1765_2157 129
672 3300050511 nmdc:mga08y16_1311_c1 nmdc:mga08y16_1311_c1_6773_7165 129
673 3300050511 nmdc:mga08y16_40988_c1 nmdc:mga08y16_40988_c1_2479_2871 129
674 3300050511 nmdc:mga08y16_543577_c1 nmdc:mga08y16_543577_c1_56_448 129
675 3300050511 nmdc:mga08y16_801129_c1 nmdc:mga08y16_801129_c1_229_633 129
676 3300050512 nmdc:mga0n895_1406937_c1 nmdc:mga0n895_1406937_c1_208_627 129
677 3300050514 nmdc:mga08x19_119768_c1 nmdc:mga08x19_119768_c1_860_1252 129
678 3300050515 nmdc:mga0a205_200356_c2 nmdc:mga0a205_200356_c2_573_992 129
679 3300050515 nmdc:mga0a205_68965_c1 nmdc:mga0a205_68965_c1_1092_1496 129
680 3300053078 Ga0495612_0413687 Ga0495612_0413687_13_405 129
681 3300053085 Ga0495619_0154142 Ga0495619_0154142_60_452 129
682 3300053085 Ga0495619_0371143 Ga0495619_0371143_444_836 129
683 3300053096 Ga0500641_0000772 Ga0500641_0000772_5216_5608 129
684 3300054114 Ga0501084_0015972 Ga0501084_0015972_4189_4581 129
685 3300054114 Ga0501084_0469648 Ga0501084_0469648_31_432 129
686 3300059421 Ga0590071_017054 Ga0590071_017054_1147_1539 129
687 3300059423 Ga0590074_040236 Ga0590074_040236_191_583 129
688 3300059424 Ga0590075_006059 Ga0590075_006059_2154_2546 129
689 3300059426 Ga0590077_006077 Ga0590077_006077_428_820 129
690 3300060353 Ga0501082_0061054 Ga0501082_0061054_2669_3070 129
691 3300060353 Ga0501082_0774658 Ga0501082_0774658_38_430 129
692 3300061734 Ga0530510_0026022 Ga0530510_0026022_2283_2684 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

10

112

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9286 13 70
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9215 8 70
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9199 13 70
2xig-assembly2.cif.gz_A the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites 0.9169 13 72
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9028 13 72
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9694 9 69 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9387 12 70 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 9 69 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9332 23 71 3.30.230.130
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 13 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C2ASF8-F1-model_v4 Orc1-like AAA ATPase domain-containing protein 0.954 7 73
AF-A0A7C4PNP8-F1-model_v4 ATP-dependent DNA helicase RecG C-terminal domain-containing protein 0.9434 9 70 GO:0003677
GO:0045892
AF-G9EPR1-F1-model_v4 ATP-dependent DNA helicase RecG C-terminal domain-containing protein 0.9339 7 72
AF-A0A2S5SWH3-F1-model_v4 Uncharacterized protein 0.9311 9 72
AF-A0A4R1RDV8-F1-model_v4 Uncharacterized protein 0.931 9 72

Feature Viewer

pLDDT pTM Quality
77.91 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map