F475605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 286 | 692 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300047315|Ga0495581_0529819|Ga0495581_0529819_152_511 |
| Length | 119 |
| Sequence | MTKSSTHTTLSRRERQIMDVLYRRGRAIAADVMAELPGEPNYKGHVRHEEEGGRYVYAPAVPRHAARKSALKHLVETFFDGSAEQVVAAVLGGEASRLSDEDLERISGLIDKARKDGSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 189 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 190 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 191 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 192 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 193 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 196 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 276 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 277 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 278 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 282 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 283 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 95.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1027405 | 3300002076 | Bacteria | 813 |
| 2 | JGI25406J46586_10001877 | 3300003203 | Bacteria | 9875 |
| 3 | Ga0065712_10011019 | 3300005290 | Bacteria | 2889 |
| 4 | Ga0065715_10647077 | 3300005293 | Unclassified | 680 |
| 5 | Ga0065707_10037617 | 3300005295 | Bacteria | 1378 |
| 6 | Ga0065707_10087131 | 3300005295 | Bacteria | 5137 |
| 7 | Ga0070676_10080082 | 3300005328 | Unclassified | 1979 |
| 8 | Ga0070676_10278467 | 3300005328 | Unclassified | 1126 |
| 9 | Ga0070676_10295884 | 3300005328 | Bacteria | 1096 |
| 10 | Ga0070676_10948899 | 3300005328 | Unclassified | 643 |
| 11 | Ga0070683_100933070 | 3300005329 | Unclassified | 833 |
| 12 | Ga0070690_100006239 | 3300005330 | Bacteria | 6764 |
| 13 | Ga0070690_101306213 | 3300005330 | Unclassified | 581 |
| 14 | Ga0070670_100047733 | 3300005331 | Bacteria | 3685 |
| 15 | Ga0070670_100498057 | 3300005331 | Unclassified | 1083 |
| 16 | Ga0070670_100642463 | 3300005331 | Unclassified | 952 |
| 17 | Ga0070670_101538400 | 3300005331 | Unclassified | 611 |
| 18 | Ga0070677_10005391 | 3300005333 | Bacteria | 4211 |
| 19 | Ga0070677_10060878 | 3300005333 | Unclassified | 1557 |
| 20 | Ga0070677_10133203 | 3300005333 | Bacteria | 1137 |
| 21 | Ga0070677_10317139 | 3300005333 | Unclassified | 797 |
| 22 | Ga0068869_100014923 | 3300005334 | Bacteria | 5194 |
| 23 | Ga0068869_100021682 | 3300005334 | Bacteria | 4421 |
| 24 | Ga0068869_100047647 | 3300005334 | Bacteria | 3096 |
| 25 | Ga0070666_10086334 | 3300005335 | Bacteria | 2150 |
| 26 | Ga0070666_10356900 | 3300005335 | Bacteria | 1047 |
| 27 | Ga0070666_10688440 | 3300005335 | Bacteria | 749 |
| 28 | Ga0070666_10834804 | 3300005335 | Unclassified | 680 |
| 29 | Ga0070680_100074435 | 3300005336 | Unclassified | 2794 |
| 30 | Ga0070682_101159706 | 3300005337 | Bacteria | 650 |
| 31 | Ga0068868_100072354 | 3300005338 | Unclassified | 2751 |
| 32 | Ga0068868_100146867 | 3300005338 | Unclassified | 1939 |
| 33 | Ga0070660_100011473 | 3300005339 | Bacteria | 6298 |
| 34 | Ga0070689_100018439 | 3300005340 | Bacteria | 5141 |
| 35 | Ga0070689_100050709 | 3300005340 | Bacteria | 3207 |
| 36 | Ga0070689_100139028 | 3300005340 | Bacteria | 1952 |
| 37 | Ga0070689_100716880 | 3300005340 | Unclassified | 874 |
| 38 | Ga0070661_100016901 | 3300005344 | Bacteria | 5165 |
| 39 | Ga0070661_100018034 | 3300005344 | Bacteria | 5015 |
| 40 | Ga0070661_101041496 | 3300005344 | Unclassified | 680 |
| 41 | Ga0070692_10796454 | 3300005345 | Bacteria | 645 |
| 42 | Ga0070668_100650695 | 3300005347 | Unclassified | 926 |
| 43 | Ga0070668_102010298 | 3300005347 | Bacteria | 533 |
| 44 | Ga0070669_100051468 | 3300005353 | Bacteria | 3010 |
| 45 | Ga0070669_100240763 | 3300005353 | Bacteria | 1437 |
| 46 | Ga0070669_101108482 | 3300005353 | Unclassified | 682 |
| 47 | Ga0070675_100000107 | 3300005354 | Bacteria | 48865 |
| 48 | Ga0070675_100000193 | 3300005354 | Bacteria | 38339 |
| 49 | Ga0070675_100019586 | 3300005354 | Bacteria | 5394 |
| 50 | Ga0070675_100053387 | 3300005354 | Unclassified | 3324 |
| 51 | Ga0070675_100121849 | 3300005354 | Bacteria | 2216 |
| 52 | Ga0070675_100132602 | 3300005354 | Bacteria | 2124 |
| 53 | Ga0070675_100133300 | 3300005354 | Bacteria | 2119 |
| 54 | Ga0070675_100185626 | 3300005354 | Bacteria | 1799 |
| 55 | Ga0070675_100252066 | 3300005354 | Unclassified | 1545 |
| 56 | Ga0070675_100623763 | 3300005354 | Unclassified | 979 |
| 57 | Ga0070675_100767811 | 3300005354 | Bacteria | 880 |
| 58 | Ga0070671_100022507 | 3300005355 | Bacteria | 5146 |
| 59 | Ga0070671_100088895 | 3300005355 | Bacteria | 2586 |
| 60 | Ga0070671_100750789 | 3300005355 | Unclassified | 848 |
| 61 | Ga0070671_100954950 | 3300005355 | Bacteria | 750 |
| 62 | Ga0070674_100001260 | 3300005356 | Bacteria | 13307 |
| 63 | Ga0070674_100027170 | 3300005356 | Bacteria | 3747 |
| 64 | Ga0070674_100179539 | 3300005356 | Unclassified | 1620 |
| 65 | Ga0070674_100285890 | 3300005356 | Bacteria | 1309 |
| 66 | Ga0070674_100743762 | 3300005356 | Unclassified | 842 |
| 67 | Ga0070674_101877689 | 3300005356 | Unclassified | 544 |
| 68 | Ga0070673_100034896 | 3300005364 | Bacteria | 3811 |
| 69 | Ga0070673_100049478 | 3300005364 | Bacteria | 3282 |
| 70 | Ga0070673_100058374 | 3300005364 | Bacteria | 3051 |
| 71 | Ga0070673_100130882 | 3300005364 | Bacteria | 2105 |
| 72 | Ga0070673_100170280 | 3300005364 | Unclassified | 1858 |
| 73 | Ga0070688_100377455 | 3300005365 | Bacteria | 1044 |
| 74 | Ga0070688_100679154 | 3300005365 | Unclassified | 796 |
| 75 | Ga0070688_101567324 | 3300005365 | Bacteria | 537 |
| 76 | Ga0070659_100132575 | 3300005366 | Unclassified | 2024 |
| 77 | Ga0070659_100171155 | 3300005366 | Bacteria | 1779 |
| 78 | Ga0070659_100214158 | 3300005366 | Bacteria | 1588 |
| 79 | Ga0070659_100313139 | 3300005366 | Bacteria | 1311 |
| 80 | Ga0070659_101008023 | 3300005366 | Bacteria | 731 |
| 81 | Ga0070667_100178096 | 3300005367 | Unclassified | 1879 |
| 82 | Ga0070667_100185181 | 3300005367 | Unclassified | 1842 |
| 83 | Ga0070667_100244639 | 3300005367 | Bacteria | 1603 |
| 84 | Ga0070667_100456383 | 3300005367 | Bacteria | 1168 |
| 85 | Ga0070667_100462003 | 3300005367 | Bacteria | 1161 |
| 86 | Ga0070709_10365065 | 3300005434 | Unclassified | 1070 |
| 87 | Ga0070705_100418671 | 3300005440 | Bacteria | 997 |
| 88 | Ga0070705_100841558 | 3300005440 | Unclassified | 733 |
| 89 | Ga0070700_100932241 | 3300005441 | Unclassified | 709 |
| 90 | Ga0070700_100956549 | 3300005441 | Bacteria | 701 |
| 91 | Ga0070700_101897668 | 3300005441 | Bacteria | 515 |
| 92 | Ga0070694_100512272 | 3300005444 | Bacteria | 956 |
| 93 | Ga0070694_100573197 | 3300005444 | Unclassified | 906 |
| 94 | Ga0070694_101472119 | 3300005444 | Unclassified | 576 |
| 95 | Ga0070694_101488194 | 3300005444 | Unclassified | 573 |
| 96 | Ga0070708_100152042 | 3300005445 | Bacteria | 2153 |
| 97 | Ga0070708_100457719 | 3300005445 | Bacteria | 1204 |
| 98 | Ga0070708_101327413 | 3300005445 | Bacteria | 672 |
| 99 | Ga0070663_100066516 | 3300005455 | Bacteria | 2611 |
| 100 | Ga0070678_100009155 | 3300005456 | Bacteria | 5980 |
| 101 | Ga0070678_100117351 | 3300005456 | Unclassified | 2093 |
| 102 | Ga0070678_100330848 | 3300005456 | Bacteria | 1304 |
| 103 | Ga0070678_100381384 | 3300005456 | Bacteria | 1220 |
| 104 | Ga0070678_101427863 | 3300005456 | Bacteria | 647 |
| 105 | Ga0070678_101440348 | 3300005456 | Bacteria | 644 |
| 106 | Ga0070662_100048201 | 3300005457 | Unclassified | 3068 |
| 107 | Ga0070662_100171859 | 3300005457 | Bacteria | 1702 |
| 108 | Ga0070662_100260287 | 3300005457 | Unclassified | 1397 |
| 109 | Ga0070662_100277827 | 3300005457 | Bacteria | 1355 |
| 110 | Ga0070681_10056175 | 3300005458 | Bacteria | 3918 |
| 111 | Ga0068867_100009442 | 3300005459 | Bacteria | 6878 |
| 112 | Ga0068867_100442858 | 3300005459 | Bacteria | 1105 |
| 113 | Ga0068867_100778871 | 3300005459 | Unclassified | 851 |
| 114 | Ga0068867_100792181 | 3300005459 | Bacteria | 844 |
| 115 | Ga0068867_100954691 | 3300005459 | Unclassified | 775 |
| 116 | Ga0070685_10132567 | 3300005466 | Unclassified | 1560 |
| 117 | Ga0070706_100296921 | 3300005467 | Bacteria | 1508 |
| 118 | Ga0070707_100274130 | 3300005468 | Bacteria | 1640 |
| 119 | Ga0070707_100867348 | 3300005468 | Bacteria | 867 |
| 120 | Ga0070698_100040015 | 3300005471 | Bacteria | 4820 |
| 121 | Ga0070698_102060673 | 3300005471 | Unclassified | 524 |
| 122 | Ga0070699_100126883 | 3300005518 | Bacteria | 2247 |
| 123 | Ga0070679_100039688 | 3300005530 | Bacteria | 4679 |
| 124 | Ga0070684_100003808 | 3300005535 | Bacteria | 11401 |
| 125 | Ga0070684_100887890 | 3300005535 | Unclassified | 835 |
| 126 | Ga0070684_100963414 | 3300005535 | Bacteria | 800 |
| 127 | Ga0070697_100216435 | 3300005536 | Bacteria | 1632 |
| 128 | Ga0070697_100534178 | 3300005536 | Bacteria | 1027 |
| 129 | Ga0068853_100450086 | 3300005539 | Unclassified | 1211 |
| 130 | Ga0068853_102096157 | 3300005539 | Unclassified | 548 |
| 131 | Ga0070672_100017016 | 3300005543 | Bacteria | 5221 |
| 132 | Ga0070672_100141926 | 3300005543 | Bacteria | 1982 |
| 133 | Ga0070672_100152116 | 3300005543 | Unclassified | 1915 |
| 134 | Ga0070672_100643060 | 3300005543 | Unclassified | 926 |
| 135 | Ga0070672_101007377 | 3300005543 | Unclassified | 738 |
| 136 | Ga0070686_100004038 | 3300005544 | Bacteria | 8071 |
| 137 | Ga0070686_100233734 | 3300005544 | Bacteria | 1335 |
| 138 | Ga0070695_100688731 | 3300005545 | Bacteria | 810 |
| 139 | Ga0070696_100347483 | 3300005546 | Viruses | 1148 |
| 140 | Ga0070696_100355754 | 3300005546 | Bacteria | 1135 |
| 141 | Ga0070696_100511438 | 3300005546 | Unclassified | 957 |
| 142 | Ga0070696_100549451 | 3300005546 | Bacteria | 925 |
| 143 | Ga0070696_101899810 | 3300005546 | Unclassified | 516 |
| 144 | Ga0070696_101929535 | 3300005546 | Unclassified | 512 |
| 145 | Ga0070665_100196198 | 3300005548 | Unclassified | 2020 |
| 146 | Ga0070665_100313738 | 3300005548 | Bacteria | 1572 |
| 147 | Ga0070665_100764982 | 3300005548 | Unclassified | 979 |
| 148 | Ga0070665_102200515 | 3300005548 | Bacteria | 555 |
| 149 | Ga0070704_100004623 | 3300005549 | Bacteria | 7965 |
| 150 | Ga0070704_100954454 | 3300005549 | Unclassified | 774 |
| 151 | Ga0070704_101689617 | 3300005549 | Bacteria | 585 |
| 152 | Ga0068855_100012526 | 3300005563 | Bacteria | 10237 |
| 153 | Ga0070664_100003576 | 3300005564 | Bacteria | 12546 |
| 154 | Ga0070664_100107457 | 3300005564 | Unclassified | 2433 |
| 155 | Ga0070664_100438053 | 3300005564 | Unclassified | 1198 |
| 156 | Ga0070664_100529507 | 3300005564 | Bacteria | 1088 |
| 157 | Ga0068857_100945793 | 3300005577 | Bacteria | 828 |
| 158 | Ga0068857_101760565 | 3300005577 | Unclassified | 606 |
| 159 | Ga0068854_100049749 | 3300005578 | Unclassified | 2996 |
| 160 | Ga0070702_100165930 | 3300005615 | Bacteria | 1432 |
| 161 | Ga0070702_100294335 | 3300005615 | Bacteria | 1120 |
| 162 | Ga0070702_100323203 | 3300005615 | Bacteria | 1076 |
| 163 | Ga0070702_100405614 | 3300005615 | Unclassified | 976 |
| 164 | Ga0070702_100561729 | 3300005615 | Unclassified | 849 |
| 165 | Ga0070702_100755618 | 3300005615 | Bacteria | 747 |
| 166 | Ga0068852_100084975 | 3300005616 | Unclassified | 2818 |
| 167 | Ga0068852_100380727 | 3300005616 | Bacteria | 1384 |
| 168 | Ga0068859_100007749 | 3300005617 | Bacteria | 10900 |
| 169 | Ga0068859_100120538 | 3300005617 | Bacteria | 2690 |
| 170 | Ga0068859_100357767 | 3300005617 | Unclassified | 1555 |
| 171 | Ga0068859_100453473 | 3300005617 | Bacteria | 1379 |
| 172 | Ga0068859_102075001 | 3300005617 | Bacteria | 628 |
| 173 | Ga0068864_100021678 | 3300005618 | Bacteria | 5381 |
| 174 | Ga0068864_100157452 | 3300005618 | Bacteria | 2062 |
| 175 | Ga0068864_100236331 | 3300005618 | Unclassified | 1692 |
| 176 | Ga0068861_100463401 | 3300005719 | Unclassified | 1138 |
| 177 | Ga0068861_100815834 | 3300005719 | Unclassified | 877 |
| 178 | Ga0068870_10045775 | 3300005840 | Bacteria | 2292 |
| 179 | Ga0068870_10078996 | 3300005840 | Unclassified | 1814 |
| 180 | Ga0068870_11109988 | 3300005840 | Unclassified | 569 |
| 181 | Ga0068863_100009062 | 3300005841 | Bacteria | 9716 |
| 182 | Ga0068863_100367827 | 3300005841 | Bacteria | 1403 |
| 183 | Ga0068858_100014541 | 3300005842 | Bacteria | 7415 |
| 184 | Ga0068858_100051880 | 3300005842 | Bacteria | 3795 |
| 185 | Ga0068858_100052631 | 3300005842 | Bacteria | 3767 |
| 186 | Ga0068858_101230415 | 3300005842 | Unclassified | 736 |
| 187 | Ga0068860_100019269 | 3300005843 | Bacteria | 6623 |
| 188 | Ga0068860_100039019 | 3300005843 | Bacteria | 4543 |
| 189 | Ga0068860_100103054 | 3300005843 | Bacteria | 2724 |
| 190 | Ga0068860_100255975 | 3300005843 | Bacteria | 1705 |
| 191 | Ga0068862_100409336 | 3300005844 | Unclassified | 1270 |
| 192 | Ga0081539_10000056 | 3300005985 | Bacteria | 256522 |
| 193 | Ga0075363_100352318 | 3300006048 | Bacteria | 860 |
| 194 | Ga0075362_10180931 | 3300006177 | Unclassified | 1022 |
| 195 | Ga0075367_10055839 | 3300006178 | Unclassified | 2345 |
| 196 | Ga0075366_10136742 | 3300006195 | Bacteria | 1480 |
| 197 | Ga0097621_100036402 | 3300006237 | Bacteria | 3938 |
| 198 | Ga0097621_100081707 | 3300006237 | Bacteria | 2690 |
| 199 | Ga0097621_100142642 | 3300006237 | Bacteria | 2048 |
| 200 | Ga0097621_100753060 | 3300006237 | Bacteria | 900 |
| 201 | Ga0097621_100865444 | 3300006237 | Unclassified | 840 |
| 202 | Ga0097621_101995485 | 3300006237 | Unclassified | 554 |
| 203 | Ga0068871_100117506 | 3300006358 | Unclassified | 2243 |
| 204 | Ga0068871_100332427 | 3300006358 | Bacteria | 1340 |
| 205 | Ga0068871_100486426 | 3300006358 | Bacteria | 1111 |
| 206 | Ga0075428_100003026 | 3300006844 | Bacteria | 18353 |
| 207 | Ga0075428_100149414 | 3300006844 | Bacteria | 2538 |
| 208 | Ga0075428_100666418 | 3300006844 | Unclassified | 1109 |
| 209 | Ga0075428_100772308 | 3300006844 | Bacteria | 1022 |
| 210 | Ga0075428_101349215 | 3300006844 | Unclassified | 749 |
| 211 | Ga0075430_100011515 | 3300006846 | Bacteria | 7518 |
| 212 | Ga0075430_100016485 | 3300006846 | Bacteria | 6293 |
| 213 | Ga0075430_100027098 | 3300006846 | Bacteria | 4871 |
| 214 | Ga0075430_100036355 | 3300006846 | Unclassified | 4177 |
| 215 | Ga0075430_100374234 | 3300006846 | Bacteria | 1176 |
| 216 | Ga0075430_100801756 | 3300006846 | Unclassified | 776 |
| 217 | Ga0075430_100904861 | 3300006846 | Unclassified | 727 |
| 218 | Ga0075431_100000804 | 3300006847 | Bacteria | 27410 |
| 219 | Ga0075431_100112182 | 3300006847 | Unclassified | 2814 |
| 220 | Ga0075431_100158037 | 3300006847 | Unclassified | 2332 |
| 221 | Ga0075431_100177343 | 3300006847 | Bacteria | 2188 |
| 222 | Ga0075431_100746045 | 3300006847 | Unclassified | 955 |
| 223 | Ga0075431_101154477 | 3300006847 | Unclassified | 738 |
| 224 | Ga0075433_10030851 | 3300006852 | Bacteria | 4577 |
| 225 | Ga0075433_10255874 | 3300006852 | Bacteria | 1553 |
| 226 | Ga0075433_10283942 | 3300006852 | Bacteria | 1466 |
| 227 | Ga0075433_10804833 | 3300006852 | Bacteria | 821 |
| 228 | Ga0075434_100017800 | 3300006871 | Bacteria | 6853 |
| 229 | Ga0075434_101265786 | 3300006871 | Bacteria | 749 |
| 230 | Ga0075429_100007498 | 3300006880 | Bacteria | 9471 |
| 231 | Ga0075429_100046351 | 3300006880 | Bacteria | 3782 |
| 232 | Ga0075429_100213147 | 3300006880 | Bacteria | 1692 |
| 233 | Ga0068865_100090794 | 3300006881 | Bacteria | 2215 |
| 234 | Ga0075436_100116847 | 3300006914 | Bacteria | 1864 |
| 235 | Ga0097620_100007749 | 3300006931 | Bacteria | 10900 |
| 236 | Ga0097620_100120541 | 3300006931 | Bacteria | 2690 |
| 237 | Ga0097620_100357735 | 3300006931 | Unclassified | 1555 |
| 238 | Ga0097620_100453427 | 3300006931 | Bacteria | 1379 |
| 239 | Ga0097620_102075005 | 3300006931 | Bacteria | 628 |
| 240 | Ga0075435_100342547 | 3300007076 | Unclassified | 1281 |
| 241 | Ga0105240_11467915 | 3300009093 | Unclassified | 716 |
| 242 | Ga0111539_10000056 | 3300009094 | Bacteria | 114878 |
| 243 | Ga0111539_10013747 | 3300009094 | Bacteria | 10113 |
| 244 | Ga0111539_10131239 | 3300009094 | Unclassified | 2933 |
| 245 | Ga0111539_10591288 | 3300009094 | Bacteria | 1292 |
| 246 | Ga0111539_10627069 | 3300009094 | Bacteria | 1252 |
| 247 | Ga0111539_10663193 | 3300009094 | Bacteria | 1215 |
| 248 | Ga0111539_10814643 | 3300009094 | Bacteria | 1086 |
| 249 | Ga0111539_10829274 | 3300009094 | Bacteria | 1076 |
| 250 | Ga0111539_11040997 | 3300009094 | Bacteria | 951 |
| 251 | Ga0111539_12618676 | 3300009094 | Unclassified | 585 |
| 252 | Ga0105247_10164975 | 3300009101 | Bacteria | 1469 |
| 253 | Ga0114129_10006522 | 3300009147 | Bacteria | 16559 |
| 254 | Ga0114129_10010650 | 3300009147 | Bacteria | 13111 |
| 255 | Ga0114129_10011051 | 3300009147 | Bacteria | 12860 |
| 256 | Ga0114129_10017449 | 3300009147 | Bacteria | 10220 |
| 257 | Ga0114129_10020920 | 3300009147 | Bacteria | 9295 |
| 258 | Ga0114129_10044424 | 3300009147 | Bacteria | 6251 |
| 259 | Ga0114129_10118725 | 3300009147 | Bacteria | 3643 |
| 260 | Ga0114129_10143879 | 3300009147 | Bacteria | 3267 |
| 261 | Ga0114129_10265291 | 3300009147 | Bacteria | 2299 |
| 262 | Ga0114129_10288678 | 3300009147 | Bacteria | 2190 |
| 263 | Ga0114129_10346166 | 3300009147 | Bacteria | 1970 |
| 264 | Ga0114129_10880335 | 3300009147 | Bacteria | 1136 |
| 265 | Ga0114129_11008401 | 3300009147 | Bacteria | 1048 |
| 266 | Ga0114129_12032295 | 3300009147 | Bacteria | 694 |
| 267 | Ga0114129_12871494 | 3300009147 | Bacteria | 571 |
| 268 | Ga0114129_13183485 | 3300009147 | Unclassified | 534 |
| 269 | Ga0105243_11169251 | 3300009148 | Bacteria | 781 |
| 270 | Ga0105242_10292374 | 3300009176 | Unclassified | 1484 |
| 271 | Ga0105242_10295764 | 3300009176 | Bacteria | 1476 |
| 272 | Ga0105242_11193204 | 3300009176 | Unclassified | 780 |
| 273 | Ga0105248_10006564 | 3300009177 | Bacteria | 12756 |
| 274 | Ga0105248_10030221 | 3300009177 | Bacteria | 6048 |
| 275 | Ga0105248_10083398 | 3300009177 | Bacteria | 3596 |
| 276 | Ga0105248_10148322 | 3300009177 | Bacteria | 2646 |
| 277 | Ga0105248_10249918 | 3300009177 | Unclassified | 1996 |
| 278 | Ga0105248_10317981 | 3300009177 | Bacteria | 1753 |
| 279 | Ga0105248_11864846 | 3300009177 | Unclassified | 682 |
| 280 | Ga0105238_10136252 | 3300009551 | Bacteria | 2433 |
| 281 | Ga0105249_10022648 | 3300009553 | Bacteria | 5629 |
| 282 | Ga0105249_10660268 | 3300009553 | Bacteria | 1104 |
| 283 | Ga0105246_10241939 | 3300011119 | Unclassified | 1427 |
| 284 | Ga0105246_10585340 | 3300011119 | Unclassified | 962 |
| 285 | Ga0105246_10606086 | 3300011119 | Bacteria | 947 |
| 286 | Ga0105246_12101391 | 3300011119 | Unclassified | 547 |
| 287 | Ga0157325_1023617 | 3300012485 | Bacteria | 568 |
| 288 | Ga0157374_10048504 | 3300013296 | Unclassified | 3940 |
| 289 | Ga0157374_10272313 | 3300013296 | Unclassified | 1670 |
| 290 | Ga0157374_11197781 | 3300013296 | Unclassified | 781 |
| 291 | Ga0157374_11933077 | 3300013296 | Bacteria | 616 |
| 292 | Ga0157378_10129016 | 3300013297 | Bacteria | 2339 |
| 293 | Ga0157378_10761429 | 3300013297 | Bacteria | 992 |
| 294 | Ga0157378_11409869 | 3300013297 | Unclassified | 740 |
| 295 | Ga0157378_12410317 | 3300013297 | Unclassified | 578 |
| 296 | Ga0163162_10013149 | 3300013306 | Bacteria | 8082 |
| 297 | Ga0163162_10082498 | 3300013306 | Bacteria | 3287 |
| 298 | Ga0163162_11373494 | 3300013306 | Unclassified | 803 |
| 299 | Ga0163162_11615031 | 3300013306 | Bacteria | 740 |
| 300 | Ga0163162_12760163 | 3300013306 | Bacteria | 565 |
| 301 | Ga0157375_10043371 | 3300013308 | Unclassified | 4362 |
| 302 | Ga0157375_10113232 | 3300013308 | Bacteria | 2814 |
| 303 | Ga0157375_10171740 | 3300013308 | Unclassified | 2316 |
| 304 | Ga0157375_10182805 | 3300013308 | Bacteria | 2249 |
| 305 | Ga0157375_10501414 | 3300013308 | Bacteria | 1378 |
| 306 | Ga0157375_11094769 | 3300013308 | Unclassified | 933 |
| 307 | Ga0157375_12425179 | 3300013308 | Unclassified | 626 |
| 308 | Ga0163163_10302020 | 3300014325 | Bacteria | 1653 |
| 309 | Ga0163163_11062607 | 3300014325 | Unclassified | 873 |
| 310 | Ga0157380_10052513 | 3300014326 | Bacteria | 3228 |
| 311 | Ga0157380_10091328 | 3300014326 | Bacteria | 2514 |
| 312 | Ga0157380_10335656 | 3300014326 | Bacteria | 1408 |
| 313 | Ga0157380_10458220 | 3300014326 | Bacteria | 1227 |
| 314 | Ga0157380_11070473 | 3300014326 | Bacteria | 844 |
| 315 | Ga0157380_11498466 | 3300014326 | Unclassified | 728 |
| 316 | Ga0157380_11602051 | 3300014326 | Bacteria | 707 |
| 317 | Ga0157377_10028734 | 3300014745 | Bacteria | 2995 |
| 318 | Ga0157377_10052241 | 3300014745 | Bacteria | 2307 |
| 319 | Ga0157377_10405424 | 3300014745 | Unclassified | 930 |
| 320 | Ga0157377_10502348 | 3300014745 | Unclassified | 848 |
| 321 | Ga0157377_10508999 | 3300014745 | Unclassified | 843 |
| 322 | Ga0157377_11635910 | 3300014745 | Unclassified | 517 |
| 323 | Ga0157379_10023491 | 3300014968 | Bacteria | 5473 |
| 324 | Ga0157376_10042880 | 3300014969 | Bacteria | 3710 |
| 325 | Ga0157376_10103296 | 3300014969 | Unclassified | 2495 |
| 326 | Ga0157376_10440333 | 3300014969 | Unclassified | 1269 |
| 327 | Ga0157376_10945802 | 3300014969 | Bacteria | 882 |
| 328 | Ga0163161_10293050 | 3300017792 | Unclassified | 1279 |
| 329 | Ga0163161_10845385 | 3300017792 | Bacteria | 772 |
| 330 | Ga0163161_11040686 | 3300017792 | Unclassified | 701 |
| 331 | Ga0213876_10083391 | 3300021384 | Bacteria | 1691 |
| 332 | Ga0207697_10242877 | 3300025315 | Unclassified | 796 |
| 333 | Ga0207682_10001041 | 3300025893 | Bacteria | 12793 |
| 334 | Ga0207682_10010361 | 3300025893 | Bacteria | 3653 |
| 335 | Ga0207682_10057354 | 3300025893 | Bacteria | 1623 |
| 336 | Ga0207682_10120094 | 3300025893 | Bacteria | 1165 |
| 337 | Ga0207642_10063485 | 3300025899 | Bacteria | 1728 |
| 338 | Ga0207710_10643552 | 3300025900 | Unclassified | 555 |
| 339 | Ga0207688_10028330 | 3300025901 | Bacteria | 3081 |
| 340 | Ga0207688_10274605 | 3300025901 | Unclassified | 1026 |
| 341 | Ga0207680_10251383 | 3300025903 | Bacteria | 1221 |
| 342 | Ga0207680_10430075 | 3300025903 | Unclassified | 935 |
| 343 | Ga0207680_10946072 | 3300025903 | Bacteria | 617 |
| 344 | Ga0207699_10319325 | 3300025906 | Unclassified | 1089 |
| 345 | Ga0207645_10001335 | 3300025907 | Bacteria | 20268 |
| 346 | Ga0207645_10068974 | 3300025907 | Bacteria | 2262 |
| 347 | Ga0207645_10279685 | 3300025907 | Bacteria | 1108 |
| 348 | Ga0207645_10430027 | 3300025907 | Unclassified | 890 |
| 349 | Ga0207645_10722738 | 3300025907 | Archaea | 677 |
| 350 | Ga0207643_10001209 | 3300025908 | Bacteria | 15266 |
| 351 | Ga0207643_10016436 | 3300025908 | Bacteria | 4037 |
| 352 | Ga0207643_11118068 | 3300025908 | Unclassified | 508 |
| 353 | Ga0207705_10038281 | 3300025909 | Bacteria | 3433 |
| 354 | Ga0207705_10490362 | 3300025909 | Bacteria | 954 |
| 355 | Ga0207684_10302415 | 3300025910 | Unclassified | 1379 |
| 356 | Ga0207684_11412796 | 3300025910 | Unclassified | 569 |
| 357 | Ga0207654_10537146 | 3300025911 | Unclassified | 829 |
| 358 | Ga0207707_10216468 | 3300025912 | Bacteria | 1668 |
| 359 | Ga0207662_10939179 | 3300025918 | Bacteria | 613 |
| 360 | Ga0207657_10012933 | 3300025919 | Bacteria | 8207 |
| 361 | Ga0207657_11486621 | 3300025919 | Bacteria | 507 |
| 362 | Ga0207649_11119325 | 3300025920 | Unclassified | 621 |
| 363 | Ga0207652_10081332 | 3300025921 | Bacteria | 2833 |
| 364 | Ga0207646_10439760 | 3300025922 | Bacteria | 1177 |
| 365 | Ga0207681_10679253 | 3300025923 | Unclassified | 855 |
| 366 | Ga0207694_10243159 | 3300025924 | Bacteria | 1471 |
| 367 | Ga0207650_10363380 | 3300025925 | Unclassified | 1193 |
| 368 | Ga0207650_10726227 | 3300025925 | Unclassified | 840 |
| 369 | Ga0207650_11332790 | 3300025925 | Unclassified | 611 |
| 370 | Ga0207659_10000925 | 3300025926 | Bacteria | 17486 |
| 371 | Ga0207659_10013128 | 3300025926 | Bacteria | 5298 |
| 372 | Ga0207659_10035018 | 3300025926 | Unclassified | 3467 |
| 373 | Ga0207659_10092828 | 3300025926 | Bacteria | 2258 |
| 374 | Ga0207659_10102971 | 3300025926 | Unclassified | 2156 |
| 375 | Ga0207659_10477157 | 3300025926 | Bacteria | 1053 |
| 376 | Ga0207659_10531537 | 3300025926 | Bacteria | 998 |
| 377 | Ga0207659_10639488 | 3300025926 | Bacteria | 909 |
| 378 | Ga0207659_11588063 | 3300025926 | Bacteria | 558 |
| 379 | Ga0207659_11636883 | 3300025926 | Bacteria | 549 |
| 380 | Ga0207687_10494209 | 3300025927 | Bacteria | 1020 |
| 381 | Ga0207644_10211609 | 3300025931 | Unclassified | 1533 |
| 382 | Ga0207644_10719682 | 3300025931 | Bacteria | 833 |
| 383 | Ga0207690_10082484 | 3300025932 | Bacteria | 2249 |
| 384 | Ga0207690_11108301 | 3300025932 | Unclassified | 660 |
| 385 | Ga0207706_10001124 | 3300025933 | Bacteria | 27217 |
| 386 | Ga0207706_10226965 | 3300025933 | Bacteria | 1634 |
| 387 | Ga0207686_10462737 | 3300025934 | Unclassified | 978 |
| 388 | Ga0207670_10045336 | 3300025936 | Bacteria | 2914 |
| 389 | Ga0207670_10150115 | 3300025936 | Unclassified | 1728 |
| 390 | Ga0207670_11729907 | 3300025936 | Bacteria | 532 |
| 391 | Ga0207669_10000677 | 3300025937 | Bacteria | 14690 |
| 392 | Ga0207669_10058705 | 3300025937 | Bacteria | 2349 |
| 393 | Ga0207669_10120331 | 3300025937 | Bacteria | 1781 |
| 394 | Ga0207669_10351826 | 3300025937 | Bacteria | 1138 |
| 395 | Ga0207669_11316479 | 3300025937 | Unclassified | 614 |
| 396 | Ga0207704_10124232 | 3300025938 | Bacteria | 1773 |
| 397 | Ga0207704_11427993 | 3300025938 | Unclassified | 593 |
| 398 | Ga0207691_10012757 | 3300025940 | Bacteria | 8045 |
| 399 | Ga0207691_10024821 | 3300025940 | Bacteria | 5634 |
| 400 | Ga0207691_10073346 | 3300025940 | Bacteria | 3087 |
| 401 | Ga0207691_10209872 | 3300025940 | Bacteria | 1692 |
| 402 | Ga0207691_10388181 | 3300025940 | Bacteria | 1191 |
| 403 | Ga0207691_10588657 | 3300025940 | Unclassified | 942 |
| 404 | Ga0207711_10028577 | 3300025941 | Bacteria | 4694 |
| 405 | Ga0207711_10142789 | 3300025941 | Bacteria | 2155 |
| 406 | Ga0207689_10034777 | 3300025942 | Bacteria | 4184 |
| 407 | Ga0207689_10170555 | 3300025942 | Bacteria | 1793 |
| 408 | Ga0207689_10240418 | 3300025942 | Bacteria | 1497 |
| 409 | Ga0207689_10362789 | 3300025942 | Unclassified | 1205 |
| 410 | Ga0207661_11680719 | 3300025944 | Unclassified | 580 |
| 411 | Ga0207679_10112433 | 3300025945 | Unclassified | 2152 |
| 412 | Ga0207679_10985887 | 3300025945 | Bacteria | 772 |
| 413 | Ga0207667_10167366 | 3300025949 | Bacteria | 2259 |
| 414 | Ga0207651_10017149 | 3300025960 | Bacteria | 4268 |
| 415 | Ga0207651_10023469 | 3300025960 | Bacteria | 3795 |
| 416 | Ga0207651_10049718 | 3300025960 | Bacteria | 2842 |
| 417 | Ga0207651_10051639 | 3300025960 | Bacteria | 2799 |
| 418 | Ga0207651_10064739 | 3300025960 | Unclassified | 2560 |
| 419 | Ga0207651_10144493 | 3300025960 | Bacteria | 1842 |
| 420 | Ga0207651_10190060 | 3300025960 | Unclassified | 1637 |
| 421 | Ga0207651_10414316 | 3300025960 | Bacteria | 1149 |
| 422 | Ga0207712_10591755 | 3300025961 | Unclassified | 959 |
| 423 | Ga0207712_11455815 | 3300025961 | Bacteria | 613 |
| 424 | Ga0207668_10328405 | 3300025972 | Bacteria | 1272 |
| 425 | Ga0207640_10077733 | 3300025981 | Bacteria | 2257 |
| 426 | Ga0207640_10085887 | 3300025981 | Unclassified | 2165 |
| 427 | Ga0207658_10228663 | 3300025986 | Bacteria | 1569 |
| 428 | Ga0207658_10246046 | 3300025986 | Unclassified | 1517 |
| 429 | Ga0207658_11557500 | 3300025986 | Bacteria | 604 |
| 430 | Ga0207677_10754550 | 3300026023 | Bacteria | 868 |
| 431 | Ga0207703_10036715 | 3300026035 | Bacteria | 3901 |
| 432 | Ga0207703_10038271 | 3300026035 | Bacteria | 3827 |
| 433 | Ga0207703_10533430 | 3300026035 | Unclassified | 1105 |
| 434 | Ga0207703_12159553 | 3300026035 | Bacteria | 533 |
| 435 | Ga0207639_11260138 | 3300026041 | Bacteria | 694 |
| 436 | Ga0207678_10104883 | 3300026067 | Unclassified | 2412 |
| 437 | Ga0207708_10117783 | 3300026075 | Bacteria | 2067 |
| 438 | Ga0207708_10645933 | 3300026075 | Unclassified | 900 |
| 439 | Ga0207702_10593992 | 3300026078 | Bacteria | 1086 |
| 440 | Ga0207641_10030170 | 3300026088 | Bacteria | 4490 |
| 441 | Ga0207648_10011249 | 3300026089 | Bacteria | 8437 |
| 442 | Ga0207648_10031771 | 3300026089 | Bacteria | 4666 |
| 443 | Ga0207648_10175891 | 3300026089 | Unclassified | 1893 |
| 444 | Ga0207648_10398594 | 3300026089 | Bacteria | 1246 |
| 445 | Ga0207648_10532748 | 3300026089 | Unclassified | 1077 |
| 446 | Ga0207648_10601658 | 3300026089 | Bacteria | 1013 |
| 447 | Ga0207648_10669647 | 3300026089 | Unclassified | 960 |
| 448 | Ga0207676_10022811 | 3300026095 | Bacteria | 4608 |
| 449 | Ga0207676_10081397 | 3300026095 | Bacteria | 2631 |
| 450 | Ga0207676_10129232 | 3300026095 | Unclassified | 2145 |
| 451 | Ga0207674_10105673 | 3300026116 | Bacteria | 2793 |
| 452 | Ga0207675_100459279 | 3300026118 | Bacteria | 1263 |
| 453 | Ga0207675_100691950 | 3300026118 | Unclassified | 1028 |
| 454 | Ga0207683_10003513 | 3300026121 | Bacteria | 13673 |
| 455 | Ga0207683_10075577 | 3300026121 | Bacteria | 2982 |
| 456 | Ga0207683_10112474 | 3300026121 | Bacteria | 2438 |
| 457 | Ga0207683_10117505 | 3300026121 | Bacteria | 2385 |
| 458 | Ga0207683_10380946 | 3300026121 | Bacteria | 1297 |
| 459 | Ga0207698_10907617 | 3300026142 | Unclassified | 888 |
| 460 | Ga0207698_10963931 | 3300026142 | Unclassified | 862 |
| 461 | Ga0207698_11405405 | 3300026142 | Bacteria | 713 |
| 462 | Ga0209981_1043577 | 3300027378 | Unclassified | 673 |
| 463 | Ga0209983_1047510 | 3300027665 | Unclassified | 935 |
| 464 | Ga0207428_10002483 | 3300027907 | Bacteria | 18414 |
| 465 | Ga0268266_10099739 | 3300028379 | Bacteria | 2557 |
| 466 | Ga0268266_10329906 | 3300028379 | Bacteria | 1430 |
| 467 | Ga0268266_10577417 | 3300028379 | Bacteria | 1079 |
| 468 | Ga0268265_10199219 | 3300028380 | Bacteria | 1736 |
| 469 | Ga0268265_12331523 | 3300028380 | Unclassified | 542 |
| 470 | Ga0268264_10056583 | 3300028381 | Bacteria | 3279 |
| 471 | Ga0268264_10059743 | 3300028381 | Bacteria | 3195 |
| 472 | Ga0268264_10781124 | 3300028381 | Unclassified | 953 |
| 473 | Ga0307408_101887569 | 3300031548 | Unclassified | 572 |
| 474 | Ga0307405_10591733 | 3300031731 | Unclassified | 904 |
| 475 | Ga0307413_11027854 | 3300031824 | Unclassified | 708 |
| 476 | Ga0307407_11641427 | 3300031903 | Bacteria | 511 |
| 477 | Ga0307412_11284238 | 3300031911 | Bacteria | 658 |
| 478 | Ga0307409_100269973 | 3300031995 | Bacteria | 1566 |
| 479 | Ga0307416_100396903 | 3300032002 | Bacteria | 1415 |
| 480 | Ga0307411_11221541 | 3300032005 | Unclassified | 682 |
| 481 | Ga0307415_101016024 | 3300032126 | Bacteria | 772 |
| 482 | Ga0373945_0160706 | 3300035116 | Bacteria | 916 |
| 483 | Ga0373956_0394287 | 3300035119 | Bacteria | 660 |
| 484 | Ga0373943_0056281 | 3300035170 | Bacteria | 1951 |
| 485 | Ga0373955_0216570 | 3300035172 | Bacteria | 1143 |
| 486 | Ga0373955_0495469 | 3300035172 | Unclassified | 746 |
| 487 | Ga0373955_1031132 | 3300035172 | Bacteria | 507 |
| 488 | Ga0373935_0499540 | 3300035692 | Bacteria | 883 |
| 489 | Ga0373927_0674316 | 3300035695 | Unclassified | 683 |
| 490 | Ga0373947_0196793 | 3300035725 | Unclassified | 1317 |
| 491 | Ga0373947_0215753 | 3300035725 | Bacteria | 1260 |
| 492 | Ga0373937_0125331 | 3300036401 | Bacteria | 2396 |
| 493 | Ga0373937_0153757 | 3300036401 | Unclassified | 2156 |
| 494 | Ga0373937_0549893 | 3300036401 | Bacteria | 1097 |
| 495 | Ga0373937_0610388 | 3300036401 | Bacteria | 1035 |
| 496 | Ga0395905_1144235 | 3300037471 | Bacteria | 682 |
| 497 | Ga0436364_0627217 | 3300037853 | Bacteria | 6369 |
| 498 | Ga0395901_1364144 | 3300038443 | Bacteria | 669 |
| 499 | Ga0436365_1573372 | 3300039437 | Bacteria | 871 |
| 500 | Ga0436365_1784715 | 3300039437 | Unclassified | 731 |
| 501 | Ga0436360_0735281 | 3300039438 | Bacteria | 2144 |
| 502 | Ga0451807_0831803 | 3300041486 | Bacteria | 563 |
| 503 | Ga0439445_0255895 | 3300042004 | Bacteria | 523 |
| 504 | Ga0439449_0258659 | 3300042007 | Bacteria | 655 |
| 505 | Ga0439462_0175885 | 3300042015 | Bacteria | 606 |
| 506 | Ga0450920_051942 | 3300042122 | Bacteria | 823 |
| 507 | Ga0439434_0281985 | 3300042435 | Bacteria | 572 |
| 508 | Ga0439435_0010420 | 3300042436 | Bacteria | 2207 |
| 509 | Ga0439435_0071066 | 3300042436 | Bacteria | 1030 |
| 510 | Ga0439444_0004617 | 3300042437 | Bacteria | 2011 |
| 511 | Ga0451577_0060549 | 3300042876 | Bacteria | 3375 |
| 512 | Ga0453684_0074567 | 3300044712 | Bacteria | 4270 |
| 513 | Ga0466971_0329145 | 3300044719 | Bacteria | 737 |
| 514 | Ga0466959_0115549 | 3300045049 | Bacteria | 1912 |
| 515 | Ga0451576_0224467 | 3300045051 | Bacteria | 1961 |
| 516 | Ga0451576_0526067 | 3300045051 | Unclassified | 1242 |
| 517 | Ga0466958_0662926 | 3300045836 | Bacteria | 679 |
| 518 | Ga0466967_1004699 | 3300045976 | Bacteria | 831 |
| 519 | Ga0495603_0031800 | 3300046455 | Bacteria | 3177 |
| 520 | Ga0495590_0157037 | 3300046457 | Unclassified | 826 |
| 521 | Ga0495629_1088653 | 3300046459 | Bacteria | 517 |
| 522 | Ga0495638_0095954 | 3300046460 | Bacteria | 1780 |
| 523 | Ga0495580_0058076 | 3300046472 | Bacteria | 2723 |
| 524 | Ga0495639_0024327 | 3300046475 | Bacteria | 2666 |
| 525 | Ga0495594_0032745 | 3300046499 | Bacteria | 2823 |
| 526 | Ga0495586_0060054 | 3300046535 | Bacteria | 2067 |
| 527 | Ga0495598_0216924 | 3300046537 | Bacteria | 697 |
| 528 | Ga0495598_0260163 | 3300046537 | Unclassified | 645 |
| 529 | Ga0495621_0065301 | 3300046539 | Bacteria | 1329 |
| 530 | Ga0495621_0097705 | 3300046539 | Bacteria | 1114 |
| 531 | Ga0495656_0140006 | 3300046615 | Bacteria | 1160 |
| 532 | Ga0495656_0347763 | 3300046615 | Bacteria | 768 |
| 533 | Ga0495656_0353031 | 3300046615 | Bacteria | 762 |
| 534 | Ga0495635_0147991 | 3300046663 | Bacteria | 1599 |
| 535 | Ga0495659_0056994 | 3300046664 | Bacteria | 1435 |
| 536 | Ga0495659_0166005 | 3300046664 | Bacteria | 893 |
| 537 | Ga0495588_0287779 | 3300046674 | Bacteria | 866 |
| 538 | Ga0495599_0552747 | 3300046678 | Bacteria | 674 |
| 539 | Ga0495658_0173323 | 3300046683 | Bacteria | 1336 |
| 540 | Ga0495670_0214416 | 3300046691 | Bacteria | 1022 |
| 541 | Ga0495581_0529819 | 3300047315 | Bacteria | 684 |
| 542 | Ga0495674_0348200 | 3300047319 | Bacteria | 1203 |
| 543 | Ga0495676_0727590 | 3300047321 | Bacteria | 641 |
| 544 | Ga0495675_0220786 | 3300047444 | Bacteria | 1147 |
| 545 | Ga0496102_1044863 | 3300048905 | Unclassified | 737 |
| 546 | Ga0496104_0280830 | 3300048907 | Bacteria | 1578 |
| 547 | Ga0496105_1175988 | 3300048908 | Bacteria | 566 |
| 548 | Ga0496106_0121479 | 3300048909 | Bacteria | 2042 |
| 549 | Ga0496108_0658058 | 3300048911 | Bacteria | 910 |
| 550 | Ga0496109_0190521 | 3300048912 | Bacteria | 1927 |
| 551 | Ga0496109_0365360 | 3300048912 | Unclassified | 1363 |
| 552 | Ga0496109_0632373 | 3300048912 | Bacteria | 1007 |
| 553 | Ga0496109_1831088 | 3300048912 | Bacteria | 540 |
| 554 | Ga0496110_1108163 | 3300048913 | Bacteria | 700 |
| 555 | Ga0496113_0137539 | 3300048916 | Bacteria | 1920 |
| 556 | Ga0496114_1773660 | 3300048917 | Unclassified | 505 |
| 557 | Ga0501291_171953 | 3300049514 | Bacteria | 501 |
| 558 | Ga0501031_0125244 | 3300049568 | Bacteria | 1678 |
| 559 | Ga0501031_0175078 | 3300049568 | Bacteria | 1402 |
| 560 | Ga0501033_0121742 | 3300049570 | Unclassified | 1893 |
| 561 | Ga0501033_0728871 | 3300049570 | Bacteria | 673 |
| 562 | Ga0501034_0188605 | 3300049571 | Bacteria | 2025 |
| 563 | Ga0501039_0128158 | 3300049575 | Bacteria | 1991 |
| 564 | Ga0501039_0169871 | 3300049575 | Bacteria | 1714 |
| 565 | Ga0501039_0247032 | 3300049575 | Bacteria | 1403 |
| 566 | Ga0501039_1003327 | 3300049575 | Bacteria | 649 |
| 567 | Ga0501040_0008884 | 3300049576 | Bacteria | 6533 |
| 568 | Ga0501040_0168715 | 3300049576 | Bacteria | 1549 |
| 569 | Ga0501040_0716446 | 3300049576 | Unclassified | 724 |
| 570 | Ga0501041_0032039 | 3300049577 | Bacteria | 3177 |
| 571 | Ga0501041_0112275 | 3300049577 | Bacteria | 1691 |
| 572 | Ga0501041_0814375 | 3300049577 | Unclassified | 599 |
| 573 | Ga0501042_0004742 | 3300049578 | Bacteria | 8680 |
| 574 | Ga0501042_0582566 | 3300049578 | Bacteria | 813 |
| 575 | Ga0501043_0722649 | 3300049579 | Unclassified | 726 |
| 576 | Ga0501046_0020141 | 3300049580 | Bacteria | 5522 |
| 577 | Ga0501046_0963926 | 3300049580 | Bacteria | 593 |
| 578 | Ga0501047_0048818 | 3300049581 | Bacteria | 4087 |
| 579 | Ga0501047_0205863 | 3300049581 | Bacteria | 1827 |
| 580 | Ga0501048_0081154 | 3300049582 | Bacteria | 2288 |
| 581 | Ga0501048_0246255 | 3300049582 | Unclassified | 1268 |
| 582 | Ga0501068_0085332 | 3300049584 | Bacteria | 1943 |
| 583 | Ga0501068_0256125 | 3300049584 | Unclassified | 1116 |
| 584 | Ga0501068_1130821 | 3300049584 | Unclassified | 518 |
| 585 | Ga0501070_0856183 | 3300049586 | Bacteria | 711 |
| 586 | Ga0501071_0094587 | 3300049587 | Bacteria | 2198 |
| 587 | Ga0501071_0504247 | 3300049587 | Unclassified | 928 |
| 588 | Ga0501072_0058925 | 3300049588 | Bacteria | 3027 |
| 589 | Ga0501072_0101766 | 3300049588 | Unclassified | 2283 |
| 590 | Ga0501072_0108370 | 3300049588 | Bacteria | 2210 |
| 591 | Ga0501072_0141018 | 3300049588 | Bacteria | 1921 |
| 592 | Ga0501072_0258397 | 3300049588 | Unclassified | 1387 |
| 593 | Ga0501072_0542305 | 3300049588 | Bacteria | 919 |
| 594 | Ga0501072_0940035 | 3300049588 | Bacteria | 675 |
| 595 | Ga0501074_0064981 | 3300049590 | Bacteria | 2627 |
| 596 | Ga0501074_1037766 | 3300049590 | Unclassified | 576 |
| 597 | Ga0501075_0006605 | 3300049591 | Bacteria | 7993 |
| 598 | Ga0501075_0007722 | 3300049591 | Bacteria | 7468 |
| 599 | Ga0501075_0109865 | 3300049591 | Bacteria | 2096 |
| 600 | Ga0501075_0273958 | 3300049591 | Unclassified | 1286 |
| 601 | Ga0501076_0027446 | 3300049592 | Bacteria | 4416 |
| 602 | Ga0501076_0031465 | 3300049592 | Bacteria | 4138 |
| 603 | Ga0501076_0435472 | 3300049592 | Bacteria | 1079 |
| 604 | Ga0501077_0087326 | 3300049593 | Bacteria | 1977 |
| 605 | Ga0501077_0272436 | 3300049593 | Bacteria | 1077 |
| 606 | Ga0501202_031298 | 3300049652 | Unclassified | 1111 |
| 607 | Ga0501079_0094366 | 3300049741 | Unclassified | 2318 |
| 608 | Ga0501080_0735213 | 3300049742 | Unclassified | 869 |
| 609 | Ga0501081_0010128 | 3300049743 | Bacteria | 6151 |
| 610 | Ga0501081_0318735 | 3300049743 | Bacteria | 1142 |
| 611 | Ga0501081_0433806 | 3300049743 | Unclassified | 975 |
| 612 | Ga0501083_0177623 | 3300049744 | Unclassified | 1391 |
| 613 | Ga0501083_0441185 | 3300049744 | Unclassified | 847 |
| 614 | Ga0501083_0529277 | 3300049744 | Bacteria | 767 |
| 615 | Ga0501035_1407961 | 3300049822 | Bacteria | 534 |
| 616 | Ga0501045_0130429 | 3300049824 | Bacteria | 1868 |
| 617 | Ga0501045_0356571 | 3300049824 | Bacteria | 1088 |
| 618 | Ga0501045_1254058 | 3300049824 | Bacteria | 540 |
| 619 | nmdc:mga03n38_475640_c1 | 3300050490 | Bacteria | 698 |
| 620 | nmdc:mga00v17_266342_c1 | 3300050491 | Unclassified | 1112 |
| 621 | nmdc:mga06z11_127425_c1 | 3300050494 | Unclassified | 1426 |
| 622 | nmdc:mga05p37_147825_c1 | 3300050507 | Bacteria | 2876 |
| 623 | nmdc:mga05p37_162599_c1 | 3300050507 | Bacteria | 2726 |
| 624 | nmdc:mga05p37_18473_c1 | 3300050507 | Bacteria | 8423 |
| 625 | nmdc:mga05p37_21673_c1 | 3300050507 | Bacteria | 7784 |
| 626 | nmdc:mga05p37_249633_c1 | 3300050507 | Bacteria | 2129 |
| 627 | nmdc:mga05p37_279883_c1 | 3300050507 | Unclassified | 1990 |
| 628 | nmdc:mga05p37_570537_c1 | 3300050507 | Bacteria | 1284 |
| 629 | nmdc:mga05p37_6982_c1 | 3300050507 | Bacteria | 13308 |
| 630 | nmdc:mga05p37_940374_c1 | 3300050507 | Bacteria | 926 |
| 631 | nmdc:mga09592_103866_c1 | 3300050508 | Unclassified | 2435 |
| 632 | nmdc:mga09592_282052_c1 | 3300050508 | Bacteria | 1441 |
| 633 | nmdc:mga09592_45734_c2 | 3300050508 | Bacteria | 2740 |
| 634 | nmdc:mga09592_5892_c1 | 3300050508 | Bacteria | 9998 |
| 635 | nmdc:mga0qj67_197595_c1 | 3300050509 | Unclassified | 1634 |
| 636 | nmdc:mga0qj67_272179_c1 | 3300050509 | Bacteria | 1373 |
| 637 | nmdc:mga0qj67_292942_c1 | 3300050509 | Bacteria | 1319 |
| 638 | nmdc:mga0qj67_41466_c1 | 3300050509 | Bacteria | 3621 |
| 639 | nmdc:mga0qj67_5884_c1 | 3300050509 | Bacteria | 8984 |
| 640 | nmdc:mga0qj67_78764_c1 | 3300050509 | Unclassified | 2638 |
| 641 | nmdc:mga0qj67_802710_c1 | 3300050509 | Unclassified | 745 |
| 642 | nmdc:mga06r32_13675_c1 | 3300050510 | Bacteria | 7360 |
| 643 | nmdc:mga06r32_1410425_c1 | 3300050510 | Bacteria | 638 |
| 644 | nmdc:mga06r32_146341_c1 | 3300050510 | Unclassified | 2340 |
| 645 | nmdc:mga06r32_15513_c1 | 3300050510 | Bacteria | 6919 |
| 646 | nmdc:mga06r32_23758_c1 | 3300050510 | Bacteria | 5678 |
| 647 | nmdc:mga06r32_328374_c1 | 3300050510 | Bacteria | 1515 |
| 648 | nmdc:mga06r32_34369_c1 | 3300050510 | Bacteria | 4780 |
| 649 | nmdc:mga06r32_91349_c1 | 3300050510 | Unclassified | 2975 |
| 650 | nmdc:mga08y16_1311_c1 | 3300050511 | Bacteria | 24756 |
| 651 | nmdc:mga08y16_166464_c1 | 3300050511 | Bacteria | 2290 |
| 652 | nmdc:mga08y16_40988_c1 | 3300050511 | Bacteria | 4851 |
| 653 | nmdc:mga08y16_543577_c1 | 3300050511 | Bacteria | 1176 |
| 654 | nmdc:mga08y16_79329_c1 | 3300050511 | Unclassified | 3421 |
| 655 | nmdc:mga08y16_801129_c1 | 3300050511 | Bacteria | 935 |
| 656 | nmdc:mga0n895_1075076_c1 | 3300050512 | Bacteria | 783 |
| 657 | nmdc:mga0n895_1406937_c1 | 3300050512 | Bacteria | 666 |
| 658 | nmdc:mga0n895_272820_c1 | 3300050512 | Unclassified | 1716 |
| 659 | nmdc:mga0n895_475166_c1 | 3300050512 | Bacteria | 1261 |
| 660 | nmdc:mga0rr50_181166_c1 | 3300050513 | Unclassified | 1722 |
| 661 | nmdc:mga0rr50_284589_c1 | 3300050513 | Bacteria | 1380 |
| 662 | nmdc:mga08x19_119768_c1 | 3300050514 | Unclassified | 1764 |
| 663 | nmdc:mga08x19_276269_c1 | 3300050514 | Bacteria | 1163 |
| 664 | nmdc:mga0a205_142561_c1 | 3300050515 | Bacteria | 2296 |
| 665 | nmdc:mga0a205_200356_c2 | 3300050515 | Bacteria | 1589 |
| 666 | nmdc:mga0a205_38006_c1 | 3300050515 | Bacteria | 4630 |
| 667 | nmdc:mga0a205_631535_c1 | 3300050515 | Bacteria | 923 |
| 668 | nmdc:mga0a205_68965_c1 | 3300050515 | Bacteria | 3415 |
| 669 | Ga0495612_0413687 | 3300053078 | Bacteria | 614 |
| 670 | Ga0495619_0154142 | 3300053085 | Bacteria | 1585 |
| 671 | Ga0495619_0371143 | 3300053085 | Bacteria | 989 |
| 672 | Ga0500641_0000772 | 3300053096 | Bacteria | 11618 |
| 673 | Ga0500568_0018910 | 3300053139 | Bacteria | 3005 |
| 674 | Ga0500616_0000188 | 3300053153 | Bacteria | 101183 |
| 675 | Ga0500645_000164 | 3300053730 | Bacteria | 51803 |
| 676 | Ga0501084_0015972 | 3300054114 | Bacteria | 6231 |
| 677 | Ga0501084_0469648 | 3300054114 | Bacteria | 1063 |
| 678 | Ga0501084_0476149 | 3300054114 | Bacteria | 1055 |
| 679 | Ga0590071_013126 | 3300059421 | Bacteria | 1941 |
| 680 | Ga0590071_017054 | 3300059421 | Bacteria | 1704 |
| 681 | Ga0590074_040236 | 3300059423 | Bacteria | 840 |
| 682 | Ga0590075_003202 | 3300059424 | Bacteria | 3895 |
| 683 | Ga0590075_006059 | 3300059424 | Bacteria | 2862 |
| 684 | Ga0590077_006077 | 3300059426 | Bacteria | 2476 |
| 685 | Ga0590077_037794 | 3300059426 | Unclassified | 1067 |
| 686 | Ga0501082_0057336 | 3300060353 | Bacteria | 3356 |
| 687 | Ga0501082_0061054 | 3300060353 | Bacteria | 3245 |
| 688 | Ga0501082_0774658 | 3300060353 | Unclassified | 839 |
| 689 | Ga0466962_0202268 | 3300061719 | Bacteria | 971 |
| 690 | Ga0530510_0026022 | 3300061734 | Bacteria | 4185 |
| 691 | Ga0530510_0085223 | 3300061734 | Bacteria | 2302 |
| 692 | Ga0530510_1027148 | 3300061734 | Unclassified | 631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025910 | Ga0207684_11412796 | Ga0207684_114127961 | 106 |
| 2 | 3300006048 | Ga0075363_100352318 | Ga0075363_1003523182 | 112 |
| 3 | 3300006177 | Ga0075362_10180931 | Ga0075362_101809312 | 112 |
| 4 | 3300006178 | Ga0075367_10055839 | Ga0075367_100558392 | 112 |
| 5 | 3300006195 | Ga0075366_10136742 | Ga0075366_101367422 | 112 |
| 6 | 3300032126 | Ga0307415_101016024 | Ga0307415_1010160242 | 112 |
| 7 | 3300006871 | Ga0075434_101265786 | Ga0075434_1012657862 | 113 |
| 8 | 3300026089 | Ga0207648_10532748 | Ga0207648_105327482 | 113 |
| 9 | 3300049586 | Ga0501070_0856183 | Ga0501070_0856183_36_407 | 113 |
| 10 | 3300049588 | Ga0501072_0108370 | Ga0501072_0108370_1812_2183 | 113 |
| 11 | 3300049743 | Ga0501081_0318735 | Ga0501081_0318735_709_1080 | 113 |
| 12 | 3300050515 | nmdc:mga0a205_631535_c1 | nmdc:mga0a205_631535_c1_532_894 | 113 |
| 13 | 3300054114 | Ga0501084_0476149 | Ga0501084_0476149_34_405 | 113 |
| 14 | 3300046664 | Ga0495659_0166005 | Ga0495659_0166005_130_498 | 116 |
| 15 | 3300013297 | Ga0157378_10761429 | Ga0157378_107614292 | 117 |
| 16 | 3300047315 | Ga0495581_0529819 | Ga0495581_0529819_152_511 | 117 |
| 17 | 3300005353 | Ga0070669_101108482 | Ga0070669_1011084822 | 119 |
| 18 | 3300005354 | Ga0070675_100053387 | Ga0070675_1000533872 | 119 |
| 19 | 3300005356 | Ga0070674_101877689 | Ga0070674_1018776891 | 119 |
| 20 | 3300013297 | Ga0157378_12410317 | Ga0157378_124103171 | 119 |
| 21 | 3300014326 | Ga0157380_10458220 | Ga0157380_104582202 | 119 |
| 22 | 3300014745 | Ga0157377_10508999 | Ga0157377_105089992 | 119 |
| 23 | 3300025926 | Ga0207659_10531537 | Ga0207659_105315372 | 119 |
| 24 | 3300050511 | nmdc:mga08y16_166464_c1 | nmdc:mga08y16_166464_c1_783_1145 | 119 |
| 25 | 3300013296 | Ga0157374_11197781 | Ga0157374_111977811 | 122 |
| 26 | 3300046472 | Ga0495580_0058076 | Ga0495580_0058076_1361_1807 | 122 |
| 27 | 3300046475 | Ga0495639_0024327 | Ga0495639_0024327_392_838 | 122 |
| 28 | 3300049575 | Ga0501039_0169871 | Ga0501039_0169871_613_999 | 123 |
| 29 | 3300049577 | Ga0501041_0112275 | Ga0501041_0112275_98_484 | 123 |
| 30 | 3300049578 | Ga0501042_0004742 | Ga0501042_0004742_8193_8579 | 123 |
| 31 | 3300049584 | Ga0501068_0085332 | Ga0501068_0085332_1526_1912 | 123 |
| 32 | 3300049587 | Ga0501071_0094587 | Ga0501071_0094587_195_581 | 123 |
| 33 | 3300049590 | Ga0501074_0064981 | Ga0501074_0064981_1756_2142 | 123 |
| 34 | 3300049591 | Ga0501075_0007722 | Ga0501075_0007722_1464_1850 | 123 |
| 35 | 3300049592 | Ga0501076_0031465 | Ga0501076_0031465_3586_3972 | 123 |
| 36 | 3300049593 | Ga0501077_0087326 | Ga0501077_0087326_539_925 | 123 |
| 37 | 3300049824 | Ga0501045_0356571 | Ga0501045_0356571_621_1007 | 123 |
| 38 | 3300060353 | Ga0501082_0057336 | Ga0501082_0057336_2798_3184 | 123 |
| 39 | 3300061734 | Ga0530510_0085223 | Ga0530510_0085223_372_758 | 123 |
| 40 | 3300005535 | Ga0070684_100887890 | Ga0070684_1008878902 | 124 |
| 41 | 3300011119 | Ga0105246_12101391 | Ga0105246_121013911 | 124 |
| 42 | 3300021384 | Ga0213876_10083391 | Ga0213876_100833912 | 124 |
| 43 | 3300035172 | Ga0373955_0495469 | Ga0373955_0495469_108_551 | 124 |
| 44 | 3300036401 | Ga0373937_0125331 | Ga0373937_0125331_1246_1689 | 124 |
| 45 | 3300039437 | Ga0436365_1573372 | Ga0436365_1573372_259_645 | 124 |
| 46 | 3300046691 | Ga0495670_0214416 | Ga0495670_0214416_349_735 | 124 |
| 47 | 3300005293 | Ga0065715_10647077 | Ga0065715_106470771 | 125 |
| 48 | 3300005333 | Ga0070677_10317139 | Ga0070677_103171391 | 125 |
| 49 | 3300005335 | Ga0070666_10834804 | Ga0070666_108348042 | 125 |
| 50 | 3300005340 | Ga0070689_100139028 | Ga0070689_1001390282 | 125 |
| 51 | 3300005355 | Ga0070671_100088895 | Ga0070671_1000888952 | 125 |
| 52 | 3300005543 | Ga0070672_100152116 | Ga0070672_1001521162 | 125 |
| 53 | 3300005615 | Ga0070702_100294335 | Ga0070702_1002943351 | 125 |
| 54 | 3300005842 | Ga0068858_100051880 | Ga0068858_1000518802 | 125 |
| 55 | 3300005843 | Ga0068860_100103054 | Ga0068860_1001030542 | 125 |
| 56 | 3300006237 | Ga0097621_101995485 | Ga0097621_1019954851 | 125 |
| 57 | 3300009101 | Ga0105247_10164975 | Ga0105247_101649752 | 125 |
| 58 | 3300009176 | Ga0105242_11193204 | Ga0105242_111932042 | 125 |
| 59 | 3300009177 | Ga0105248_10006564 | Ga0105248_100065645 | 125 |
| 60 | 3300013297 | Ga0157378_10129016 | Ga0157378_101290162 | 125 |
| 61 | 3300013306 | Ga0163162_10082498 | Ga0163162_100824982 | 125 |
| 62 | 3300013308 | Ga0157375_10171740 | Ga0157375_101717403 | 125 |
| 63 | 3300014968 | Ga0157379_10023491 | Ga0157379_100234913 | 125 |
| 64 | 3300025900 | Ga0207710_10643552 | Ga0207710_106435521 | 125 |
| 65 | 3300025903 | Ga0207680_10430075 | Ga0207680_104300752 | 125 |
| 66 | 3300025931 | Ga0207644_10211609 | Ga0207644_102116092 | 125 |
| 67 | 3300025934 | Ga0207686_10462737 | Ga0207686_104627372 | 125 |
| 68 | 3300025936 | Ga0207670_10150115 | Ga0207670_101501152 | 125 |
| 69 | 3300025940 | Ga0207691_10012757 | Ga0207691_100127573 | 125 |
| 70 | 3300025941 | Ga0207711_10142789 | Ga0207711_101427892 | 125 |
| 71 | 3300025960 | Ga0207651_10190060 | Ga0207651_101900602 | 125 |
| 72 | 3300026035 | Ga0207703_10533430 | Ga0207703_105334302 | 125 |
| 73 | 3300028381 | Ga0268264_10059743 | Ga0268264_100597432 | 125 |
| 74 | 3300039437 | Ga0436365_1784715 | Ga0436365_1784715_261_650 | 125 |
| 75 | 3300049570 | Ga0501033_0728871 | Ga0501033_0728871_104_517 | 125 |
| 76 | 3300049577 | Ga0501041_0814375 | Ga0501041_0814375_14_427 | 125 |
| 77 | 3300049588 | Ga0501072_0141018 | Ga0501072_0141018_1044_1457 | 125 |
| 78 | 3300003203 | JGI25406J46586_10001877 | JGI25406J46586_100018777 | 126 |
| 79 | 3300005355 | Ga0070671_100954950 | Ga0070671_1009549502 | 126 |
| 80 | 3300005536 | Ga0070697_100534178 | Ga0070697_1005341782 | 126 |
| 81 | 3300005617 | Ga0068859_100357767 | Ga0068859_1003577672 | 126 |
| 82 | 3300005841 | Ga0068863_100009062 | Ga0068863_1000090623 | 126 |
| 83 | 3300005985 | Ga0081539_10000056 | Ga0081539_1000005635 | 126 |
| 84 | 3300006237 | Ga0097621_100036402 | Ga0097621_1000364024 | 126 |
| 85 | 3300006852 | Ga0075433_10804833 | Ga0075433_108048332 | 126 |
| 86 | 3300006880 | Ga0075429_100213147 | Ga0075429_1002131472 | 126 |
| 87 | 3300006931 | Ga0097620_100357735 | Ga0097620_1003577352 | 126 |
| 88 | 3300009093 | Ga0105240_11467915 | Ga0105240_114679152 | 126 |
| 89 | 3300009094 | Ga0111539_11040997 | Ga0111539_110409971 | 126 |
| 90 | 3300009147 | Ga0114129_10017449 | Ga0114129_100174494 | 126 |
| 91 | 3300009147 | Ga0114129_10346166 | Ga0114129_103461662 | 126 |
| 92 | 3300009176 | Ga0105242_10295764 | Ga0105242_102957642 | 126 |
| 93 | 3300009177 | Ga0105248_10148322 | Ga0105248_101483222 | 126 |
| 94 | 3300014969 | Ga0157376_10042880 | Ga0157376_100428802 | 126 |
| 95 | 3300025931 | Ga0207644_10719682 | Ga0207644_107196822 | 126 |
| 96 | 3300035725 | Ga0373947_0215753 | Ga0373947_0215753_184_564 | 126 |
| 97 | 3300046535 | Ga0495586_0060054 | Ga0495586_0060054_475_867 | 126 |
| 98 | 3300046615 | Ga0495656_0140006 | Ga0495656_0140006_267_653 | 126 |
| 99 | 3300048912 | Ga0496109_1831088 | Ga0496109_1831088_116_508 | 126 |
| 100 | 3300049575 | Ga0501039_1003327 | Ga0501039_1003327_177_590 | 126 |
| 101 | 3300050507 | nmdc:mga05p37_18473_c1 | nmdc:mga05p37_18473_c1_6572_6958 | 126 |
| 102 | 3300050512 | nmdc:mga0n895_1075076_c1 | nmdc:mga0n895_1075076_c1_169_564 | 126 |
| 103 | 3300050512 | nmdc:mga0n895_475166_c1 | nmdc:mga0n895_475166_c1_327_713 | 126 |
| 104 | 3300050513 | nmdc:mga0rr50_284589_c1 | nmdc:mga0rr50_284589_c1_509_904 | 126 |
| 105 | 3300050514 | nmdc:mga08x19_276269_c1 | nmdc:mga08x19_276269_c1_627_1022 | 126 |
| 106 | 3300005564 | Ga0070664_100529507 | Ga0070664_1005295071 | 127 |
| 107 | 3300025912 | Ga0207707_10216468 | Ga0207707_102164682 | 127 |
| 108 | 3300025918 | Ga0207662_10939179 | Ga0207662_109391791 | 127 |
| 109 | 3300025919 | Ga0207657_11486621 | Ga0207657_114866211 | 127 |
| 110 | 3300025945 | Ga0207679_10985887 | Ga0207679_109858871 | 127 |
| 111 | 3300031548 | Ga0307408_101887569 | Ga0307408_1018875691 | 127 |
| 112 | 3300031731 | Ga0307405_10591733 | Ga0307405_105917331 | 127 |
| 113 | 3300032002 | Ga0307416_100396903 | Ga0307416_1003969032 | 127 |
| 114 | 3300038443 | Ga0395901_1364144 | Ga0395901_1364144_33_425 | 127 |
| 115 | 3300044719 | Ga0466971_0329145 | Ga0466971_0329145_20_406 | 127 |
| 116 | 3300045049 | Ga0466959_0115549 | Ga0466959_0115549_152_538 | 127 |
| 117 | 3300045836 | Ga0466958_0662926 | Ga0466958_0662926_148_534 | 127 |
| 118 | 3300046537 | Ga0495598_0216924 | Ga0495598_0216924_231_617 | 127 |
| 119 | 3300049584 | Ga0501068_1130821 | Ga0501068_1130821_49_468 | 127 |
| 120 | 3300059421 | Ga0590071_013126 | Ga0590071_013126_243_659 | 127 |
| 121 | 3300059424 | Ga0590075_003202 | Ga0590075_003202_486_902 | 127 |
| 122 | 3300059426 | Ga0590077_037794 | Ga0590077_037794_311_727 | 127 |
| 123 | 3300061719 | Ga0466962_0202268 | Ga0466962_0202268_354_740 | 127 |
| 124 | 3300061734 | Ga0530510_1027148 | Ga0530510_1027148_16_435 | 127 |
| 125 | 3300005328 | Ga0070676_10278467 | Ga0070676_102784672 | 128 |
| 126 | 3300005328 | Ga0070676_10948899 | Ga0070676_109488992 | 128 |
| 127 | 3300005329 | Ga0070683_100933070 | Ga0070683_1009330701 | 128 |
| 128 | 3300005330 | Ga0070690_100006239 | Ga0070690_1000062392 | 128 |
| 129 | 3300005330 | Ga0070690_101306213 | Ga0070690_1013062132 | 128 |
| 130 | 3300005331 | Ga0070670_100047733 | Ga0070670_1000477333 | 128 |
| 131 | 3300005331 | Ga0070670_100498057 | Ga0070670_1004980571 | 128 |
| 132 | 3300005333 | Ga0070677_10005391 | Ga0070677_100053914 | 128 |
| 133 | 3300005333 | Ga0070677_10133203 | Ga0070677_101332032 | 128 |
| 134 | 3300005334 | Ga0068869_100014923 | Ga0068869_1000149231 | 128 |
| 135 | 3300005335 | Ga0070666_10688440 | Ga0070666_106884402 | 128 |
| 136 | 3300005338 | Ga0068868_100146867 | Ga0068868_1001468672 | 128 |
| 137 | 3300005340 | Ga0070689_100716880 | Ga0070689_1007168802 | 128 |
| 138 | 3300005344 | Ga0070661_100018034 | Ga0070661_1000180342 | 128 |
| 139 | 3300005347 | Ga0070668_102010298 | Ga0070668_1020102981 | 128 |
| 140 | 3300005354 | Ga0070675_100000107 | Ga0070675_10000010722 | 128 |
| 141 | 3300005354 | Ga0070675_100132602 | Ga0070675_1001326021 | 128 |
| 142 | 3300005354 | Ga0070675_100133300 | Ga0070675_1001333002 | 128 |
| 143 | 3300005354 | Ga0070675_100252066 | Ga0070675_1002520662 | 128 |
| 144 | 3300005355 | Ga0070671_100022507 | Ga0070671_1000225076 | 128 |
| 145 | 3300005356 | Ga0070674_100285890 | Ga0070674_1002858902 | 128 |
| 146 | 3300005364 | Ga0070673_100034896 | Ga0070673_1000348962 | 128 |
| 147 | 3300005365 | Ga0070688_100377455 | Ga0070688_1003774552 | 128 |
| 148 | 3300005365 | Ga0070688_101567324 | Ga0070688_1015673241 | 128 |
| 149 | 3300005366 | Ga0070659_100132575 | Ga0070659_1001325752 | 128 |
| 150 | 3300005367 | Ga0070667_100178096 | Ga0070667_1001780962 | 128 |
| 151 | 3300005441 | Ga0070700_100956549 | Ga0070700_1009565491 | 128 |
| 152 | 3300005444 | Ga0070694_101488194 | Ga0070694_1014881941 | 128 |
| 153 | 3300005445 | Ga0070708_100457719 | Ga0070708_1004577191 | 128 |
| 154 | 3300005455 | Ga0070663_100066516 | Ga0070663_1000665163 | 128 |
| 155 | 3300005456 | Ga0070678_100009155 | Ga0070678_1000091555 | 128 |
| 156 | 3300005456 | Ga0070678_100117351 | Ga0070678_1001173512 | 128 |
| 157 | 3300005456 | Ga0070678_100330848 | Ga0070678_1003308482 | 128 |
| 158 | 3300005456 | Ga0070678_100381384 | Ga0070678_1003813842 | 128 |
| 159 | 3300005457 | Ga0070662_100260287 | Ga0070662_1002602872 | 128 |
| 160 | 3300005459 | Ga0068867_100009442 | Ga0068867_1000094422 | 128 |
| 161 | 3300005459 | Ga0068867_100442858 | Ga0068867_1004428582 | 128 |
| 162 | 3300005459 | Ga0068867_100778871 | Ga0068867_1007788711 | 128 |
| 163 | 3300005468 | Ga0070707_100867348 | Ga0070707_1008673482 | 128 |
| 164 | 3300005471 | Ga0070698_102060673 | Ga0070698_1020606731 | 128 |
| 165 | 3300005518 | Ga0070699_100126883 | Ga0070699_1001268831 | 128 |
| 166 | 3300005535 | Ga0070684_100963414 | Ga0070684_1009634142 | 128 |
| 167 | 3300005536 | Ga0070697_100216435 | Ga0070697_1002164352 | 128 |
| 168 | 3300005539 | Ga0068853_102096157 | Ga0068853_1020961571 | 128 |
| 169 | 3300005543 | Ga0070672_100141926 | Ga0070672_1001419262 | 128 |
| 170 | 3300005544 | Ga0070686_100004038 | Ga0070686_10000403812 | 128 |
| 171 | 3300005545 | Ga0070695_100688731 | Ga0070695_1006887312 | 128 |
| 172 | 3300005546 | Ga0070696_101899810 | Ga0070696_1018998101 | 128 |
| 173 | 3300005546 | Ga0070696_101929535 | Ga0070696_1019295351 | 128 |
| 174 | 3300005548 | Ga0070665_100196198 | Ga0070665_1001961982 | 128 |
| 175 | 3300005549 | Ga0070704_101689617 | Ga0070704_1016896171 | 128 |
| 176 | 3300005564 | Ga0070664_100003576 | Ga0070664_10000357610 | 128 |
| 177 | 3300005615 | Ga0070702_100755618 | Ga0070702_1007556182 | 128 |
| 178 | 3300005616 | Ga0068852_100084975 | Ga0068852_1000849752 | 128 |
| 179 | 3300005618 | Ga0068864_100236331 | Ga0068864_1002363312 | 128 |
| 180 | 3300005841 | Ga0068863_100367827 | Ga0068863_1003678272 | 128 |
| 181 | 3300005842 | Ga0068858_100052631 | Ga0068858_1000526312 | 128 |
| 182 | 3300005843 | Ga0068860_100019269 | Ga0068860_1000192692 | 128 |
| 183 | 3300006237 | Ga0097621_100081707 | Ga0097621_1000817074 | 128 |
| 184 | 3300006237 | Ga0097621_100865444 | Ga0097621_1008654442 | 128 |
| 185 | 3300006358 | Ga0068871_100117506 | Ga0068871_1001175062 | 128 |
| 186 | 3300006846 | Ga0075430_100011515 | Ga0075430_1000115153 | 128 |
| 187 | 3300006846 | Ga0075430_100904861 | Ga0075430_1009048612 | 128 |
| 188 | 3300006847 | Ga0075431_100158037 | Ga0075431_1001580372 | 128 |
| 189 | 3300006847 | Ga0075431_100746045 | Ga0075431_1007460452 | 128 |
| 190 | 3300006852 | Ga0075433_10030851 | Ga0075433_100308515 | 128 |
| 191 | 3300006852 | Ga0075433_10283942 | Ga0075433_102839422 | 128 |
| 192 | 3300006871 | Ga0075434_100017800 | Ga0075434_1000178002 | 128 |
| 193 | 3300006881 | Ga0068865_100090794 | Ga0068865_1000907943 | 128 |
| 194 | 3300007076 | Ga0075435_100342547 | Ga0075435_1003425472 | 128 |
| 195 | 3300009094 | Ga0111539_10591288 | Ga0111539_105912882 | 128 |
| 196 | 3300009094 | Ga0111539_10829274 | Ga0111539_108292742 | 128 |
| 197 | 3300009094 | Ga0111539_12618676 | Ga0111539_126186762 | 128 |
| 198 | 3300009147 | Ga0114129_10006522 | Ga0114129_1000652215 | 128 |
| 199 | 3300009147 | Ga0114129_13183485 | Ga0114129_131834851 | 128 |
| 200 | 3300009176 | Ga0105242_10292374 | Ga0105242_102923742 | 128 |
| 201 | 3300009177 | Ga0105248_10317981 | Ga0105248_103179812 | 128 |
| 202 | 3300009177 | Ga0105248_11864846 | Ga0105248_118648461 | 128 |
| 203 | 3300009551 | Ga0105238_10136252 | Ga0105238_101362523 | 128 |
| 204 | 3300011119 | Ga0105246_10241939 | Ga0105246_102419392 | 128 |
| 205 | 3300013296 | Ga0157374_11933077 | Ga0157374_119330771 | 128 |
| 206 | 3300013306 | Ga0163162_11615031 | Ga0163162_116150312 | 128 |
| 207 | 3300013308 | Ga0157375_10501414 | Ga0157375_105014142 | 128 |
| 208 | 3300013308 | Ga0157375_11094769 | Ga0157375_110947691 | 128 |
| 209 | 3300014326 | Ga0157380_11498466 | Ga0157380_114984662 | 128 |
| 210 | 3300014326 | Ga0157380_11602051 | Ga0157380_116020511 | 128 |
| 211 | 3300017792 | Ga0163161_10293050 | Ga0163161_102930502 | 128 |
| 212 | 3300025893 | Ga0207682_10001041 | Ga0207682_100010418 | 128 |
| 213 | 3300025893 | Ga0207682_10120094 | Ga0207682_101200942 | 128 |
| 214 | 3300025901 | Ga0207688_10274605 | Ga0207688_102746052 | 128 |
| 215 | 3300025903 | Ga0207680_10946072 | Ga0207680_109460722 | 128 |
| 216 | 3300025907 | Ga0207645_10001335 | Ga0207645_100013352 | 128 |
| 217 | 3300025907 | Ga0207645_10430027 | Ga0207645_104300271 | 128 |
| 218 | 3300025923 | Ga0207681_10679253 | Ga0207681_106792532 | 128 |
| 219 | 3300025926 | Ga0207659_10000925 | Ga0207659_100009256 | 128 |
| 220 | 3300025926 | Ga0207659_10102971 | Ga0207659_101029713 | 128 |
| 221 | 3300025926 | Ga0207659_10477157 | Ga0207659_104771572 | 128 |
| 222 | 3300025926 | Ga0207659_11588063 | Ga0207659_115880631 | 128 |
| 223 | 3300025926 | Ga0207659_11636883 | Ga0207659_116368831 | 128 |
| 224 | 3300025933 | Ga0207706_10001124 | Ga0207706_100011243 | 128 |
| 225 | 3300025936 | Ga0207670_11729907 | Ga0207670_117299072 | 128 |
| 226 | 3300025937 | Ga0207669_10058705 | Ga0207669_100587052 | 128 |
| 227 | 3300025937 | Ga0207669_10120331 | Ga0207669_101203312 | 128 |
| 228 | 3300025938 | Ga0207704_11427993 | Ga0207704_114279931 | 128 |
| 229 | 3300025940 | Ga0207691_10209872 | Ga0207691_102098722 | 128 |
| 230 | 3300025940 | Ga0207691_10388181 | Ga0207691_103881812 | 128 |
| 231 | 3300025960 | Ga0207651_10017149 | Ga0207651_100171494 | 128 |
| 232 | 3300025960 | Ga0207651_10049718 | Ga0207651_100497184 | 128 |
| 233 | 3300025960 | Ga0207651_10414316 | Ga0207651_104143162 | 128 |
| 234 | 3300025961 | Ga0207712_11455815 | Ga0207712_114558151 | 128 |
| 235 | 3300025981 | Ga0207640_10085887 | Ga0207640_100858873 | 128 |
| 236 | 3300025986 | Ga0207658_10246046 | Ga0207658_102460462 | 128 |
| 237 | 3300026035 | Ga0207703_10036715 | Ga0207703_100367152 | 128 |
| 238 | 3300026035 | Ga0207703_12159553 | Ga0207703_121595532 | 128 |
| 239 | 3300026041 | Ga0207639_11260138 | Ga0207639_112601381 | 128 |
| 240 | 3300026067 | Ga0207678_10104883 | Ga0207678_101048832 | 128 |
| 241 | 3300026088 | Ga0207641_10030170 | Ga0207641_100301702 | 128 |
| 242 | 3300026089 | Ga0207648_10011249 | Ga0207648_100112492 | 128 |
| 243 | 3300026089 | Ga0207648_10398594 | Ga0207648_103985942 | 128 |
| 244 | 3300026089 | Ga0207648_10669647 | Ga0207648_106696472 | 128 |
| 245 | 3300026095 | Ga0207676_10129232 | Ga0207676_101292324 | 128 |
| 246 | 3300026121 | Ga0207683_10003513 | Ga0207683_100035135 | 128 |
| 247 | 3300026121 | Ga0207683_10380946 | Ga0207683_103809462 | 128 |
| 248 | 3300026142 | Ga0207698_10907617 | Ga0207698_109076171 | 128 |
| 249 | 3300026142 | Ga0207698_10963931 | Ga0207698_109639312 | 128 |
| 250 | 3300027378 | Ga0209981_1043577 | Ga0209981_10435772 | 128 |
| 251 | 3300027665 | Ga0209983_1047510 | Ga0209983_10475101 | 128 |
| 252 | 3300028379 | Ga0268266_10099739 | Ga0268266_100997392 | 128 |
| 253 | 3300028379 | Ga0268266_10329906 | Ga0268266_103299062 | 128 |
| 254 | 3300031824 | Ga0307413_11027854 | Ga0307413_110278541 | 128 |
| 255 | 3300031903 | Ga0307407_11641427 | Ga0307407_116414271 | 128 |
| 256 | 3300035170 | Ga0373943_0056281 | Ga0373943_0056281_1204_1593 | 128 |
| 257 | 3300035692 | Ga0373935_0499540 | Ga0373935_0499540_235_639 | 128 |
| 258 | 3300035695 | Ga0373927_0674316 | Ga0373927_0674316_225_614 | 128 |
| 259 | 3300035725 | Ga0373947_0196793 | Ga0373947_0196793_307_696 | 128 |
| 260 | 3300037853 | Ga0436364_0627217 | Ga0436364_0627217_1421_1810 | 128 |
| 261 | 3300039438 | Ga0436360_0735281 | Ga0436360_0735281_1694_2083 | 128 |
| 262 | 3300042004 | Ga0439445_0255895 | Ga0439445_0255895_29_463 | 128 |
| 263 | 3300042007 | Ga0439449_0258659 | Ga0439449_0258659_135_569 | 128 |
| 264 | 3300042015 | Ga0439462_0175885 | Ga0439462_0175885_109_507 | 128 |
| 265 | 3300042436 | Ga0439435_0010420 | Ga0439435_0010420_350_739 | 128 |
| 266 | 3300042436 | Ga0439435_0071066 | Ga0439435_0071066_581_970 | 128 |
| 267 | 3300042876 | Ga0451577_0060549 | Ga0451577_0060549_503_895 | 128 |
| 268 | 3300044712 | Ga0453684_0074567 | Ga0453684_0074567_2379_2771 | 128 |
| 269 | 3300045051 | Ga0451576_0526067 | Ga0451576_0526067_128_517 | 128 |
| 270 | 3300046455 | Ga0495603_0031800 | Ga0495603_0031800_1313_1702 | 128 |
| 271 | 3300046460 | Ga0495638_0095954 | Ga0495638_0095954_1256_1690 | 128 |
| 272 | 3300046499 | Ga0495594_0032745 | Ga0495594_0032745_1270_1659 | 128 |
| 273 | 3300046664 | Ga0495659_0056994 | Ga0495659_0056994_693_1082 | 128 |
| 274 | 3300046674 | Ga0495588_0287779 | Ga0495588_0287779_137_565 | 128 |
| 275 | 3300046683 | Ga0495658_0173323 | Ga0495658_0173323_616_1005 | 128 |
| 276 | 3300047321 | Ga0495676_0727590 | Ga0495676_0727590_10_399 | 128 |
| 277 | 3300048908 | Ga0496105_1175988 | Ga0496105_1175988_114_524 | 128 |
| 278 | 3300048909 | Ga0496106_0121479 | Ga0496106_0121479_522_911 | 128 |
| 279 | 3300048911 | Ga0496108_0658058 | Ga0496108_0658058_390_809 | 128 |
| 280 | 3300048912 | Ga0496109_0365360 | Ga0496109_0365360_555_974 | 128 |
| 281 | 3300048913 | Ga0496110_1108163 | Ga0496110_1108163_279_668 | 128 |
| 282 | 3300048917 | Ga0496114_1773660 | Ga0496114_1773660_43_432 | 128 |
| 283 | 3300049580 | Ga0501046_0963926 | Ga0501046_0963926_113_502 | 128 |
| 284 | 3300049581 | Ga0501047_0048818 | Ga0501047_0048818_3687_4076 | 128 |
| 285 | 3300049588 | Ga0501072_0940035 | Ga0501072_0940035_265_654 | 128 |
| 286 | 3300050490 | nmdc:mga03n38_475640_c1 | nmdc:mga03n38_475640_c1_176_607 | 128 |
| 287 | 3300050491 | nmdc:mga00v17_266342_c1 | nmdc:mga00v17_266342_c1_591_1022 | 128 |
| 288 | 3300050494 | nmdc:mga06z11_127425_c1 | nmdc:mga06z11_127425_c1_574_1005 | 128 |
| 289 | 3300050507 | nmdc:mga05p37_279883_c1 | nmdc:mga05p37_279883_c1_1467_1871 | 128 |
| 290 | 3300050508 | nmdc:mga09592_103866_c1 | nmdc:mga09592_103866_c1_37_426 | 128 |
| 291 | 3300050509 | nmdc:mga0qj67_41466_c1 | nmdc:mga0qj67_41466_c1_2834_3223 | 128 |
| 292 | 3300050509 | nmdc:mga0qj67_802710_c1 | nmdc:mga0qj67_802710_c1_309_713 | 128 |
| 293 | 3300050510 | nmdc:mga06r32_146341_c1 | nmdc:mga06r32_146341_c1_518_922 | 128 |
| 294 | 3300050510 | nmdc:mga06r32_34369_c1 | nmdc:mga06r32_34369_c1_4240_4629 | 128 |
| 295 | 3300050511 | nmdc:mga08y16_79329_c1 | nmdc:mga08y16_79329_c1_1070_1474 | 128 |
| 296 | 3300050512 | nmdc:mga0n895_272820_c1 | nmdc:mga0n895_272820_c1_451_840 | 128 |
| 297 | 3300050513 | nmdc:mga0rr50_181166_c1 | nmdc:mga0rr50_181166_c1_151_540 | 128 |
| 298 | 3300050515 | nmdc:mga0a205_142561_c1 | nmdc:mga0a205_142561_c1_991_1380 | 128 |
| 299 | 3300050515 | nmdc:mga0a205_38006_c1 | nmdc:mga0a205_38006_c1_3173_3562 | 128 |
| 300 | 3300053139 | Ga0500568_0018910 | Ga0500568_0018910_991_1422 | 128 |
| 301 | 3300053153 | Ga0500616_0000188 | Ga0500616_0000188_80913_81302 | 128 |
| 302 | 3300053730 | Ga0500645_000164 | Ga0500645_000164_24021_24410 | 128 |
| 303 | 3300002076 | JGI24749J21850_1027405 | JGI24749J21850_10274052 | 129 |
| 304 | 3300005290 | Ga0065712_10011019 | Ga0065712_100110195 | 129 |
| 305 | 3300005295 | Ga0065707_10037617 | Ga0065707_100376172 | 129 |
| 306 | 3300005295 | Ga0065707_10087131 | Ga0065707_100871315 | 129 |
| 307 | 3300005328 | Ga0070676_10080082 | Ga0070676_100800822 | 129 |
| 308 | 3300005328 | Ga0070676_10295884 | Ga0070676_102958842 | 129 |
| 309 | 3300005331 | Ga0070670_100642463 | Ga0070670_1006424632 | 129 |
| 310 | 3300005331 | Ga0070670_101538400 | Ga0070670_1015384002 | 129 |
| 311 | 3300005333 | Ga0070677_10060878 | Ga0070677_100608782 | 129 |
| 312 | 3300005334 | Ga0068869_100021682 | Ga0068869_1000216821 | 129 |
| 313 | 3300005334 | Ga0068869_100047647 | Ga0068869_1000476472 | 129 |
| 314 | 3300005335 | Ga0070666_10086334 | Ga0070666_100863342 | 129 |
| 315 | 3300005335 | Ga0070666_10356900 | Ga0070666_103569002 | 129 |
| 316 | 3300005336 | Ga0070680_100074435 | Ga0070680_1000744354 | 129 |
| 317 | 3300005337 | Ga0070682_101159706 | Ga0070682_1011597061 | 129 |
| 318 | 3300005338 | Ga0068868_100072354 | Ga0068868_1000723544 | 129 |
| 319 | 3300005339 | Ga0070660_100011473 | Ga0070660_1000114732 | 129 |
| 320 | 3300005340 | Ga0070689_100018439 | Ga0070689_1000184393 | 129 |
| 321 | 3300005340 | Ga0070689_100050709 | Ga0070689_1000507093 | 129 |
| 322 | 3300005344 | Ga0070661_100016901 | Ga0070661_1000169015 | 129 |
| 323 | 3300005344 | Ga0070661_101041496 | Ga0070661_1010414961 | 129 |
| 324 | 3300005345 | Ga0070692_10796454 | Ga0070692_107964541 | 129 |
| 325 | 3300005347 | Ga0070668_100650695 | Ga0070668_1006506952 | 129 |
| 326 | 3300005353 | Ga0070669_100051468 | Ga0070669_1000514682 | 129 |
| 327 | 3300005353 | Ga0070669_100240763 | Ga0070669_1002407632 | 129 |
| 328 | 3300005354 | Ga0070675_100000193 | Ga0070675_10000019327 | 129 |
| 329 | 3300005354 | Ga0070675_100019586 | Ga0070675_1000195868 | 129 |
| 330 | 3300005354 | Ga0070675_100121849 | Ga0070675_1001218492 | 129 |
| 331 | 3300005354 | Ga0070675_100185626 | Ga0070675_1001856262 | 129 |
| 332 | 3300005354 | Ga0070675_100623763 | Ga0070675_1006237631 | 129 |
| 333 | 3300005354 | Ga0070675_100767811 | Ga0070675_1007678112 | 129 |
| 334 | 3300005355 | Ga0070671_100750789 | Ga0070671_1007507892 | 129 |
| 335 | 3300005356 | Ga0070674_100001260 | Ga0070674_10000126012 | 129 |
| 336 | 3300005356 | Ga0070674_100027170 | Ga0070674_1000271706 | 129 |
| 337 | 3300005356 | Ga0070674_100179539 | Ga0070674_1001795392 | 129 |
| 338 | 3300005356 | Ga0070674_100743762 | Ga0070674_1007437621 | 129 |
| 339 | 3300005364 | Ga0070673_100049478 | Ga0070673_1000494783 | 129 |
| 340 | 3300005364 | Ga0070673_100058374 | Ga0070673_1000583742 | 129 |
| 341 | 3300005364 | Ga0070673_100130882 | Ga0070673_1001308822 | 129 |
| 342 | 3300005364 | Ga0070673_100170280 | Ga0070673_1001702802 | 129 |
| 343 | 3300005365 | Ga0070688_100679154 | Ga0070688_1006791542 | 129 |
| 344 | 3300005366 | Ga0070659_100171155 | Ga0070659_1001711552 | 129 |
| 345 | 3300005366 | Ga0070659_100214158 | Ga0070659_1002141582 | 129 |
| 346 | 3300005366 | Ga0070659_100313139 | Ga0070659_1003131391 | 129 |
| 347 | 3300005366 | Ga0070659_101008023 | Ga0070659_1010080232 | 129 |
| 348 | 3300005367 | Ga0070667_100185181 | Ga0070667_1001851812 | 129 |
| 349 | 3300005367 | Ga0070667_100244639 | Ga0070667_1002446392 | 129 |
| 350 | 3300005367 | Ga0070667_100456383 | Ga0070667_1004563831 | 129 |
| 351 | 3300005367 | Ga0070667_100462003 | Ga0070667_1004620032 | 129 |
| 352 | 3300005434 | Ga0070709_10365065 | Ga0070709_103650652 | 129 |
| 353 | 3300005440 | Ga0070705_100418671 | Ga0070705_1004186712 | 129 |
| 354 | 3300005440 | Ga0070705_100841558 | Ga0070705_1008415582 | 129 |
| 355 | 3300005441 | Ga0070700_100932241 | Ga0070700_1009322411 | 129 |
| 356 | 3300005441 | Ga0070700_101897668 | Ga0070700_1018976681 | 129 |
| 357 | 3300005444 | Ga0070694_100512272 | Ga0070694_1005122722 | 129 |
| 358 | 3300005444 | Ga0070694_100573197 | Ga0070694_1005731971 | 129 |
| 359 | 3300005444 | Ga0070694_101472119 | Ga0070694_1014721191 | 129 |
| 360 | 3300005445 | Ga0070708_100152042 | Ga0070708_1001520423 | 129 |
| 361 | 3300005445 | Ga0070708_101327413 | Ga0070708_1013274132 | 129 |
| 362 | 3300005456 | Ga0070678_101427863 | Ga0070678_1014278631 | 129 |
| 363 | 3300005456 | Ga0070678_101440348 | Ga0070678_1014403481 | 129 |
| 364 | 3300005457 | Ga0070662_100048201 | Ga0070662_1000482011 | 129 |
| 365 | 3300005457 | Ga0070662_100171859 | Ga0070662_1001718593 | 129 |
| 366 | 3300005457 | Ga0070662_100277827 | Ga0070662_1002778272 | 129 |
| 367 | 3300005458 | Ga0070681_10056175 | Ga0070681_100561755 | 129 |
| 368 | 3300005459 | Ga0068867_100792181 | Ga0068867_1007921811 | 129 |
| 369 | 3300005459 | Ga0068867_100954691 | Ga0068867_1009546912 | 129 |
| 370 | 3300005466 | Ga0070685_10132567 | Ga0070685_101325672 | 129 |
| 371 | 3300005467 | Ga0070706_100296921 | Ga0070706_1002969212 | 129 |
| 372 | 3300005468 | Ga0070707_100274130 | Ga0070707_1002741302 | 129 |
| 373 | 3300005471 | Ga0070698_100040015 | Ga0070698_1000400154 | 129 |
| 374 | 3300005530 | Ga0070679_100039688 | Ga0070679_1000396885 | 129 |
| 375 | 3300005535 | Ga0070684_100003808 | Ga0070684_10000380815 | 129 |
| 376 | 3300005539 | Ga0068853_100450086 | Ga0068853_1004500862 | 129 |
| 377 | 3300005543 | Ga0070672_100017016 | Ga0070672_1000170163 | 129 |
| 378 | 3300005543 | Ga0070672_100643060 | Ga0070672_1006430602 | 129 |
| 379 | 3300005543 | Ga0070672_101007377 | Ga0070672_1010073772 | 129 |
| 380 | 3300005544 | Ga0070686_100233734 | Ga0070686_1002337342 | 129 |
| 381 | 3300005546 | Ga0070696_100347483 | Ga0070696_1003474832 | 129 |
| 382 | 3300005546 | Ga0070696_100355754 | Ga0070696_1003557541 | 129 |
| 383 | 3300005546 | Ga0070696_100511438 | Ga0070696_1005114381 | 129 |
| 384 | 3300005546 | Ga0070696_100549451 | Ga0070696_1005494511 | 129 |
| 385 | 3300005548 | Ga0070665_100313738 | Ga0070665_1003137382 | 129 |
| 386 | 3300005548 | Ga0070665_100764982 | Ga0070665_1007649821 | 129 |
| 387 | 3300005548 | Ga0070665_102200515 | Ga0070665_1022005151 | 129 |
| 388 | 3300005549 | Ga0070704_100004623 | Ga0070704_1000046233 | 129 |
| 389 | 3300005549 | Ga0070704_100954454 | Ga0070704_1009544542 | 129 |
| 390 | 3300005563 | Ga0068855_100012526 | Ga0068855_10001252610 | 129 |
| 391 | 3300005564 | Ga0070664_100107457 | Ga0070664_1001074573 | 129 |
| 392 | 3300005564 | Ga0070664_100438053 | Ga0070664_1004380532 | 129 |
| 393 | 3300005577 | Ga0068857_100945793 | Ga0068857_1009457931 | 129 |
| 394 | 3300005577 | Ga0068857_101760565 | Ga0068857_1017605651 | 129 |
| 395 | 3300005578 | Ga0068854_100049749 | Ga0068854_1000497492 | 129 |
| 396 | 3300005615 | Ga0070702_100165930 | Ga0070702_1001659302 | 129 |
| 397 | 3300005615 | Ga0070702_100323203 | Ga0070702_1003232032 | 129 |
| 398 | 3300005615 | Ga0070702_100405614 | Ga0070702_1004056142 | 129 |
| 399 | 3300005615 | Ga0070702_100561729 | Ga0070702_1005617291 | 129 |
| 400 | 3300005616 | Ga0068852_100380727 | Ga0068852_1003807271 | 129 |
| 401 | 3300005617 | Ga0068859_100007749 | Ga0068859_1000077494 | 129 |
| 402 | 3300005617 | Ga0068859_100120538 | Ga0068859_1001205383 | 129 |
| 403 | 3300005617 | Ga0068859_100453473 | Ga0068859_1004534732 | 129 |
| 404 | 3300005617 | Ga0068859_102075001 | Ga0068859_1020750011 | 129 |
| 405 | 3300005618 | Ga0068864_100021678 | Ga0068864_1000216784 | 129 |
| 406 | 3300005618 | Ga0068864_100157452 | Ga0068864_1001574522 | 129 |
| 407 | 3300005719 | Ga0068861_100463401 | Ga0068861_1004634012 | 129 |
| 408 | 3300005719 | Ga0068861_100815834 | Ga0068861_1008158342 | 129 |
| 409 | 3300005840 | Ga0068870_10045775 | Ga0068870_100457752 | 129 |
| 410 | 3300005840 | Ga0068870_10078996 | Ga0068870_100789962 | 129 |
| 411 | 3300005840 | Ga0068870_11109988 | Ga0068870_111099881 | 129 |
| 412 | 3300005842 | Ga0068858_100014541 | Ga0068858_1000145414 | 129 |
| 413 | 3300005842 | Ga0068858_101230415 | Ga0068858_1012304151 | 129 |
| 414 | 3300005843 | Ga0068860_100039019 | Ga0068860_1000390192 | 129 |
| 415 | 3300005843 | Ga0068860_100255975 | Ga0068860_1002559752 | 129 |
| 416 | 3300005844 | Ga0068862_100409336 | Ga0068862_1004093362 | 129 |
| 417 | 3300006237 | Ga0097621_100142642 | Ga0097621_1001426423 | 129 |
| 418 | 3300006237 | Ga0097621_100753060 | Ga0097621_1007530602 | 129 |
| 419 | 3300006358 | Ga0068871_100332427 | Ga0068871_1003324272 | 129 |
| 420 | 3300006358 | Ga0068871_100486426 | Ga0068871_1004864262 | 129 |
| 421 | 3300006844 | Ga0075428_100003026 | Ga0075428_1000030268 | 129 |
| 422 | 3300006844 | Ga0075428_100149414 | Ga0075428_1001494144 | 129 |
| 423 | 3300006844 | Ga0075428_100666418 | Ga0075428_1006664182 | 129 |
| 424 | 3300006844 | Ga0075428_100772308 | Ga0075428_1007723082 | 129 |
| 425 | 3300006844 | Ga0075428_101349215 | Ga0075428_1013492152 | 129 |
| 426 | 3300006846 | Ga0075430_100016485 | Ga0075430_1000164853 | 129 |
| 427 | 3300006846 | Ga0075430_100027098 | Ga0075430_1000270987 | 129 |
| 428 | 3300006846 | Ga0075430_100036355 | Ga0075430_1000363553 | 129 |
| 429 | 3300006846 | Ga0075430_100374234 | Ga0075430_1003742342 | 129 |
| 430 | 3300006846 | Ga0075430_100801756 | Ga0075430_1008017562 | 129 |
| 431 | 3300006847 | Ga0075431_100000804 | Ga0075431_1000008048 | 129 |
| 432 | 3300006847 | Ga0075431_100112182 | Ga0075431_1001121822 | 129 |
| 433 | 3300006847 | Ga0075431_100177343 | Ga0075431_1001773432 | 129 |
| 434 | 3300006847 | Ga0075431_101154477 | Ga0075431_1011544771 | 129 |
| 435 | 3300006852 | Ga0075433_10255874 | Ga0075433_102558742 | 129 |
| 436 | 3300006880 | Ga0075429_100007498 | Ga0075429_1000074982 | 129 |
| 437 | 3300006880 | Ga0075429_100046351 | Ga0075429_1000463513 | 129 |
| 438 | 3300006914 | Ga0075436_100116847 | Ga0075436_1001168472 | 129 |
| 439 | 3300006931 | Ga0097620_100007749 | Ga0097620_1000077494 | 129 |
| 440 | 3300006931 | Ga0097620_100120541 | Ga0097620_1001205413 | 129 |
| 441 | 3300006931 | Ga0097620_100453427 | Ga0097620_1004534272 | 129 |
| 442 | 3300006931 | Ga0097620_102075005 | Ga0097620_1020750051 | 129 |
| 443 | 3300009094 | Ga0111539_10000056 | Ga0111539_1000005683 | 129 |
| 444 | 3300009094 | Ga0111539_10013747 | Ga0111539_100137474 | 129 |
| 445 | 3300009094 | Ga0111539_10131239 | Ga0111539_101312391 | 129 |
| 446 | 3300009094 | Ga0111539_10627069 | Ga0111539_106270692 | 129 |
| 447 | 3300009094 | Ga0111539_10663193 | Ga0111539_106631932 | 129 |
| 448 | 3300009094 | Ga0111539_10814643 | Ga0111539_108146431 | 129 |
| 449 | 3300009147 | Ga0114129_10010650 | Ga0114129_100106508 | 129 |
| 450 | 3300009147 | Ga0114129_10011051 | Ga0114129_100110516 | 129 |
| 451 | 3300009147 | Ga0114129_10020920 | Ga0114129_100209203 | 129 |
| 452 | 3300009147 | Ga0114129_10044424 | Ga0114129_100444242 | 129 |
| 453 | 3300009147 | Ga0114129_10118725 | Ga0114129_101187253 | 129 |
| 454 | 3300009147 | Ga0114129_10143879 | Ga0114129_101438791 | 129 |
| 455 | 3300009147 | Ga0114129_10265291 | Ga0114129_102652913 | 129 |
| 456 | 3300009147 | Ga0114129_10288678 | Ga0114129_102886783 | 129 |
| 457 | 3300009147 | Ga0114129_10880335 | Ga0114129_108803352 | 129 |
| 458 | 3300009147 | Ga0114129_11008401 | Ga0114129_110084012 | 129 |
| 459 | 3300009147 | Ga0114129_12032295 | Ga0114129_120322951 | 129 |
| 460 | 3300009147 | Ga0114129_12871494 | Ga0114129_128714942 | 129 |
| 461 | 3300009148 | Ga0105243_11169251 | Ga0105243_111692512 | 129 |
| 462 | 3300009177 | Ga0105248_10030221 | Ga0105248_100302215 | 129 |
| 463 | 3300009177 | Ga0105248_10083398 | Ga0105248_100833982 | 129 |
| 464 | 3300009177 | Ga0105248_10249918 | Ga0105248_102499182 | 129 |
| 465 | 3300009553 | Ga0105249_10022648 | Ga0105249_100226482 | 129 |
| 466 | 3300009553 | Ga0105249_10660268 | Ga0105249_106602682 | 129 |
| 467 | 3300011119 | Ga0105246_10585340 | Ga0105246_105853402 | 129 |
| 468 | 3300011119 | Ga0105246_10606086 | Ga0105246_106060862 | 129 |
| 469 | 3300012485 | Ga0157325_1023617 | Ga0157325_10236172 | 129 |
| 470 | 3300013296 | Ga0157374_10048504 | Ga0157374_100485042 | 129 |
| 471 | 3300013296 | Ga0157374_10272313 | Ga0157374_102723132 | 129 |
| 472 | 3300013297 | Ga0157378_11409869 | Ga0157378_114098692 | 129 |
| 473 | 3300013306 | Ga0163162_10013149 | Ga0163162_100131492 | 129 |
| 474 | 3300013306 | Ga0163162_11373494 | Ga0163162_113734941 | 129 |
| 475 | 3300013306 | Ga0163162_12760163 | Ga0163162_127601632 | 129 |
| 476 | 3300013308 | Ga0157375_10043371 | Ga0157375_100433718 | 129 |
| 477 | 3300013308 | Ga0157375_10113232 | Ga0157375_101132324 | 129 |
| 478 | 3300013308 | Ga0157375_10182805 | Ga0157375_101828052 | 129 |
| 479 | 3300013308 | Ga0157375_12425179 | Ga0157375_124251792 | 129 |
| 480 | 3300014325 | Ga0163163_10302020 | Ga0163163_103020202 | 129 |
| 481 | 3300014325 | Ga0163163_11062607 | Ga0163163_110626071 | 129 |
| 482 | 3300014326 | Ga0157380_10052513 | Ga0157380_100525136 | 129 |
| 483 | 3300014326 | Ga0157380_10091328 | Ga0157380_100913284 | 129 |
| 484 | 3300014326 | Ga0157380_10335656 | Ga0157380_103356562 | 129 |
| 485 | 3300014326 | Ga0157380_11070473 | Ga0157380_110704732 | 129 |
| 486 | 3300014745 | Ga0157377_10028734 | Ga0157377_100287343 | 129 |
| 487 | 3300014745 | Ga0157377_10052241 | Ga0157377_100522412 | 129 |
| 488 | 3300014745 | Ga0157377_10405424 | Ga0157377_104054241 | 129 |
| 489 | 3300014745 | Ga0157377_10502348 | Ga0157377_105023482 | 129 |
| 490 | 3300014745 | Ga0157377_11635910 | Ga0157377_116359102 | 129 |
| 491 | 3300014969 | Ga0157376_10103296 | Ga0157376_101032962 | 129 |
| 492 | 3300014969 | Ga0157376_10440333 | Ga0157376_104403332 | 129 |
| 493 | 3300014969 | Ga0157376_10945802 | Ga0157376_109458022 | 129 |
| 494 | 3300017792 | Ga0163161_10845385 | Ga0163161_108453851 | 129 |
| 495 | 3300017792 | Ga0163161_11040686 | Ga0163161_110406862 | 129 |
| 496 | 3300025315 | Ga0207697_10242877 | Ga0207697_102428771 | 129 |
| 497 | 3300025893 | Ga0207682_10010361 | Ga0207682_100103612 | 129 |
| 498 | 3300025893 | Ga0207682_10057354 | Ga0207682_100573541 | 129 |
| 499 | 3300025899 | Ga0207642_10063485 | Ga0207642_100634852 | 129 |
| 500 | 3300025901 | Ga0207688_10028330 | Ga0207688_100283303 | 129 |
| 501 | 3300025903 | Ga0207680_10251383 | Ga0207680_102513832 | 129 |
| 502 | 3300025906 | Ga0207699_10319325 | Ga0207699_103193252 | 129 |
| 503 | 3300025907 | Ga0207645_10068974 | Ga0207645_100689742 | 129 |
| 504 | 3300025907 | Ga0207645_10279685 | Ga0207645_102796852 | 129 |
| 505 | 3300025907 | Ga0207645_10722738 | Ga0207645_107227381 | 129 |
| 506 | 3300025908 | Ga0207643_10001209 | Ga0207643_100012093 | 129 |
| 507 | 3300025908 | Ga0207643_10016436 | Ga0207643_100164363 | 129 |
| 508 | 3300025908 | Ga0207643_11118068 | Ga0207643_111180681 | 129 |
| 509 | 3300025909 | Ga0207705_10038281 | Ga0207705_100382812 | 129 |
| 510 | 3300025909 | Ga0207705_10490362 | Ga0207705_104903622 | 129 |
| 511 | 3300025910 | Ga0207684_10302415 | Ga0207684_103024152 | 129 |
| 512 | 3300025911 | Ga0207654_10537146 | Ga0207654_105371462 | 129 |
| 513 | 3300025919 | Ga0207657_10012933 | Ga0207657_100129333 | 129 |
| 514 | 3300025920 | Ga0207649_11119325 | Ga0207649_111193251 | 129 |
| 515 | 3300025921 | Ga0207652_10081332 | Ga0207652_100813323 | 129 |
| 516 | 3300025922 | Ga0207646_10439760 | Ga0207646_104397603 | 129 |
| 517 | 3300025924 | Ga0207694_10243159 | Ga0207694_102431592 | 129 |
| 518 | 3300025925 | Ga0207650_10363380 | Ga0207650_103633801 | 129 |
| 519 | 3300025925 | Ga0207650_10726227 | Ga0207650_107262272 | 129 |
| 520 | 3300025925 | Ga0207650_11332790 | Ga0207650_113327902 | 129 |
| 521 | 3300025926 | Ga0207659_10013128 | Ga0207659_100131285 | 129 |
| 522 | 3300025926 | Ga0207659_10035018 | Ga0207659_100350183 | 129 |
| 523 | 3300025926 | Ga0207659_10092828 | Ga0207659_100928282 | 129 |
| 524 | 3300025926 | Ga0207659_10639488 | Ga0207659_106394882 | 129 |
| 525 | 3300025927 | Ga0207687_10494209 | Ga0207687_104942092 | 129 |
| 526 | 3300025932 | Ga0207690_10082484 | Ga0207690_100824842 | 129 |
| 527 | 3300025932 | Ga0207690_11108301 | Ga0207690_111083011 | 129 |
| 528 | 3300025933 | Ga0207706_10226965 | Ga0207706_102269651 | 129 |
| 529 | 3300025936 | Ga0207670_10045336 | Ga0207670_100453362 | 129 |
| 530 | 3300025937 | Ga0207669_10000677 | Ga0207669_100006775 | 129 |
| 531 | 3300025937 | Ga0207669_10351826 | Ga0207669_103518262 | 129 |
| 532 | 3300025937 | Ga0207669_11316479 | Ga0207669_113164791 | 129 |
| 533 | 3300025938 | Ga0207704_10124232 | Ga0207704_101242322 | 129 |
| 534 | 3300025940 | Ga0207691_10024821 | Ga0207691_100248215 | 129 |
| 535 | 3300025940 | Ga0207691_10073346 | Ga0207691_100733462 | 129 |
| 536 | 3300025940 | Ga0207691_10588657 | Ga0207691_105886572 | 129 |
| 537 | 3300025941 | Ga0207711_10028577 | Ga0207711_100285773 | 129 |
| 538 | 3300025942 | Ga0207689_10034777 | Ga0207689_100347772 | 129 |
| 539 | 3300025942 | Ga0207689_10170555 | Ga0207689_101705551 | 129 |
| 540 | 3300025942 | Ga0207689_10240418 | Ga0207689_102404182 | 129 |
| 541 | 3300025942 | Ga0207689_10362789 | Ga0207689_103627892 | 129 |
| 542 | 3300025944 | Ga0207661_11680719 | Ga0207661_116807191 | 129 |
| 543 | 3300025945 | Ga0207679_10112433 | Ga0207679_101124332 | 129 |
| 544 | 3300025949 | Ga0207667_10167366 | Ga0207667_101673662 | 129 |
| 545 | 3300025960 | Ga0207651_10023469 | Ga0207651_100234693 | 129 |
| 546 | 3300025960 | Ga0207651_10051639 | Ga0207651_100516391 | 129 |
| 547 | 3300025960 | Ga0207651_10064739 | Ga0207651_100647392 | 129 |
| 548 | 3300025960 | Ga0207651_10144493 | Ga0207651_101444932 | 129 |
| 549 | 3300025961 | Ga0207712_10591755 | Ga0207712_105917552 | 129 |
| 550 | 3300025972 | Ga0207668_10328405 | Ga0207668_103284052 | 129 |
| 551 | 3300025981 | Ga0207640_10077733 | Ga0207640_100777332 | 129 |
| 552 | 3300025986 | Ga0207658_10228663 | Ga0207658_102286633 | 129 |
| 553 | 3300025986 | Ga0207658_11557500 | Ga0207658_115575002 | 129 |
| 554 | 3300026023 | Ga0207677_10754550 | Ga0207677_107545502 | 129 |
| 555 | 3300026035 | Ga0207703_10038271 | Ga0207703_100382711 | 129 |
| 556 | 3300026075 | Ga0207708_10117783 | Ga0207708_101177832 | 129 |
| 557 | 3300026075 | Ga0207708_10645933 | Ga0207708_106459332 | 129 |
| 558 | 3300026078 | Ga0207702_10593992 | Ga0207702_105939922 | 129 |
| 559 | 3300026089 | Ga0207648_10031771 | Ga0207648_100317715 | 129 |
| 560 | 3300026089 | Ga0207648_10175891 | Ga0207648_101758912 | 129 |
| 561 | 3300026089 | Ga0207648_10601658 | Ga0207648_106016582 | 129 |
| 562 | 3300026095 | Ga0207676_10022811 | Ga0207676_100228114 | 129 |
| 563 | 3300026095 | Ga0207676_10081397 | Ga0207676_100813974 | 129 |
| 564 | 3300026116 | Ga0207674_10105673 | Ga0207674_101056732 | 129 |
| 565 | 3300026118 | Ga0207675_100459279 | Ga0207675_1004592792 | 129 |
| 566 | 3300026118 | Ga0207675_100691950 | Ga0207675_1006919502 | 129 |
| 567 | 3300026121 | Ga0207683_10075577 | Ga0207683_100755772 | 129 |
| 568 | 3300026121 | Ga0207683_10112474 | Ga0207683_101124742 | 129 |
| 569 | 3300026121 | Ga0207683_10117505 | Ga0207683_101175052 | 129 |
| 570 | 3300026142 | Ga0207698_11405405 | Ga0207698_114054051 | 129 |
| 571 | 3300027907 | Ga0207428_10002483 | Ga0207428_1000248312 | 129 |
| 572 | 3300028379 | Ga0268266_10577417 | Ga0268266_105774171 | 129 |
| 573 | 3300028380 | Ga0268265_10199219 | Ga0268265_101992192 | 129 |
| 574 | 3300028380 | Ga0268265_12331523 | Ga0268265_123315232 | 129 |
| 575 | 3300028381 | Ga0268264_10056583 | Ga0268264_100565832 | 129 |
| 576 | 3300028381 | Ga0268264_10781124 | Ga0268264_107811242 | 129 |
| 577 | 3300031911 | Ga0307412_11284238 | Ga0307412_112842381 | 129 |
| 578 | 3300031995 | Ga0307409_100269973 | Ga0307409_1002699732 | 129 |
| 579 | 3300032005 | Ga0307411_11221541 | Ga0307411_112215412 | 129 |
| 580 | 3300035116 | Ga0373945_0160706 | Ga0373945_0160706_412_807 | 129 |
| 581 | 3300035119 | Ga0373956_0394287 | Ga0373956_0394287_133_525 | 129 |
| 582 | 3300035172 | Ga0373955_0216570 | Ga0373955_0216570_697_1089 | 129 |
| 583 | 3300035172 | Ga0373955_1031132 | Ga0373955_1031132_25_417 | 129 |
| 584 | 3300036401 | Ga0373937_0153757 | Ga0373937_0153757_1243_1638 | 129 |
| 585 | 3300036401 | Ga0373937_0549893 | Ga0373937_0549893_195_593 | 129 |
| 586 | 3300036401 | Ga0373937_0610388 | Ga0373937_0610388_581_973 | 129 |
| 587 | 3300037471 | Ga0395905_1144235 | Ga0395905_1144235_56_448 | 129 |
| 588 | 3300041486 | Ga0451807_0831803 | Ga0451807_0831803_96_488 | 129 |
| 589 | 3300042122 | Ga0450920_051942 | Ga0450920_051942_331_732 | 129 |
| 590 | 3300042435 | Ga0439434_0281985 | Ga0439434_0281985_52_444 | 129 |
| 591 | 3300042437 | Ga0439444_0004617 | Ga0439444_0004617_988_1407 | 129 |
| 592 | 3300045051 | Ga0451576_0224467 | Ga0451576_0224467_1459_1851 | 129 |
| 593 | 3300045976 | Ga0466967_1004699 | Ga0466967_1004699_284_676 | 129 |
| 594 | 3300046457 | Ga0495590_0157037 | Ga0495590_0157037_18_410 | 129 |
| 595 | 3300046459 | Ga0495629_1088653 | Ga0495629_1088653_52_447 | 129 |
| 596 | 3300046537 | Ga0495598_0260163 | Ga0495598_0260163_46_438 | 129 |
| 597 | 3300046539 | Ga0495621_0065301 | Ga0495621_0065301_51_443 | 129 |
| 598 | 3300046539 | Ga0495621_0097705 | Ga0495621_0097705_34_453 | 129 |
| 599 | 3300046615 | Ga0495656_0347763 | Ga0495656_0347763_43_435 | 129 |
| 600 | 3300046615 | Ga0495656_0353031 | Ga0495656_0353031_36_428 | 129 |
| 601 | 3300046663 | Ga0495635_0147991 | Ga0495635_0147991_146_541 | 129 |
| 602 | 3300046678 | Ga0495599_0552747 | Ga0495599_0552747_83_475 | 129 |
| 603 | 3300047319 | Ga0495674_0348200 | Ga0495674_0348200_336_755 | 129 |
| 604 | 3300047444 | Ga0495675_0220786 | Ga0495675_0220786_211_603 | 129 |
| 605 | 3300048905 | Ga0496102_1044863 | Ga0496102_1044863_315_707 | 129 |
| 606 | 3300048907 | Ga0496104_0280830 | Ga0496104_0280830_1086_1481 | 129 |
| 607 | 3300048912 | Ga0496109_0190521 | Ga0496109_0190521_854_1249 | 129 |
| 608 | 3300048912 | Ga0496109_0632373 | Ga0496109_0632373_361_750 | 129 |
| 609 | 3300048916 | Ga0496113_0137539 | Ga0496113_0137539_1223_1618 | 129 |
| 610 | 3300049514 | Ga0501291_171953 | Ga0501291_171953_76_468 | 129 |
| 611 | 3300049568 | Ga0501031_0125244 | Ga0501031_0125244_188_589 | 129 |
| 612 | 3300049568 | Ga0501031_0175078 | Ga0501031_0175078_736_1128 | 129 |
| 613 | 3300049570 | Ga0501033_0121742 | Ga0501033_0121742_531_923 | 129 |
| 614 | 3300049571 | Ga0501034_0188605 | Ga0501034_0188605_1263_1655 | 129 |
| 615 | 3300049575 | Ga0501039_0128158 | Ga0501039_0128158_491_892 | 129 |
| 616 | 3300049575 | Ga0501039_0247032 | Ga0501039_0247032_610_1002 | 129 |
| 617 | 3300049576 | Ga0501040_0008884 | Ga0501040_0008884_5233_5625 | 129 |
| 618 | 3300049576 | Ga0501040_0168715 | Ga0501040_0168715_1060_1461 | 129 |
| 619 | 3300049576 | Ga0501040_0716446 | Ga0501040_0716446_52_471 | 129 |
| 620 | 3300049577 | Ga0501041_0032039 | Ga0501041_0032039_1306_1707 | 129 |
| 621 | 3300049578 | Ga0501042_0582566 | Ga0501042_0582566_182_583 | 129 |
| 622 | 3300049579 | Ga0501043_0722649 | Ga0501043_0722649_148_540 | 129 |
| 623 | 3300049580 | Ga0501046_0020141 | Ga0501046_0020141_26_418 | 129 |
| 624 | 3300049581 | Ga0501047_0205863 | Ga0501047_0205863_1161_1553 | 129 |
| 625 | 3300049582 | Ga0501048_0081154 | Ga0501048_0081154_676_1077 | 129 |
| 626 | 3300049582 | Ga0501048_0246255 | Ga0501048_0246255_56_448 | 129 |
| 627 | 3300049584 | Ga0501068_0256125 | Ga0501068_0256125_40_432 | 129 |
| 628 | 3300049587 | Ga0501071_0504247 | Ga0501071_0504247_183_575 | 129 |
| 629 | 3300049588 | Ga0501072_0058925 | Ga0501072_0058925_898_1299 | 129 |
| 630 | 3300049588 | Ga0501072_0101766 | Ga0501072_0101766_214_606 | 129 |
| 631 | 3300049588 | Ga0501072_0258397 | Ga0501072_0258397_82_501 | 129 |
| 632 | 3300049588 | Ga0501072_0542305 | Ga0501072_0542305_98_490 | 129 |
| 633 | 3300049590 | Ga0501074_1037766 | Ga0501074_1037766_37_429 | 129 |
| 634 | 3300049591 | Ga0501075_0006605 | Ga0501075_0006605_2431_2823 | 129 |
| 635 | 3300049591 | Ga0501075_0109865 | Ga0501075_0109865_1119_1520 | 129 |
| 636 | 3300049591 | Ga0501075_0273958 | Ga0501075_0273958_863_1255 | 129 |
| 637 | 3300049592 | Ga0501076_0027446 | Ga0501076_0027446_509_910 | 129 |
| 638 | 3300049592 | Ga0501076_0435472 | Ga0501076_0435472_214_606 | 129 |
| 639 | 3300049593 | Ga0501077_0272436 | Ga0501077_0272436_133_525 | 129 |
| 640 | 3300049652 | Ga0501202_031298 | Ga0501202_031298_126_518 | 129 |
| 641 | 3300049741 | Ga0501079_0094366 | Ga0501079_0094366_1688_2080 | 129 |
| 642 | 3300049742 | Ga0501080_0735213 | Ga0501080_0735213_149_541 | 129 |
| 643 | 3300049743 | Ga0501081_0010128 | Ga0501081_0010128_4828_5220 | 129 |
| 644 | 3300049743 | Ga0501081_0433806 | Ga0501081_0433806_452_871 | 129 |
| 645 | 3300049744 | Ga0501083_0177623 | Ga0501083_0177623_301_693 | 129 |
| 646 | 3300049744 | Ga0501083_0441185 | Ga0501083_0441185_192_584 | 129 |
| 647 | 3300049744 | Ga0501083_0529277 | Ga0501083_0529277_180_581 | 129 |
| 648 | 3300049822 | Ga0501035_1407961 | Ga0501035_1407961_111_503 | 129 |
| 649 | 3300049824 | Ga0501045_0130429 | Ga0501045_0130429_1374_1775 | 129 |
| 650 | 3300049824 | Ga0501045_1254058 | Ga0501045_1254058_76_495 | 129 |
| 651 | 3300050507 | nmdc:mga05p37_147825_c1 | nmdc:mga05p37_147825_c1_381_791 | 129 |
| 652 | 3300050507 | nmdc:mga05p37_162599_c1 | nmdc:mga05p37_162599_c1_413_832 | 129 |
| 653 | 3300050507 | nmdc:mga05p37_21673_c1 | nmdc:mga05p37_21673_c1_5749_6168 | 129 |
| 654 | 3300050507 | nmdc:mga05p37_249633_c1 | nmdc:mga05p37_249633_c1_463_867 | 129 |
| 655 | 3300050507 | nmdc:mga05p37_570537_c1 | nmdc:mga05p37_570537_c1_864_1256 | 129 |
| 656 | 3300050507 | nmdc:mga05p37_6982_c1 | nmdc:mga05p37_6982_c1_5334_5726 | 129 |
| 657 | 3300050507 | nmdc:mga05p37_940374_c1 | nmdc:mga05p37_940374_c1_88_480 | 129 |
| 658 | 3300050508 | nmdc:mga09592_282052_c1 | nmdc:mga09592_282052_c1_803_1195 | 129 |
| 659 | 3300050508 | nmdc:mga09592_45734_c2 | nmdc:mga09592_45734_c2_2005_2424 | 129 |
| 660 | 3300050508 | nmdc:mga09592_5892_c1 | nmdc:mga09592_5892_c1_1530_1949 | 129 |
| 661 | 3300050509 | nmdc:mga0qj67_197595_c1 | nmdc:mga0qj67_197595_c1_415_807 | 129 |
| 662 | 3300050509 | nmdc:mga0qj67_272179_c1 | nmdc:mga0qj67_272179_c1_627_1019 | 129 |
| 663 | 3300050509 | nmdc:mga0qj67_292942_c1 | nmdc:mga0qj67_292942_c1_63_455 | 129 |
| 664 | 3300050509 | nmdc:mga0qj67_5884_c1 | nmdc:mga0qj67_5884_c1_1284_1703 | 129 |
| 665 | 3300050509 | nmdc:mga0qj67_78764_c1 | nmdc:mga0qj67_78764_c1_1256_1675 | 129 |
| 666 | 3300050510 | nmdc:mga06r32_13675_c1 | nmdc:mga06r32_13675_c1_5403_5795 | 129 |
| 667 | 3300050510 | nmdc:mga06r32_1410425_c1 | nmdc:mga06r32_1410425_c1_168_560 | 129 |
| 668 | 3300050510 | nmdc:mga06r32_15513_c1 | nmdc:mga06r32_15513_c1_170_589 | 129 |
| 669 | 3300050510 | nmdc:mga06r32_23758_c1 | nmdc:mga06r32_23758_c1_319_711 | 129 |
| 670 | 3300050510 | nmdc:mga06r32_328374_c1 | nmdc:mga06r32_328374_c1_180_572 | 129 |
| 671 | 3300050510 | nmdc:mga06r32_91349_c1 | nmdc:mga06r32_91349_c1_1765_2157 | 129 |
| 672 | 3300050511 | nmdc:mga08y16_1311_c1 | nmdc:mga08y16_1311_c1_6773_7165 | 129 |
| 673 | 3300050511 | nmdc:mga08y16_40988_c1 | nmdc:mga08y16_40988_c1_2479_2871 | 129 |
| 674 | 3300050511 | nmdc:mga08y16_543577_c1 | nmdc:mga08y16_543577_c1_56_448 | 129 |
| 675 | 3300050511 | nmdc:mga08y16_801129_c1 | nmdc:mga08y16_801129_c1_229_633 | 129 |
| 676 | 3300050512 | nmdc:mga0n895_1406937_c1 | nmdc:mga0n895_1406937_c1_208_627 | 129 |
| 677 | 3300050514 | nmdc:mga08x19_119768_c1 | nmdc:mga08x19_119768_c1_860_1252 | 129 |
| 678 | 3300050515 | nmdc:mga0a205_200356_c2 | nmdc:mga0a205_200356_c2_573_992 | 129 |
| 679 | 3300050515 | nmdc:mga0a205_68965_c1 | nmdc:mga0a205_68965_c1_1092_1496 | 129 |
| 680 | 3300053078 | Ga0495612_0413687 | Ga0495612_0413687_13_405 | 129 |
| 681 | 3300053085 | Ga0495619_0154142 | Ga0495619_0154142_60_452 | 129 |
| 682 | 3300053085 | Ga0495619_0371143 | Ga0495619_0371143_444_836 | 129 |
| 683 | 3300053096 | Ga0500641_0000772 | Ga0500641_0000772_5216_5608 | 129 |
| 684 | 3300054114 | Ga0501084_0015972 | Ga0501084_0015972_4189_4581 | 129 |
| 685 | 3300054114 | Ga0501084_0469648 | Ga0501084_0469648_31_432 | 129 |
| 686 | 3300059421 | Ga0590071_017054 | Ga0590071_017054_1147_1539 | 129 |
| 687 | 3300059423 | Ga0590074_040236 | Ga0590074_040236_191_583 | 129 |
| 688 | 3300059424 | Ga0590075_006059 | Ga0590075_006059_2154_2546 | 129 |
| 689 | 3300059426 | Ga0590077_006077 | Ga0590077_006077_428_820 | 129 |
| 690 | 3300060353 | Ga0501082_0061054 | Ga0501082_0061054_2669_3070 | 129 |
| 691 | 3300060353 | Ga0501082_0774658 | Ga0501082_0774658_38_430 | 129 |
| 692 | 3300061734 | Ga0530510_0026022 | Ga0530510_0026022_2283_2684 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kmf-assembly1.cif.gz_A-2 | crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna | 0.9286 | 13 | 70 |
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.9215 | 8 | 70 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9199 | 13 | 70 |
| 2xig-assembly2.cif.gz_A | the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites | 0.9169 | 13 | 72 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9028 | 13 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9694 | 9 | 69 | 1.10.10.10 |
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9387 | 12 | 70 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9385 | 9 | 69 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9332 | 23 | 71 | 3.30.230.130 |
| 4kmfA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9286 | 13 | 70 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2ASF8-F1-model_v4 | Orc1-like AAA ATPase domain-containing protein | 0.954 | 7 | 73 |
|
| AF-A0A7C4PNP8-F1-model_v4 | ATP-dependent DNA helicase RecG C-terminal domain-containing protein | 0.9434 | 9 | 70 |
GO:0003677
GO:0045892 |
| AF-G9EPR1-F1-model_v4 | ATP-dependent DNA helicase RecG C-terminal domain-containing protein | 0.9339 | 7 | 72 |
|
| AF-A0A2S5SWH3-F1-model_v4 | Uncharacterized protein | 0.9311 | 9 | 72 |
|
| AF-A0A4R1RDV8-F1-model_v4 | Uncharacterized protein | 0.931 | 9 | 72 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar