F475640

General Info

Members Datasets Scaffolds Average Seq Length
693 402 1386 155

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10002031|Ga0081538_100020317
Length 167
Sequence VPRSSPRRIAGRGAEASRPAADAQPAQPILPPFTEETARLKVKLAEDAWNTRDPEIVVLAYTEDSEWRNRTEFLRGRAEIRAFLERKWRREREYRLRKELWAFSDNRISVRFEYESRDRSGQWWRSYGNEHWGFDEASGLIHRRDASINDYRIEPSERRIREVVLAT

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
242 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
243 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
353 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
358 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
359 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
360 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
361 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
362 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
363 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
364 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
365 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
366 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
367 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
368 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
369 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
370 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
371 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
372 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
373 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
374 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
375 2643221559 Lysobacter sp. Root559 Isolate Unclassified
376 2643221586 Lysobacter sp. Root667 Isolate Unclassified
377 2643221607 Rhizobium sp. Root73 Isolate Unclassified
378 2643221612 Lysobacter sp. Root76 Isolate Unclassified
379 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
380 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
381 2643221727 Lysobacter sp. Root96 Isolate Unclassified
382 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
383 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
384 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
385 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
386 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
387 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
388 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
389 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
390 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
391 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
392 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
393 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
394 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
395 2857558681 Duganella sp. R-74565 Isolate Unclassified
396 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
397 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
398 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
399 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
400 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
401 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
402 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0.72
Isolates 6.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.78
Nodule 2.16
Rhizoplane 5.34
Rhizosphere 77.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10002031 3300005981 Bacteria 20235
2 JGI24740J21852_10000004 3300001979 Bacteria 91019
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25162J39368_1000482 3300002737 Bacteria 30484
5 JGI25162J39368_1002120 3300002737 Bacteria 8430
6 JGI25154J39366_1000096 3300002738 Bacteria 79168
7 JGI25157J39369_1000005 3300002741 Bacteria 269089
8 JGI25159J45721_1000854 3300002987 Bacteria 13275
9 JGI25165J46597_1000190 3300003214 Bacteria 91363
10 JGI25165J46597_1000328 3300003214 Bacteria 56610
11 JGI25165J46597_1003751 3300003214 Bacteria 3586
12 rootH1_10031765 3300003316 Bacteria 4802
13 rootL2_10002812 3300003322 Bacteria 40354
14 JGI25160J50197_1000108 3300003354 Bacteria 77944
15 JGI25161J50226_1000112 3300003374 Bacteria 63152
16 Ga0055526_1001333 3300003771 Bacteria 17671
17 Ga0055524_1033922 3300003775 Bacteria 1420
18 Ga0055536_1022503 3300003781 Bacteria 1879
19 Ga0055540_1007954 3300003792 Bacteria 3896
20 Ga0055531_10000267 3300003794 Bacteria 54377
21 Ga0058692_1004915 3300003856 Bacteria 3886
22 Ga0055543_1000080 3300004625 Bacteria 84865
23 Ga0065165_1000520 3300005262 Bacteria 58925
24 Ga0070658_10086082 3300005327 Bacteria 2585
25 Ga0070658_10385511 3300005327 Bacteria 1203
26 Ga0070658_10493591 3300005327 Bacteria 1057
27 Ga0070658_10745425 3300005327 Bacteria 850
28 Ga0070683_100041942 3300005329 Bacteria 4213
29 Ga0070683_100467121 3300005329 Bacteria 1204
30 Ga0070690_100630075 3300005330 Bacteria 817
31 Ga0070670_100254844 3300005331 Bacteria 1529
32 Ga0068869_100051341 3300005334 Bacteria 2992
33 Ga0070666_10099304 3300005335 Bacteria 2004
34 Ga0070666_10589254 3300005335 Bacteria 811
35 Ga0070680_100047938 3300005336 Bacteria 3481
36 Ga0070680_100115766 3300005336 Bacteria 2234
37 Ga0070680_100201385 3300005336 Bacteria 1679
38 Ga0070682_100009618 3300005337 Bacteria 5472
39 Ga0070682_100095471 3300005337 Bacteria 1952
40 Ga0070682_100728445 3300005337 Bacteria 798
41 Ga0068868_100013631 3300005338 Bacteria 5968
42 Ga0068868_100076723 3300005338 Bacteria 2672
43 Ga0068868_101655831 3300005338 Bacteria 602
44 Ga0070660_100035037 3300005339 Bacteria 3797
45 Ga0070660_100203320 3300005339 Bacteria 1607
46 Ga0070660_100308817 3300005339 Bacteria 1297
47 Ga0070660_100368372 3300005339 Bacteria 1185
48 Ga0070689_100000011 3300005340 Bacteria 218327
49 Ga0070691_10032551 3300005341 Bacteria 2450
50 Ga0070661_100198105 3300005344 Bacteria 1533
51 Ga0070661_100470760 3300005344 Bacteria 1002
52 Ga0070692_10041940 3300005345 Bacteria 2347
53 Ga0070675_100173981 3300005354 Bacteria 1858
54 Ga0070675_100475295 3300005354 Bacteria 1123
55 Ga0070671_100176013 3300005355 Bacteria 1810
56 Ga0070674_100260725 3300005356 Bacteria 1365
57 Ga0070673_100147575 3300005364 Bacteria 1989
58 Ga0070673_100487097 3300005364 Bacteria 1114
59 Ga0070659_100010471 3300005366 Bacteria 6823
60 Ga0070659_100402439 3300005366 Bacteria 1156
61 Ga0070667_100205573 3300005367 Bacteria 1748
62 Ga0070667_100295811 3300005367 Bacteria 1457
63 Ga0070703_10185235 3300005406 Bacteria 807
64 Ga0070709_10029024 3300005434 Bacteria 3305
65 Ga0070714_100038783 3300005435 Bacteria 4007
66 Ga0070714_100117709 3300005435 Bacteria 2360
67 Ga0070714_100274116 3300005435 Bacteria 1565
68 Ga0070714_100417886 3300005435 Bacteria 1270
69 Ga0070714_101805288 3300005435 Bacteria 597
70 Ga0070713_100220761 3300005436 Bacteria 1719
71 Ga0070713_100702139 3300005436 Bacteria 966
72 Ga0070710_10033556 3300005437 Bacteria 2788
73 Ga0070710_10229356 3300005437 Bacteria 1185
74 Ga0070710_11445820 3300005437 Bacteria 515
75 Ga0070711_100004682 3300005439 Bacteria 8100
76 Ga0070711_100020164 3300005439 Bacteria 4291
77 Ga0070711_100521994 3300005439 Bacteria 982
78 Ga0070705_100436455 3300005440 Bacteria 979
79 Ga0070700_100009767 3300005441 Bacteria 5275
80 Ga0070708_100106158 3300005445 Bacteria 2578
81 Ga0070708_100233771 3300005445 Bacteria 1725
82 Ga0070663_100068056 3300005455 Bacteria 2585
83 Ga0070663_100324004 3300005455 Bacteria 1240
84 Ga0070678_100152979 3300005456 Bacteria 1860
85 Ga0070678_100786835 3300005456 Bacteria 863
86 Ga0070662_100004473 3300005457 Bacteria 8848
87 Ga0070662_100505209 3300005457 Bacteria 1009
88 Ga0070662_100674675 3300005457 Bacteria 873
89 Ga0070681_10007311 3300005458 Bacteria 10782
90 Ga0070681_10093296 3300005458 Bacteria 2959
91 Ga0070681_10315863 3300005458 Bacteria 1472
92 Ga0070681_10423768 3300005458 Bacteria 1243
93 Ga0070681_10472778 3300005458 Bacteria 1166
94 Ga0068867_100026766 3300005459 Bacteria 4143
95 Ga0070706_100123540 3300005467 Bacteria 2413
96 Ga0070707_100088574 3300005468 Bacteria 2994
97 Ga0070707_100939741 3300005468 Bacteria 829
98 Ga0070698_100349576 3300005471 Bacteria 1410
99 Ga0070699_100034260 3300005518 Bacteria 4389
100 Ga0070699_100070075 3300005518 Bacteria 3048
101 Ga0070699_100838453 3300005518 Bacteria 842
102 Ga0070679_100002524 3300005530 Bacteria 16591
103 Ga0070679_100065436 3300005530 Bacteria 3624
104 Ga0070679_100194515 3300005530 Bacteria 1996
105 Ga0070679_100204241 3300005530 Bacteria 1940
106 Ga0070684_100002960 3300005535 Bacteria 12646
107 Ga0070684_100005420 3300005535 Bacteria 9775
108 Ga0070684_100191006 3300005535 Bacteria 1863
109 Ga0070684_100239612 3300005535 Bacteria 1657
110 Ga0070697_100466425 3300005536 Bacteria 1101
111 Ga0068853_100809061 3300005539 Bacteria 898
112 Ga0068853_101127529 3300005539 Bacteria 757
113 Ga0068853_101217927 3300005539 Bacteria 727
114 Ga0070686_100030262 3300005544 Bacteria 3301
115 Ga0070686_100527839 3300005544 Bacteria 920
116 Ga0070695_100001972 3300005545 Bacteria 11667
117 Ga0070696_100030203 3300005546 Bacteria 3709
118 Ga0070693_100036544 3300005547 Bacteria 2732
119 Ga0070665_100000186 3300005548 Bacteria 110750
120 Ga0070665_100274209 3300005548 Bacteria 1688
121 Ga0070665_100529507 3300005548 Bacteria 1190
122 Ga0068855_100041744 3300005563 Bacteria 5436
123 Ga0068855_100445875 3300005563 Bacteria 1413
124 Ga0068855_101156135 3300005563 Bacteria 807
125 Ga0070664_100010347 3300005564 Bacteria 7567
126 Ga0068857_100123129 3300005577 Bacteria 2336
127 Ga0068857_101244320 3300005577 Bacteria 721
128 Ga0068854_100070076 3300005578 Bacteria 2562
129 Ga0068854_100127340 3300005578 Bacteria 1941
130 Ga0068854_100699668 3300005578 Bacteria 875
131 Ga0068856_100003522 3300005614 Bacteria 15780
132 Ga0068856_100037635 3300005614 Bacteria 4747
133 Ga0068856_100092720 3300005614 Bacteria 3006
134 Ga0068856_100116408 3300005614 Bacteria 2673
135 Ga0068856_100177050 3300005614 Bacteria 2145
136 Ga0068856_100208925 3300005614 Bacteria 1967
137 Ga0068856_100277015 3300005614 Bacteria 1694
138 Ga0068856_101414485 3300005614 Bacteria 710
139 Ga0070702_100054952 3300005615 Bacteria 2293
140 Ga0068852_100112543 3300005616 Bacteria 2477
141 Ga0068852_101462955 3300005616 Bacteria 705
142 Ga0068852_101597465 3300005616 Bacteria 674
143 Ga0068859_100188731 3300005617 Bacteria 2145
144 Ga0068859_102480016 3300005617 Bacteria 571
145 Ga0068864_100025130 3300005618 Bacteria 5014
146 Ga0068864_100859777 3300005618 Bacteria 894
147 Ga0068866_10016241 3300005718 Bacteria 3324
148 Ga0068861_101666061 3300005719 Bacteria 630
149 Ga0068851_10050700 3300005834 Bacteria 2107
150 Ga0068851_10068170 3300005834 Bacteria 1836
151 Ga0068863_100224986 3300005841 Bacteria 1809
152 Ga0068863_101377241 3300005841 Bacteria 713
153 Ga0068858_100032669 3300005842 Bacteria 4832
154 Ga0068860_100080173 3300005843 Bacteria 3104
155 Ga0068862_100017651 3300005844 Bacteria 5940
156 Ga0068862_100776020 3300005844 Bacteria 934
157 Ga0081538_10039777 3300005981 Bacteria 3010
158 Ga0070717_10470220 3300006028 Bacteria 1135
159 Ga0070717_10484418 3300006028 Bacteria 1117
160 Ga0070717_10531707 3300006028 Bacteria 1064
161 Ga0070717_11779765 3300006028 Bacteria 557
162 Ga0075363_100767426 3300006048 Bacteria 585
163 Ga0070715_10039805 3300006163 Bacteria 1961
164 Ga0070716_100017106 3300006173 Bacteria 3753
165 Ga0070712_100054434 3300006175 Bacteria 2797
166 Ga0070712_100168376 3300006175 Bacteria 1698
167 Ga0070712_100182200 3300006175 Bacteria 1637
168 Ga0075367_10544489 3300006178 Bacteria 737
169 Ga0075366_10009449 3300006195 Bacteria 5442
170 Ga0075366_10317092 3300006195 Bacteria 955
171 Ga0097621_100014178 3300006237 Bacteria 5961
172 Ga0097621_100154305 3300006237 Bacteria 1970
173 Ga0075370_10031452 3300006353 Bacteria 2963
174 Ga0075370_10067848 3300006353 Bacteria 2036
175 Ga0068871_100964030 3300006358 Bacteria 793
176 Ga0075434_100794036 3300006871 Bacteria 963
177 Ga0068865_100080121 3300006881 Bacteria 2341
178 Ga0068865_100106975 3300006881 Bacteria 2057
179 Ga0068865_100144120 3300006881 Bacteria 1799
180 Ga0068865_100208869 3300006881 Bacteria 1520
181 Ga0097620_100188722 3300006931 Bacteria 2145
182 Ga0079104_1009299 3300006946 Bacteria 3341
183 Ga0075435_100933220 3300007076 Bacteria 757
184 Ga0105250_10138795 3300009092 Bacteria 1007
185 Ga0105240_10000013 3300009093 Bacteria 483458
186 Ga0105240_10014421 3300009093 Bacteria 10789
187 Ga0105240_10807400 3300009093 Bacteria 1016
188 Ga0105240_11221854 3300009093 Bacteria 795
189 Ga0111539_10015046 3300009094 Bacteria 9642
190 Ga0111539_10255411 3300009094 Bacteria 2041
191 Ga0111539_11706741 3300009094 Bacteria 730
192 Ga0105245_10001224 3300009098 Bacteria 23180
193 Ga0105245_10016264 3300009098 Bacteria 6486
194 Ga0105245_10087901 3300009098 Bacteria 2853
195 Ga0105247_10106650 3300009101 Bacteria 1798
196 Ga0105247_10156239 3300009101 Bacteria 1507
197 Ga0105243_10104890 3300009148 Bacteria 2354
198 Ga0105243_10556996 3300009148 Bacteria 1096
199 Ga0105243_11217058 3300009148 Bacteria 767
200 Ga0105241_10061714 3300009174 Bacteria 2888
201 Ga0105241_10662740 3300009174 Bacteria 949
202 Ga0105241_10701863 3300009174 Bacteria 924
203 Ga0105242_10010437 3300009176 Bacteria 7126
204 Ga0105248_10092781 3300009177 Bacteria 3400
205 Ga0105248_10456738 3300009177 Bacteria 1440
206 Ga0105248_12770110 3300009177 Bacteria 559
207 Ga0105237_10078229 3300009545 Bacteria 3297
208 Ga0105237_10465050 3300009545 Bacteria 1271
209 Ga0105237_10729085 3300009545 Bacteria 998
210 Ga0105249_10184445 3300009553 Bacteria 2032
211 Ga0105249_10200426 3300009553 Bacteria 1953
212 Ga0105249_10428033 3300009553 Bacteria 1358
213 Ga0105249_11631903 3300009553 Bacteria 717
214 Ga0105239_10009215 3300010375 Bacteria 11163
215 Ga0105239_10031939 3300010375 Bacteria 5785
216 Ga0105239_10044154 3300010375 Bacteria 4886
217 Ga0105239_10048377 3300010375 Bacteria 4663
218 Ga0105239_10055507 3300010375 Bacteria 4344
219 Ga0105239_10061892 3300010375 Bacteria 4108
220 Ga0105239_10077711 3300010375 Bacteria 3653
221 Ga0105239_10559742 3300010375 Bacteria 1302
222 Ga0105246_10012939 3300011119 Bacteria 5220
223 Ga0105246_10085153 3300011119 Bacteria 2263
224 Ga0105246_10748839 3300011119 Bacteria 861
225 Ga0157373_10235011 3300013100 Bacteria 1295
226 Ga0157371_10054302 3300013102 Bacteria 2845
227 Ga0157371_10142614 3300013102 Bacteria 1706
228 Ga0157370_10000548 3300013104 Bacteria 46830
229 Ga0157370_10145970 3300013104 Bacteria 2203
230 Ga0157370_10202741 3300013104 Bacteria 1840
231 Ga0157369_10001204 3300013105 Bacteria 32229
232 Ga0157369_10713039 3300013105 Bacteria 1033
233 Ga0157374_10105687 3300013296 Bacteria 2704
234 Ga0157374_10129617 3300013296 Bacteria 2440
235 Ga0157374_11256810 3300013296 Bacteria 762
236 Ga0157378_10083988 3300013297 Bacteria 2883
237 Ga0157378_12783285 3300013297 Bacteria 542
238 Ga0157372_10015956 3300013307 Bacteria 8056
239 Ga0157372_10019760 3300013307 Bacteria 7259
240 Ga0157372_10044577 3300013307 Bacteria 4915
241 Ga0157375_10094529 3300013308 Bacteria 3058
242 Ga0157375_10212989 3300013308 Bacteria 2090
243 Ga0163163_10016580 3300014325 Bacteria 6851
244 Ga0163163_10236919 3300014325 Bacteria 1874
245 Ga0163163_10515752 3300014325 Bacteria 1257
246 Ga0157380_10009578 3300014326 Bacteria 6949
247 Ga0182008_10518573 3300014497 Bacteria 658
248 Ga0157377_10004856 3300014745 Bacteria 6250
249 Ga0157376_10256790 3300014969 Bacteria 1635
250 Ga0182007_10001962 3300015262 Bacteria 10639
251 Ga0163161_10357567 3300017792 Bacteria 1162
252 Ga0163161_10386951 3300017792 Bacteria 1119
253 Ga0206356_10956483 3300020070 Bacteria 1623
254 Ga0206353_11753941 3300020082 Bacteria 646
255 Ga0154015_1553135 3300020610 Bacteria 588
256 Ga0213872_10106191 3300021361 Bacteria 1250
257 Ga0213875_10118891 3300021388 Bacteria 1235
258 Ga0224712_10023016 3300022467 Bacteria 2157
259 Ga0224712_10099423 3300022467 Bacteria 1231
260 Ga0209435_100009 3300025206 Bacteria 476614
261 Ga0209436_109771 3300025208 Bacteria 1799
262 Ga0209672_113991 3300025228 Bacteria 943
263 Ga0209437_100057 3300025233 Bacteria 362922
264 Ga0209437_100206 3300025233 Bacteria 115048
265 Ga0209646_1000018 3300025246 Bacteria 476716
266 Ga0209646_1006705 3300025246 Bacteria 1921
267 Ga0209646_1024903 3300025246 Bacteria 839
268 Ga0209026_1000043 3300025250 Bacteria 269142
269 Ga0209677_100446 3300025253 Bacteria 24001
270 Ga0209148_1011094 3300025254 Bacteria 1685
271 Ga0209759_1000007 3300025256 Bacteria 476614
272 Ga0209759_1017541 3300025256 Bacteria 1761
273 Ga0209233_1000130 3300025261 Bacteria 205687
274 Ga0209233_1000178 3300025261 Bacteria 140956
275 Ga0209233_1000256 3300025261 Bacteria 80855
276 Ga0209455_1011113 3300025272 Bacteria 2236
277 Ga0209673_1011373 3300025273 Bacteria 3674
278 Ga0209673_1017967 3300025273 Bacteria 2589
279 Ga0209130_1000108 3300025284 Bacteria 133733
280 Ga0209676_1000026 3300025292 Bacteria 574599
281 Ga0209564_1001682 3300025295 Bacteria 21003
282 Ga0209256_1004417 3300025299 Bacteria 8843
283 Ga0207426_1000082 3300025302 Bacteria 298939
284 Ga0209051_1005354 3300025303 Bacteria 7537
285 Ga0209257_1000101 3300025304 Bacteria 251553
286 Ga0207692_10049588 3300025898 Bacteria 2120
287 Ga0207692_10874292 3300025898 Bacteria 590
288 Ga0207642_10590415 3300025899 Bacteria 690
289 Ga0207710_10025558 3300025900 Bacteria 2548
290 Ga0207710_10391886 3300025900 Bacteria 712
291 Ga0207688_10002214 3300025901 Bacteria 10471
292 Ga0207688_10031918 3300025901 Bacteria 2909
293 Ga0207680_10177483 3300025903 Bacteria 1438
294 Ga0207680_10670578 3300025903 Bacteria 743
295 Ga0207647_10262143 3300025904 Bacteria 990
296 Ga0207685_10011655 3300025905 Bacteria 2652
297 Ga0207685_10453978 3300025905 Bacteria 667
298 Ga0207699_10002942 3300025906 Bacteria 8103
299 Ga0207705_10071191 3300025909 Bacteria 2520
300 Ga0207705_10093568 3300025909 Bacteria 2203
301 Ga0207705_10134728 3300025909 Bacteria 1840
302 Ga0207684_10410664 3300025910 Bacteria 1164
303 Ga0207707_10053417 3300025912 Bacteria 3517
304 Ga0207707_10081938 3300025912 Bacteria 2817
305 Ga0207707_10261072 3300025912 Bacteria 1503
306 Ga0207707_10263627 3300025912 Bacteria 1494
307 Ga0207707_10426782 3300025912 Bacteria 1136
308 Ga0207695_10000044 3300025913 Bacteria 440819
309 Ga0207695_10038220 3300025913 Bacteria 5170
310 Ga0207695_10848774 3300025913 Bacteria 793
311 Ga0207671_10000497 3300025914 Bacteria 53394
312 Ga0207671_10705220 3300025914 Bacteria 802
313 Ga0207693_10010064 3300025915 Bacteria 7682
314 Ga0207693_10057148 3300025915 Bacteria 3059
315 Ga0207693_10124804 3300025915 Bacteria 2023
316 Ga0207693_10202919 3300025915 Bacteria 1559
317 Ga0207693_10543738 3300025915 Bacteria 906
318 Ga0207663_10046066 3300025916 Bacteria 2685
319 Ga0207663_10431583 3300025916 Bacteria 1013
320 Ga0207663_10984282 3300025916 Bacteria 676
321 Ga0207660_10240065 3300025917 Bacteria 1427
322 Ga0207657_10067226 3300025919 Bacteria 3048
323 Ga0207657_10162065 3300025919 Bacteria 1816
324 Ga0207657_10187051 3300025919 Bacteria 1672
325 Ga0207657_10194130 3300025919 Bacteria 1636
326 Ga0207657_10491680 3300025919 Bacteria 961
327 Ga0207649_10012185 3300025920 Bacteria 4762
328 Ga0207652_10023694 3300025921 Bacteria 5087
329 Ga0207652_10085956 3300025921 Bacteria 2757
330 Ga0207652_10092105 3300025921 Bacteria 2666
331 Ga0207652_10119634 3300025921 Bacteria 2342
332 Ga0207646_10031227 3300025922 Bacteria 4824
333 Ga0207681_10449373 3300025923 Bacteria 1048
334 Ga0207694_10367010 3300025924 Bacteria 1194
335 Ga0207650_10914483 3300025925 Bacteria 745
336 Ga0207659_10248145 3300025926 Bacteria 1443
337 Ga0207659_11188531 3300025926 Bacteria 656
338 Ga0207687_10027848 3300025927 Bacteria 3793
339 Ga0207700_10214725 3300025928 Bacteria 1628
340 Ga0207700_10717081 3300025928 Bacteria 893
341 Ga0207700_10890326 3300025928 Bacteria 796
342 Ga0207664_10216366 3300025929 Bacteria 1660
343 Ga0207664_11172501 3300025929 Bacteria 686
344 Ga0207644_10076085 3300025931 Bacteria 2468
345 Ga0207690_10296642 3300025932 Bacteria 1263
346 Ga0207706_10006716 3300025933 Bacteria 10636
347 Ga0207706_10061733 3300025933 Bacteria 3300
348 Ga0207706_10513547 3300025933 Bacteria 1033
349 Ga0207686_11022808 3300025934 Bacteria 671
350 Ga0207709_10108618 3300025935 Bacteria 1850
351 Ga0207709_10602823 3300025935 Bacteria 870
352 Ga0207709_10882642 3300025935 Bacteria 726
353 Ga0207670_10000005 3300025936 Bacteria 431451
354 Ga0207669_10272934 3300025937 Bacteria 1271
355 Ga0207669_10983974 3300025937 Bacteria 708
356 Ga0207665_10018756 3300025939 Bacteria 4546
357 Ga0207689_10033848 3300025942 Bacteria 4244
358 Ga0207689_10421645 3300025942 Bacteria 1114
359 Ga0207661_10001855 3300025944 Bacteria 14463
360 Ga0207679_10699919 3300025945 Bacteria 919
361 Ga0207679_10791627 3300025945 Bacteria 864
362 Ga0207667_10225114 3300025949 Bacteria 1921
363 Ga0207667_10391591 3300025949 Bacteria 1415
364 Ga0207667_11395047 3300025949 Bacteria 674
365 Ga0207712_10141058 3300025961 Bacteria 1849
366 Ga0207712_10186069 3300025961 Bacteria 1635
367 Ga0207712_11430135 3300025961 Bacteria 619
368 Ga0207668_10087503 3300025972 Bacteria 2279
369 Ga0207668_11089933 3300025972 Bacteria 716
370 Ga0207640_10113194 3300025981 Bacteria 1928
371 Ga0207640_10148927 3300025981 Bacteria 1717
372 Ga0207640_10160636 3300025981 Bacteria 1662
373 Ga0207640_10338302 3300025981 Bacteria 1204
374 Ga0207658_10443852 3300025986 Bacteria 1147
375 Ga0207677_10033829 3300026023 Bacteria 3302
376 Ga0207677_10532029 3300026023 Bacteria 1021
377 Ga0207703_11493239 3300026035 Bacteria 650
378 Ga0207639_10583002 3300026041 Bacteria 1030
379 Ga0207639_10618958 3300026041 Bacteria 1000
380 Ga0207678_10005739 3300026067 Bacteria 11078
381 Ga0207678_10085737 3300026067 Bacteria 2692
382 Ga0207678_11434413 3300026067 Bacteria 610
383 Ga0207708_10075771 3300026075 Bacteria 2580
384 Ga0207702_10044539 3300026078 Bacteria 3730
385 Ga0207702_10140725 3300026078 Bacteria 2183
386 Ga0207702_10204599 3300026078 Bacteria 1832
387 Ga0207702_10318650 3300026078 Bacteria 1480
388 Ga0207702_10330298 3300026078 Bacteria 1454
389 Ga0207702_10691472 3300026078 Bacteria 1005
390 Ga0207702_11188704 3300026078 Bacteria 757
391 Ga0207702_11574425 3300026078 Bacteria 650
392 Ga0207641_10182939 3300026088 Bacteria 1921
393 Ga0207648_10164698 3300026089 Bacteria 1959
394 Ga0207676_10504384 3300026095 Bacteria 1149
395 Ga0207674_10045401 3300026116 Bacteria 4520
396 Ga0207674_10380851 3300026116 Bacteria 1364
397 Ga0207675_100053049 3300026118 Bacteria 3784
398 Ga0207675_100066515 3300026118 Bacteria 3369
399 Ga0207683_10038033 3300026121 Bacteria 4191
400 Ga0207683_10292395 3300026121 Bacteria 1490
401 Ga0207683_10386401 3300026121 Bacteria 1287
402 Ga0207683_10565988 3300026121 Bacteria 1051
403 Ga0207698_10004537 3300026142 Bacteria 8476
404 Ga0207698_10097419 3300026142 Bacteria 2427
405 Ga0209371_1009172 3300027312 Bacteria 3174
406 Ga0268266_10000002 3300028379 Bacteria 3059047
407 Ga0268266_10098313 3300028379 Bacteria 2575
408 Ga0268266_10578736 3300028379 Bacteria 1077
409 Ga0268264_10574568 3300028381 Bacteria 1108
410 Ga0268256_1022771 3300030500 Bacteria 1637
411 Ga0307511_10332586 3300030521 Bacteria 664
412 Ga0265327_10012708 3300031251 Bacteria 5655
413 Ga0307509_10121187 3300031507 Bacteria 2593
414 Ga0307516_10000466 3300031730 Bacteria 53591
415 Ga0307409_100062646 3300031995 Bacteria 2913
416 Ga0307416_100444873 3300032002 Bacteria 1347
417 Ga0307414_11559135 3300032004 Bacteria 615
418 Ga0307415_100006169 3300032126 Bacteria 6436
419 Ga0373926_0027809 3300035083 Bacteria 1983
420 Ga0373934_0141393 3300035086 Bacteria 984
421 Ga0373944_0007659 3300035089 Bacteria 2899
422 Ga0373954_0036727 3300035118 Bacteria 2275
423 Ga0373954_0119932 3300035118 Bacteria 1276
424 Ga0373956_0246989 3300035119 Bacteria 848
425 Ga0373943_0180602 3300035170 Bacteria 1159
426 Ga0373946_0005767 3300035171 Bacteria 4481
427 Ga0373955_0028940 3300035172 Bacteria 2877
428 Ga0373927_0007531 3300035695 Bacteria 7364
429 Ga0373933_0073582 3300035724 Bacteria 2082
430 Ga0373947_0268674 3300035725 Bacteria 1132
431 Ga0373937_0005733 3300036401 Bacteria 10667
432 Ga0373937_0030192 3300036401 Bacteria 4910
433 Ga0373925_0046884 3300037068 Bacteria 3215
434 Ga0373925_0080630 3300037068 Bacteria 2473
435 Ga0395899_0534859 3300037312 Bacteria 755
436 Ga0395900_0062404 3300037418 Bacteria 3831
437 Ga0395900_0108574 3300037418 Bacteria 2851
438 Ga0395900_0701420 3300037418 Bacteria 945
439 Ga0395900_1063695 3300037418 Bacteria 727
440 Ga0395898_0022342 3300037466 Bacteria 6407
441 Ga0395898_0064956 3300037466 Bacteria 3539
442 Ga0395898_0117445 3300037466 Bacteria 2549
443 Ga0395898_0137452 3300037466 Bacteria 2340
444 Ga0395898_0635509 3300037466 Bacteria 1010
445 Ga0395905_0048174 3300037471 Bacteria 3994
446 Ga0436364_0171955 3300037853 Bacteria 2793
447 Ga0436364_1066521 3300037853 Bacteria 1769
448 Ga0395901_0042923 3300038443 Bacteria 4690
449 Ga0395901_0093676 3300038443 Bacteria 3145
450 Ga0395901_0197055 3300038443 Bacteria 2112
451 Ga0436361_1005664 3300039447 Bacteria 1226
452 Ga0436362_0236764 3300039453 Bacteria 578
453 Ga0436362_0812596 3300039453 Bacteria 656
454 Ga0451793_0623273 3300041452 Bacteria 601
455 Ga0451837_0218467 3300041494 Bacteria 864
456 Ga0451843_1432846 3300041509 Bacteria 714
457 Ga0451577_0008357 3300042876 Bacteria 10075
458 Ga0466972_0273279 3300044658 Bacteria 790
459 Ga0466966_0307859 3300044684 Bacteria 952
460 Ga0466966_0746771 3300044684 Bacteria 590
461 Ga0466961_0147969 3300044693 Bacteria 1468
462 Ga0466961_0550734 3300044693 Bacteria 695
463 Ga0466963_0004810 3300044694 Bacteria 7871
464 Ga0466963_0008345 3300044694 Bacteria 6206
465 Ga0466963_0056490 3300044694 Bacteria 2612
466 Ga0466963_0068120 3300044694 Bacteria 2390
467 Ga0466963_0402362 3300044694 Bacteria 965
468 Ga0466963_0429687 3300044694 Bacteria 931
469 Ga0466964_0117045 3300044706 Bacteria 1196
470 Ga0466964_0136440 3300044706 Bacteria 1123
471 Ga0466964_0188703 3300044706 Bacteria 982
472 Ga0466964_0309934 3300044706 Bacteria 798
473 Ga0453684_0061890 3300044712 Bacteria 4800
474 Ga0466971_0133651 3300044719 Bacteria 1153
475 Ga0466970_0000492 3300044765 Bacteria 19391
476 Ga0466970_0243380 3300044765 Bacteria 1007
477 Ga0466957_0002260 3300044842 Bacteria 10321
478 Ga0466960_0228615 3300044901 Bacteria 1026
479 Ga0466960_0751473 3300044901 Bacteria 588
480 Ga0466959_0007213 3300045049 Bacteria 7787
481 Ga0466959_0123564 3300045049 Bacteria 1838
482 Ga0466959_0488960 3300045049 Bacteria 832
483 Ga0451576_0166707 3300045051 Bacteria 2299
484 Ga0451576_0786934 3300045051 Bacteria 999
485 Ga0466958_0005181 3300045836 Bacteria 6978
486 Ga0466958_0027596 3300045836 Bacteria 3361
487 Ga0466967_0001146 3300045976 Bacteria 14811
488 Ga0466967_0003704 3300045976 Bacteria 10066
489 Ga0466967_0005558 3300045976 Bacteria 8755
490 Ga0466967_0046076 3300045976 Bacteria 3794
491 Ga0466967_0063795 3300045976 Bacteria 3275
492 Ga0466967_0087945 3300045976 Bacteria 2818
493 Ga0466967_0116837 3300045976 Bacteria 2458
494 Ga0466967_0127008 3300045976 Bacteria 2363
495 Ga0466967_0209469 3300045976 Bacteria 1848
496 Ga0466967_0764810 3300045976 Bacteria 958
497 Ga0466967_0849296 3300045976 Bacteria 907
498 Ga0466967_1050520 3300045976 Bacteria 811
499 Ga0466967_1263438 3300045976 Bacteria 735
500 Ga0466967_2023755 3300045976 Bacteria 572
501 Ga0466967_2149273 3300045976 Bacteria 554
502 Ga0495603_0108067 3300046455 Bacteria 1623
503 Ga0495638_0001474 3300046460 Bacteria 21249
504 Ga0495650_0223333 3300046471 Bacteria 648
505 Ga0495580_0000706 3300046472 Bacteria 28537
506 Ga0495580_0058866 3300046472 Bacteria 2701
507 Ga0495580_0087829 3300046472 Bacteria 2165
508 Ga0495580_0251750 3300046472 Bacteria 1209
509 Ga0495639_0179149 3300046475 Bacteria 1031
510 Ga0495594_0252620 3300046499 Bacteria 1004
511 Ga0495607_0008237 3300046501 Bacteria 7133
512 Ga0495618_0004080 3300046514 Bacteria 9013
513 Ga0495628_0242428 3300046516 Bacteria 1348
514 Ga0495630_0075548 3300046517 Bacteria 2539
515 Ga0495630_0080706 3300046517 Bacteria 2454
516 Ga0495648_0013758 3300046524 Bacteria 5964
517 Ga0495652_0272924 3300046529 Bacteria 1242
518 Ga0495665_0349180 3300046531 Bacteria 753
519 Ga0495586_0378298 3300046535 Bacteria 814
520 Ga0495587_0047476 3300046536 Bacteria 2545
521 Ga0495645_0305684 3300046543 Bacteria 1037
522 Ga0495622_0240512 3300046557 Bacteria 798
523 Ga0495634_0051102 3300046642 Bacteria 2774
524 Ga0495625_0008078 3300046660 Bacteria 9025
525 Ga0495635_0125372 3300046663 Bacteria 1751
526 Ga0495661_0041185 3300046665 Bacteria 2860
527 Ga0495588_0059480 3300046674 Bacteria 1977
528 Ga0495588_0216040 3300046674 Bacteria 1012
529 Ga0495657_0058286 3300046675 Bacteria 2565
530 Ga0495599_0117288 3300046678 Bacteria 1656
531 Ga0495647_0021287 3300046681 Bacteria 2334
532 Ga0495613_1013711 3300046689 Bacteria 533
533 Ga0495624_0137675 3300046690 Bacteria 1496
534 Ga0495589_0222215 3300046794 Bacteria 887
535 Ga0495674_0227637 3300047319 Bacteria 1540
536 Ga0495674_0989465 3300047319 Bacteria 645
537 Ga0495674_1070087 3300047319 Bacteria 615
538 Ga0495676_0152643 3300047321 Bacteria 1642
539 Ga0495683_0000811 3300047323 Bacteria 22242
540 Ga0495687_080052 3300047443 Bacteria 1282
541 Ga0495686_0002926 3300047472 Bacteria 15309
542 Ga0495602_0175681 3300048088 Bacteria 1657
543 Ga0495602_0206696 3300048088 Bacteria 1494
544 Ga0495614_0127661 3300048089 Bacteria 1124
545 Ga0496100_0013680 3300048903 Bacteria 4689
546 Ga0496100_0039717 3300048903 Bacteria 2989
547 Ga0496100_0123787 3300048903 Bacteria 1813
548 Ga0496101_0066797 3300048904 Bacteria 2624
549 Ga0496101_0105250 3300048904 Bacteria 2117
550 Ga0496102_0023853 3300048905 Bacteria 5437
551 Ga0496102_0079888 3300048905 Bacteria 3012
552 Ga0496102_0798875 3300048905 Bacteria 866
553 Ga0496102_0894649 3300048905 Bacteria 809
554 Ga0496103_0008366 3300048906 Bacteria 6146
555 Ga0496103_0276458 3300048906 Bacteria 1080
556 Ga0496104_0326489 3300048907 Bacteria 1447
557 Ga0496105_0607103 3300048908 Bacteria 848
558 Ga0496106_0069530 3300048909 Bacteria 2687
559 Ga0496106_0280388 3300048909 Bacteria 1335
560 Ga0496107_0140303 3300048910 Bacteria 1786
561 Ga0496107_0271835 3300048910 Bacteria 1261
562 Ga0496107_1060137 3300048910 Bacteria 587
563 Ga0496108_0011803 3300048911 Bacteria 7106
564 Ga0496109_0013079 3300048912 Bacteria 7179
565 Ga0496110_0015418 3300048913 Bacteria 6359
566 Ga0496110_0072945 3300048913 Bacteria 3046
567 Ga0496110_0089930 3300048913 Bacteria 2745
568 Ga0496110_0228921 3300048913 Bacteria 1690
569 Ga0496111_0001401 3300048914 Bacteria 13702
570 Ga0496111_0109072 3300048914 Bacteria 2038
571 Ga0496111_0321290 3300048914 Bacteria 1146
572 Ga0496112_0065219 3300048915 Bacteria 3594
573 Ga0496112_0388933 3300048915 Bacteria 1335
574 Ga0496113_0021069 3300048916 Bacteria 4595
575 Ga0496113_0044343 3300048916 Bacteria 3294
576 Ga0496113_0103580 3300048916 Bacteria 2207
577 Ga0496113_0144218 3300048916 Bacteria 1875
578 Ga0496114_0059961 3300048917 Bacteria 3179
579 Ga0496115_0433948 3300048918 Bacteria 1063
580 Ga0496116_0300880 3300048919 Bacteria 763
581 Ga0496117_0001113 3300048920 Bacteria 40547
582 Ga0496117_0088443 3300048920 Bacteria 2004
583 Ga0496118_0004156 3300048921 Bacteria 17488
584 Ga0496118_0151453 3300048921 Bacteria 1451
585 Ga0496118_0395227 3300048921 Bacteria 720
586 Ga0496119_0025482 3300048922 Bacteria 4129
587 Ga0496119_0033681 3300048922 Bacteria 3390
588 Ga0496119_0281826 3300048922 Bacteria 826
589 Ga0496120_0230640 3300048923 Bacteria 879
590 Ga0496121_0004808 3300048924 Bacteria 17800
591 Ga0496122_0006017 3300048925 Bacteria 14155
592 Ga0496122_0011310 3300048925 Bacteria 9061
593 Ga0496122_0013044 3300048925 Bacteria 8185
594 Ga0496122_0045528 3300048925 Bacteria 3409
595 Ga0496123_0007031 3300048926 Bacteria 10717
596 Ga0496123_0014268 3300048926 Bacteria 6599
597 Ga0496123_0016188 3300048926 Bacteria 6070
598 Ga0496123_0025593 3300048926 Bacteria 4444
599 Ga0496124_0069937 3300048927 Bacteria 2912
600 Ga0496124_0426927 3300048927 Bacteria 911
601 Ga0496125_0003960 3300048928 Bacteria 17457
602 Ga0496125_0460302 3300048928 Bacteria 726
603 Ga0496125_0745333 3300048928 Bacteria 514
604 Ga0496126_0012859 3300048929 Bacteria 8553
605 Ga0496126_0330256 3300048929 Bacteria 1251
606 Ga0501032_0050561 3300049569 Bacteria 2803
607 Ga0501033_0080475 3300049570 Bacteria 2390
608 Ga0501033_0300184 3300049570 Bacteria 1131
609 Ga0501034_0248660 3300049571 Bacteria 1723
610 Ga0501034_0314682 3300049571 Bacteria 1499
611 Ga0501037_0063786 3300049573 Bacteria 2686
612 Ga0501038_0701017 3300049574 Bacteria 758
613 Ga0501040_0105680 3300049576 Bacteria 1967
614 Ga0501043_0482269 3300049579 Bacteria 928
615 Ga0501046_0114132 3300049580 Bacteria 2061
616 Ga0501046_0133837 3300049580 Bacteria 1879
617 Ga0501047_0086920 3300049581 Bacteria 3004
618 Ga0501047_0156995 3300049581 Bacteria 2148
619 Ga0501047_0347810 3300049581 Bacteria 1319
620 Ga0501048_0071156 3300049582 Bacteria 2456
621 Ga0501067_0009689 3300049583 Bacteria 5331
622 Ga0501068_0410889 3300049584 Bacteria 873
623 Ga0501073_1004086 3300049589 Bacteria 574
624 Ga0501076_0652770 3300049592 Bacteria 868
625 Ga0501077_0211661 3300049593 Bacteria 1232
626 Ga0501079_0103807 3300049741 Bacteria 2205
627 Ga0501081_0117504 3300049743 Bacteria 1892
628 Ga0501083_0494172 3300049744 Bacteria 796
629 Ga0501035_0015595 3300049822 Bacteria 7011
630 Ga0501044_1021739 3300049823 Bacteria 698
631 Ga0501045_0093426 3300049824 Bacteria 2225
632 nmdc:mga0k408_85005_c1 3300050493 Bacteria 1857
633 nmdc:mga07m45_224580_c1 3300050496 Bacteria 1093
634 nmdc:mga09592_117513_c1 3300050508 Bacteria 2282
635 nmdc:mga08y16_393667_c1 3300050511 Bacteria 1419
636 nmdc:mga0rr50_412518_c1 3300050513 Bacteria 1142
637 nmdc:mga08x19_37443_c1 3300050514 Bacteria 3078
638 Ga0495601_0028981 3300053077 Bacteria 3431
639 Ga0495619_0184838 3300053085 Bacteria 1442
640 Ga0500643_056625 3300053087 Bacteria 1108
641 Ga0500641_0001183 3300053096 Bacteria 9288
642 Ga0500618_002574 3300053125 Bacteria 6718
643 Ga0500642_0015228 3300053130 Bacteria 2885
644 Ga0500568_0047713 3300053139 Bacteria 1696
645 Ga0501082_0068275 3300060353 Bacteria 3061
646 Ga0501082_0174642 3300060353 Bacteria 1868
647 Ga0466962_0131321 3300061719 Bacteria 1210
648 2511134254 2510917022 Bacteria 6504556
649 2524458527 2524023209 Bacteria 6679728
650 2535520465 2534681796 Bacteria 7146037
651 2585167755 2582581283 Bacteria 6030556
652 2585269042 2582581306 Bacteria 6450535
653 2585271743 2582581307 Bacteria 6597605
654 2585279877 2582581308 Bacteria 7413247
655 2585326576 2582581315 Bacteria 7318924
656 2585334078 2582581316 Bacteria 7774528
657 2585531719 2585427527 Bacteria 7273426
658 2585551334 2585427530 Bacteria 7383882
659 2585563017 2585427531 Bacteria 6992870
660 2585902906 2585427608 Bacteria 6544331
661 2585907232 2585427609 Bacteria 6667127
662 2587982774 2585428125 Bacteria 6662905
663 2616306670 2615840626 Bacteria 7921970
664 2616557528 2615840698 Bacteria 7319877
665 2617386018 2617270742 Bacteria 6808054
666 2643818559 2643221559 Bacteria 4424915
667 2643938309 2643221586 Bacteria 4446529
668 2644050800 2643221607 Bacteria 6314006
669 2644078944 2643221612 Bacteria 4361984
670 2644205303 2643221636 Bacteria 6583769
671 2644483704 2643221686 Bacteria 6310811
672 2644693721 2643221727 Bacteria 4415595
673 2671113423 2667528174 Bacteria 6435400
674 2753270440 2751185782 Bacteria 11227053
675 2778178679 2775507266 Bacteria 7392367
676 2819611291 2818991448 Bacteria 6772224
677 2819638764 2818991453 Bacteria 7181617
678 2838030988 2838029111 Bacteria 6603031
679 2842300214 2842298080 Bacteria 6123127
680 2842359125 2842357229 Bacteria 6485165
681 2842477720 2842475841 Bacteria 6603183
682 2842485023 2842482326 Bacteria 7212537
683 2842504408 2842502639 Bacteria 6604161
684 2842511652 2842509118 Bacteria 6850950
685 2852391758 2852387548 Bacteria 8025568
686 2857558898 2857558681 Bacteria 6617694
687 2919411120 2919408235 Bacteria 6149349
688 2928129212 2928125067 Bacteria 5937560
689 3005421568 3005416602 Bacteria 7064308
690 8005319729 8005314921 Bacteria 7072929
691 8005490352 8005484373 Bacteria 6297373
692 8005647002 8005645114 Bacteria 6950293
693 8005688154 8005682033 Bacteria 6726518
694 Ga0081538_10002031
695 JGI24740J21852_10000004
696 JGI25156J39149_1000014
697 JGI25162J39368_1000482
698 JGI25162J39368_1002120
699 JGI25154J39366_1000096
700 JGI25157J39369_1000005
701 JGI25159J45721_1000854
702 JGI25165J46597_1000190
703 JGI25165J46597_1000328
704 JGI25165J46597_1003751
705 rootH1_10031765
706 rootL2_10002812
707 JGI25160J50197_1000108
708 JGI25161J50226_1000112
709 Ga0055526_1001333
710 Ga0055524_1033922
711 Ga0055536_1022503
712 Ga0055540_1007954
713 Ga0055531_10000267
714 Ga0058692_1004915
715 Ga0055543_1000080
716 Ga0065165_1000520
717 Ga0070658_10086082
718 Ga0070658_10385511
719 Ga0070658_10493591
720 Ga0070658_10745425
721 Ga0070683_100041942
722 Ga0070683_100467121
723 Ga0070690_100630075
724 Ga0070670_100254844
725 Ga0068869_100051341
726 Ga0070666_10099304
727 Ga0070666_10589254
728 Ga0070680_100047938
729 Ga0070680_100115766
730 Ga0070680_100201385
731 Ga0070682_100009618
732 Ga0070682_100095471
733 Ga0070682_100728445
734 Ga0068868_100013631
735 Ga0068868_100076723
736 Ga0068868_101655831
737 Ga0070660_100035037
738 Ga0070660_100203320
739 Ga0070660_100308817
740 Ga0070660_100368372
741 Ga0070689_100000011
742 Ga0070691_10032551
743 Ga0070661_100198105
744 Ga0070661_100470760
745 Ga0070692_10041940
746 Ga0070675_100173981
747 Ga0070675_100475295
748 Ga0070671_100176013
749 Ga0070674_100260725
750 Ga0070673_100147575
751 Ga0070673_100487097
752 Ga0070659_100010471
753 Ga0070659_100402439
754 Ga0070667_100205573
755 Ga0070667_100295811
756 Ga0070703_10185235
757 Ga0070709_10029024
758 Ga0070714_100038783
759 Ga0070714_100117709
760 Ga0070714_100274116
761 Ga0070714_100417886
762 Ga0070714_101805288
763 Ga0070713_100220761
764 Ga0070713_100702139
765 Ga0070710_10033556
766 Ga0070710_10229356
767 Ga0070710_11445820
768 Ga0070711_100004682
769 Ga0070711_100020164
770 Ga0070711_100521994
771 Ga0070705_100436455
772 Ga0070700_100009767
773 Ga0070708_100106158
774 Ga0070708_100233771
775 Ga0070663_100068056
776 Ga0070663_100324004
777 Ga0070678_100152979
778 Ga0070678_100786835
779 Ga0070662_100004473
780 Ga0070662_100505209
781 Ga0070662_100674675
782 Ga0070681_10007311
783 Ga0070681_10093296
784 Ga0070681_10315863
785 Ga0070681_10423768
786 Ga0070681_10472778
787 Ga0068867_100026766
788 Ga0070706_100123540
789 Ga0070707_100088574
790 Ga0070707_100939741
791 Ga0070698_100349576
792 Ga0070699_100034260
793 Ga0070699_100070075
794 Ga0070699_100838453
795 Ga0070679_100002524
796 Ga0070679_100065436
797 Ga0070679_100194515
798 Ga0070679_100204241
799 Ga0070684_100002960
800 Ga0070684_100005420
801 Ga0070684_100191006
802 Ga0070684_100239612
803 Ga0070697_100466425
804 Ga0068853_100809061
805 Ga0068853_101127529
806 Ga0068853_101217927
807 Ga0070686_100030262
808 Ga0070686_100527839
809 Ga0070695_100001972
810 Ga0070696_100030203
811 Ga0070693_100036544
812 Ga0070665_100000186
813 Ga0070665_100274209
814 Ga0070665_100529507
815 Ga0068855_100041744
816 Ga0068855_100445875
817 Ga0068855_101156135
818 Ga0070664_100010347
819 Ga0068857_100123129
820 Ga0068857_101244320
821 Ga0068854_100070076
822 Ga0068854_100127340
823 Ga0068854_100699668
824 Ga0068856_100003522
825 Ga0068856_100037635
826 Ga0068856_100092720
827 Ga0068856_100116408
828 Ga0068856_100177050
829 Ga0068856_100208925
830 Ga0068856_100277015
831 Ga0068856_101414485
832 Ga0070702_100054952
833 Ga0068852_100112543
834 Ga0068852_101462955
835 Ga0068852_101597465
836 Ga0068859_100188731
837 Ga0068859_102480016
838 Ga0068864_100025130
839 Ga0068864_100859777
840 Ga0068866_10016241
841 Ga0068861_101666061
842 Ga0068851_10050700
843 Ga0068851_10068170
844 Ga0068863_100224986
845 Ga0068863_101377241
846 Ga0068858_100032669
847 Ga0068860_100080173
848 Ga0068862_100017651
849 Ga0068862_100776020
850 Ga0081538_10039777
851 Ga0070717_10470220
852 Ga0070717_10484418
853 Ga0070717_10531707
854 Ga0070717_11779765
855 Ga0075363_100767426
856 Ga0070715_10039805
857 Ga0070716_100017106
858 Ga0070712_100054434
859 Ga0070712_100168376
860 Ga0070712_100182200
861 Ga0075367_10544489
862 Ga0075366_10009449
863 Ga0075366_10317092
864 Ga0097621_100014178
865 Ga0097621_100154305
866 Ga0075370_10031452
867 Ga0075370_10067848
868 Ga0068871_100964030
869 Ga0075434_100794036
870 Ga0068865_100080121
871 Ga0068865_100106975
872 Ga0068865_100144120
873 Ga0068865_100208869
874 Ga0097620_100188722
875 Ga0079104_1009299
876 Ga0075435_100933220
877 Ga0105250_10138795
878 Ga0105240_10000013
879 Ga0105240_10014421
880 Ga0105240_10807400
881 Ga0105240_11221854
882 Ga0111539_10015046
883 Ga0111539_10255411
884 Ga0111539_11706741
885 Ga0105245_10001224
886 Ga0105245_10016264
887 Ga0105245_10087901
888 Ga0105247_10106650
889 Ga0105247_10156239
890 Ga0105243_10104890
891 Ga0105243_10556996
892 Ga0105243_11217058
893 Ga0105241_10061714
894 Ga0105241_10662740
895 Ga0105241_10701863
896 Ga0105242_10010437
897 Ga0105248_10092781
898 Ga0105248_10456738
899 Ga0105248_12770110
900 Ga0105237_10078229
901 Ga0105237_10465050
902 Ga0105237_10729085
903 Ga0105249_10184445
904 Ga0105249_10200426
905 Ga0105249_10428033
906 Ga0105249_11631903
907 Ga0105239_10009215
908 Ga0105239_10031939
909 Ga0105239_10044154
910 Ga0105239_10048377
911 Ga0105239_10055507
912 Ga0105239_10061892
913 Ga0105239_10077711
914 Ga0105239_10559742
915 Ga0105246_10012939
916 Ga0105246_10085153
917 Ga0105246_10748839
918 Ga0157373_10235011
919 Ga0157371_10054302
920 Ga0157371_10142614
921 Ga0157370_10000548
922 Ga0157370_10145970
923 Ga0157370_10202741
924 Ga0157369_10001204
925 Ga0157369_10713039
926 Ga0157374_10105687
927 Ga0157374_10129617
928 Ga0157374_11256810
929 Ga0157378_10083988
930 Ga0157378_12783285
931 Ga0157372_10015956
932 Ga0157372_10019760
933 Ga0157372_10044577
934 Ga0157375_10094529
935 Ga0157375_10212989
936 Ga0163163_10016580
937 Ga0163163_10236919
938 Ga0163163_10515752
939 Ga0157380_10009578
940 Ga0182008_10518573
941 Ga0157377_10004856
942 Ga0157376_10256790
943 Ga0182007_10001962
944 Ga0163161_10357567
945 Ga0163161_10386951
946 Ga0206356_10956483
947 Ga0206353_11753941
948 Ga0154015_1553135
949 Ga0213872_10106191
950 Ga0213875_10118891
951 Ga0224712_10023016
952 Ga0224712_10099423
953 Ga0209435_100009
954 Ga0209436_109771
955 Ga0209672_113991
956 Ga0209437_100057
957 Ga0209437_100206
958 Ga0209646_1000018
959 Ga0209646_1006705
960 Ga0209646_1024903
961 Ga0209026_1000043
962 Ga0209677_100446
963 Ga0209148_1011094
964 Ga0209759_1000007
965 Ga0209759_1017541
966 Ga0209233_1000130
967 Ga0209233_1000178
968 Ga0209233_1000256
969 Ga0209455_1011113
970 Ga0209673_1011373
971 Ga0209673_1017967
972 Ga0209130_1000108
973 Ga0209676_1000026
974 Ga0209564_1001682
975 Ga0209256_1004417
976 Ga0207426_1000082
977 Ga0209051_1005354
978 Ga0209257_1000101
979 Ga0207692_10049588
980 Ga0207692_10874292
981 Ga0207642_10590415
982 Ga0207710_10025558
983 Ga0207710_10391886
984 Ga0207688_10002214
985 Ga0207688_10031918
986 Ga0207680_10177483
987 Ga0207680_10670578
988 Ga0207647_10262143
989 Ga0207685_10011655
990 Ga0207685_10453978
991 Ga0207699_10002942
992 Ga0207705_10071191
993 Ga0207705_10093568
994 Ga0207705_10134728
995 Ga0207684_10410664
996 Ga0207707_10053417
997 Ga0207707_10081938
998 Ga0207707_10261072
999 Ga0207707_10263627
1000 Ga0207707_10426782
1001 Ga0207695_10000044
1002 Ga0207695_10038220
1003 Ga0207695_10848774
1004 Ga0207671_10000497
1005 Ga0207671_10705220
1006 Ga0207693_10010064
1007 Ga0207693_10057148
1008 Ga0207693_10124804
1009 Ga0207693_10202919
1010 Ga0207693_10543738
1011 Ga0207663_10046066
1012 Ga0207663_10431583
1013 Ga0207663_10984282
1014 Ga0207660_10240065
1015 Ga0207657_10067226
1016 Ga0207657_10162065
1017 Ga0207657_10187051
1018 Ga0207657_10194130
1019 Ga0207657_10491680
1020 Ga0207649_10012185
1021 Ga0207652_10023694
1022 Ga0207652_10085956
1023 Ga0207652_10092105
1024 Ga0207652_10119634
1025 Ga0207646_10031227
1026 Ga0207681_10449373
1027 Ga0207694_10367010
1028 Ga0207650_10914483
1029 Ga0207659_10248145
1030 Ga0207659_11188531
1031 Ga0207687_10027848
1032 Ga0207700_10214725
1033 Ga0207700_10717081
1034 Ga0207700_10890326
1035 Ga0207664_10216366
1036 Ga0207664_11172501
1037 Ga0207644_10076085
1038 Ga0207690_10296642
1039 Ga0207706_10006716
1040 Ga0207706_10061733
1041 Ga0207706_10513547
1042 Ga0207686_11022808
1043 Ga0207709_10108618
1044 Ga0207709_10602823
1045 Ga0207709_10882642
1046 Ga0207670_10000005
1047 Ga0207669_10272934
1048 Ga0207669_10983974
1049 Ga0207665_10018756
1050 Ga0207689_10033848
1051 Ga0207689_10421645
1052 Ga0207661_10001855
1053 Ga0207679_10699919
1054 Ga0207679_10791627
1055 Ga0207667_10225114
1056 Ga0207667_10391591
1057 Ga0207667_11395047
1058 Ga0207712_10141058
1059 Ga0207712_10186069
1060 Ga0207712_11430135
1061 Ga0207668_10087503
1062 Ga0207668_11089933
1063 Ga0207640_10113194
1064 Ga0207640_10148927
1065 Ga0207640_10160636
1066 Ga0207640_10338302
1067 Ga0207658_10443852
1068 Ga0207677_10033829
1069 Ga0207677_10532029
1070 Ga0207703_11493239
1071 Ga0207639_10583002
1072 Ga0207639_10618958
1073 Ga0207678_10005739
1074 Ga0207678_10085737
1075 Ga0207678_11434413
1076 Ga0207708_10075771
1077 Ga0207702_10044539
1078 Ga0207702_10140725
1079 Ga0207702_10204599
1080 Ga0207702_10318650
1081 Ga0207702_10330298
1082 Ga0207702_10691472
1083 Ga0207702_11188704
1084 Ga0207702_11574425
1085 Ga0207641_10182939
1086 Ga0207648_10164698
1087 Ga0207676_10504384
1088 Ga0207674_10045401
1089 Ga0207674_10380851
1090 Ga0207675_100053049
1091 Ga0207675_100066515
1092 Ga0207683_10038033
1093 Ga0207683_10292395
1094 Ga0207683_10386401
1095 Ga0207683_10565988
1096 Ga0207698_10004537
1097 Ga0207698_10097419
1098 Ga0209371_1009172
1099 Ga0268266_10000002
1100 Ga0268266_10098313
1101 Ga0268266_10578736
1102 Ga0268264_10574568
1103 Ga0268256_1022771
1104 Ga0307511_10332586
1105 Ga0265327_10012708
1106 Ga0307509_10121187
1107 Ga0307516_10000466
1108 Ga0307409_100062646
1109 Ga0307416_100444873
1110 Ga0307414_11559135
1111 Ga0307415_100006169
1112 Ga0373926_0027809
1113 Ga0373934_0141393
1114 Ga0373944_0007659
1115 Ga0373954_0036727
1116 Ga0373954_0119932
1117 Ga0373956_0246989
1118 Ga0373943_0180602
1119 Ga0373946_0005767
1120 Ga0373955_0028940
1121 Ga0373927_0007531
1122 Ga0373933_0073582
1123 Ga0373947_0268674
1124 Ga0373937_0005733
1125 Ga0373937_0030192
1126 Ga0373925_0046884
1127 Ga0373925_0080630
1128 Ga0395899_0534859
1129 Ga0395900_0062404
1130 Ga0395900_0108574
1131 Ga0395900_0701420
1132 Ga0395900_1063695
1133 Ga0395898_0022342
1134 Ga0395898_0064956
1135 Ga0395898_0117445
1136 Ga0395898_0137452
1137 Ga0395898_0635509
1138 Ga0395905_0048174
1139 Ga0436364_0171955
1140 Ga0436364_1066521
1141 Ga0395901_0042923
1142 Ga0395901_0093676
1143 Ga0395901_0197055
1144 Ga0436361_1005664
1145 Ga0436362_0236764
1146 Ga0436362_0812596
1147 Ga0451793_0623273
1148 Ga0451837_0218467
1149 Ga0451843_1432846
1150 Ga0451577_0008357
1151 Ga0466972_0273279
1152 Ga0466966_0307859
1153 Ga0466966_0746771
1154 Ga0466961_0147969
1155 Ga0466961_0550734
1156 Ga0466963_0004810
1157 Ga0466963_0008345
1158 Ga0466963_0056490
1159 Ga0466963_0068120
1160 Ga0466963_0402362
1161 Ga0466963_0429687
1162 Ga0466964_0117045
1163 Ga0466964_0136440
1164 Ga0466964_0188703
1165 Ga0466964_0309934
1166 Ga0453684_0061890
1167 Ga0466971_0133651
1168 Ga0466970_0000492
1169 Ga0466970_0243380
1170 Ga0466957_0002260
1171 Ga0466960_0228615
1172 Ga0466960_0751473
1173 Ga0466959_0007213
1174 Ga0466959_0123564
1175 Ga0466959_0488960
1176 Ga0451576_0166707
1177 Ga0451576_0786934
1178 Ga0466958_0005181
1179 Ga0466958_0027596
1180 Ga0466967_0001146
1181 Ga0466967_0003704
1182 Ga0466967_0005558
1183 Ga0466967_0046076
1184 Ga0466967_0063795
1185 Ga0466967_0087945
1186 Ga0466967_0116837
1187 Ga0466967_0127008
1188 Ga0466967_0209469
1189 Ga0466967_0764810
1190 Ga0466967_0849296
1191 Ga0466967_1050520
1192 Ga0466967_1263438
1193 Ga0466967_2023755
1194 Ga0466967_2149273
1195 Ga0495603_0108067
1196 Ga0495638_0001474
1197 Ga0495650_0223333
1198 Ga0495580_0000706
1199 Ga0495580_0058866
1200 Ga0495580_0087829
1201 Ga0495580_0251750
1202 Ga0495639_0179149
1203 Ga0495594_0252620
1204 Ga0495607_0008237
1205 Ga0495618_0004080
1206 Ga0495628_0242428
1207 Ga0495630_0075548
1208 Ga0495630_0080706
1209 Ga0495648_0013758
1210 Ga0495652_0272924
1211 Ga0495665_0349180
1212 Ga0495586_0378298
1213 Ga0495587_0047476
1214 Ga0495645_0305684
1215 Ga0495622_0240512
1216 Ga0495634_0051102
1217 Ga0495625_0008078
1218 Ga0495635_0125372
1219 Ga0495661_0041185
1220 Ga0495588_0059480
1221 Ga0495588_0216040
1222 Ga0495657_0058286
1223 Ga0495599_0117288
1224 Ga0495647_0021287
1225 Ga0495613_1013711
1226 Ga0495624_0137675
1227 Ga0495589_0222215
1228 Ga0495674_0227637
1229 Ga0495674_0989465
1230 Ga0495674_1070087
1231 Ga0495676_0152643
1232 Ga0495683_0000811
1233 Ga0495687_080052
1234 Ga0495686_0002926
1235 Ga0495602_0175681
1236 Ga0495602_0206696
1237 Ga0495614_0127661
1238 Ga0496100_0013680
1239 Ga0496100_0039717
1240 Ga0496100_0123787
1241 Ga0496101_0066797
1242 Ga0496101_0105250
1243 Ga0496102_0023853
1244 Ga0496102_0079888
1245 Ga0496102_0798875
1246 Ga0496102_0894649
1247 Ga0496103_0008366
1248 Ga0496103_0276458
1249 Ga0496104_0326489
1250 Ga0496105_0607103
1251 Ga0496106_0069530
1252 Ga0496106_0280388
1253 Ga0496107_0140303
1254 Ga0496107_0271835
1255 Ga0496107_1060137
1256 Ga0496108_0011803
1257 Ga0496109_0013079
1258 Ga0496110_0015418
1259 Ga0496110_0072945
1260 Ga0496110_0089930
1261 Ga0496110_0228921
1262 Ga0496111_0001401
1263 Ga0496111_0109072
1264 Ga0496111_0321290
1265 Ga0496112_0065219
1266 Ga0496112_0388933
1267 Ga0496113_0021069
1268 Ga0496113_0044343
1269 Ga0496113_0103580
1270 Ga0496113_0144218
1271 Ga0496114_0059961
1272 Ga0496115_0433948
1273 Ga0496116_0300880
1274 Ga0496117_0001113
1275 Ga0496117_0088443
1276 Ga0496118_0004156
1277 Ga0496118_0151453
1278 Ga0496118_0395227
1279 Ga0496119_0025482
1280 Ga0496119_0033681
1281 Ga0496119_0281826
1282 Ga0496120_0230640
1283 Ga0496121_0004808
1284 Ga0496122_0006017
1285 Ga0496122_0011310
1286 Ga0496122_0013044
1287 Ga0496122_0045528
1288 Ga0496123_0007031
1289 Ga0496123_0014268
1290 Ga0496123_0016188
1291 Ga0496123_0025593
1292 Ga0496124_0069937
1293 Ga0496124_0426927
1294 Ga0496125_0003960
1295 Ga0496125_0460302
1296 Ga0496125_0745333
1297 Ga0496126_0012859
1298 Ga0496126_0330256
1299 Ga0501032_0050561
1300 Ga0501033_0080475
1301 Ga0501033_0300184
1302 Ga0501034_0248660
1303 Ga0501034_0314682
1304 Ga0501037_0063786
1305 Ga0501038_0701017
1306 Ga0501040_0105680
1307 Ga0501043_0482269
1308 Ga0501046_0114132
1309 Ga0501046_0133837
1310 Ga0501047_0086920
1311 Ga0501047_0156995
1312 Ga0501047_0347810
1313 Ga0501048_0071156
1314 Ga0501067_0009689
1315 Ga0501068_0410889
1316 Ga0501073_1004086
1317 Ga0501076_0652770
1318 Ga0501077_0211661
1319 Ga0501079_0103807
1320 Ga0501081_0117504
1321 Ga0501083_0494172
1322 Ga0501035_0015595
1323 Ga0501044_1021739
1324 Ga0501045_0093426
1325 nmdc:mga0k408_85005_c1
1326 nmdc:mga07m45_224580_c1
1327 nmdc:mga09592_117513_c1
1328 nmdc:mga08y16_393667_c1
1329 nmdc:mga0rr50_412518_c1
1330 nmdc:mga08x19_37443_c1
1331 Ga0495601_0028981
1332 Ga0495619_0184838
1333 Ga0500643_056625
1334 Ga0500641_0001183
1335 Ga0500618_002574
1336 Ga0500642_0015228
1337 Ga0500568_0047713
1338 Ga0501082_0068275
1339 Ga0501082_0174642
1340 Ga0466962_0131321
1341 2511134254
1342 2524458527
1343 2535520465
1344 2585167755
1345 2585269042
1346 2585271743
1347 2585279877
1348 2585326576
1349 2585334078
1350 2585531719
1351 2585551334
1352 2585563017
1353 2585902906
1354 2585907232
1355 2587982774
1356 2616306670
1357 2616557528
1358 2617386018
1359 2643818559
1360 2643938309
1361 2644050800
1362 2644078944
1363 2644205303
1364 2644483704
1365 2644693721
1366 2671113423
1367 2753270440
1368 2778178679
1369 2819611291
1370 2819638764
1371 2838030988
1372 2842300214
1373 2842359125
1374 2842477720
1375 2842485023
1376 2842504408
1377 2842511652
1378 2852391758
1379 2857558898
1380 2919411120
1381 2928129212
1382 3005421568
1383 8005319729
1384 8005490352
1385 8005647002
1386 8005688154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

31

161

0.98

PF12680

SnoaL_2

SnoaL-like domain

42

144

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 1.001 6 150
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9426 6 150
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8858 16 124
4hvn-assembly1.cif.gz_B crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. 0.8768 17 122
2inx-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol 0.8754 9 121
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 1.001 10 150 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9869 10 150 3.10.450.50
af_A0A1D8PLG7_12_136_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8995 33 124 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8952 36 124 3.10.450.50
3ebtA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.88 17 124 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7Y3NJA5-F1-model_v4 DUF1348 family protein 1.007 6 97
AF-A0A519I772-F1-model_v4 DUF1348 family protein 1.007 82 154
AF-A0A2V5YC23-F1-model_v4 DUF1348 domain-containing protein 1.006 6 124
AF-A0A1H7CD02-F1-model_v4 DUF1348 domain-containing protein 1.006 58 154
AF-J8V0J8-F1-model_v4 deleted 1.006 66 154

Map