F475644

General Info

Members Datasets Scaffolds Average Seq Length
693 336 1386 346

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10000014|Ga0105244_1000001420
Length 424
Sequence MMRRNQQQKAHAQYNPAHQLDDTIKYHTHNNQCPKESRGKMLPGTWRLRQLKRGVLIKGCEPLTDVVKWRVTTDEGNNMSDTIRVGLIGYGYASKTFHAPLISGTPGMELAAVSSSDEAKVKVDWPGVKVVSEPKHLFNDPSIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELDALARSLGRLLSVFHNRRWDSDFLTVKALIAEGTLGEVTFFESHFDRYRPEVRNRWREQGGPGSGIWYDLAPHLLDQAVNLFGLPVSLTVDLAQLRPGAQSTDYFHAVLNYPQRRVILHGTLLAAAESARYIVHGTRASYVKYGLDPQEERLKNGERLPQEDWGYDMRDGVVTRVNGDDRTEETWLTVPGNYPAYYAGIRDALNGSGENPVPASQAIQIMELIELGIESAKHRATLSLT

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
52 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
53 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
54 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
91 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
97 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
106 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
166 2506520008 Serratia plymuthica AS12 Isolate Unclassified
167 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
168 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
169 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
170 2547132181 Kosakonia sacchari SP1 Isolate Stem
171 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
172 2561511199 Enterobacter sp. R4-368 Isolate Nodule
173 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
174 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
175 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
176 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
177 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
178 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
179 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
180 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
181 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
182 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
183 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
184 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
185 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
186 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
187 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
188 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
189 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
190 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
191 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
192 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
193 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
194 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
195 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
196 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
197 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
198 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
199 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
200 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
201 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
202 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
203 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
204 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
205 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
206 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
207 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
208 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
209 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
210 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
211 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
212 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
213 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
214 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
215 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
216 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
217 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
218 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
219 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
220 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
221 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
222 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
223 2636415599 Klebsiella variicola DX120E Isolate Unclassified
224 2643221731 Bacillus sp. Root147 Isolate Unclassified
225 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
226 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
227 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
228 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
229 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
230 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
231 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
232 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
233 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
234 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
235 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
236 2738543017 Bacillus sp. OV186 Isolate Unclassified
237 2751185917 Enterobacter sp. HK169 Isolate Unclassified
238 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
239 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
240 2775507074 Klebsiella sp. D5A Isolate Unclassified
241 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
242 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
243 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
244 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
245 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
246 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
247 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
248 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
249 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
250 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
251 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
252 2821118458 Enterobacter asburiae 609 Isolate Unclassified
253 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
254 2842882022 Bacillus sp. R-71893 Isolate Unclassified
255 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
256 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
257 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
258 2847085930 Erwinia persicina B64 Isolate Bulb
259 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
260 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
261 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
262 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
263 2857586860 Bacillus sp. R-71935 Isolate Unclassified
264 2865014394 Pantoea sp. R-71966 Isolate Unclassified
265 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
266 2876601092 Pantoea endophytica 596 Isolate Unclassified
267 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
268 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
269 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
270 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
271 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
272 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
273 2904504865 Serratia marcescens 1822 Isolate Unclassified
274 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
275 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
276 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
277 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
278 2919150387 Rahnella aceris 1817 Isolate Unclassified
279 2919404418 Luteibacter sp. 3190 Isolate Unclassified
280 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
281 2919720352 Priestia megaterium 4340 Isolate Unclassified
282 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
283 2927143783 Rahnella sp. 2050 Isolate Unclassified
284 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
285 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
286 2932406140 Serratia sp. 2723 Isolate Rhizosphere
287 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
288 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
289 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
290 2937539931 Pantoea sp. LS15 Isolate Unclassified
291 2937967321 Serratia sp. YC16 Isolate Unclassified
292 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
293 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
294 2939577877 Serratia sp. 509 Isolate Rhizosphere
295 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
296 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
297 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
298 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
299 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
300 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
301 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
302 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
303 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
304 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
305 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
306 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
307 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
308 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
309 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
310 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
311 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
312 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
313 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
314 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
315 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
316 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
317 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
318 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
319 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
320 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
321 640753048 Serratia proteamaculans 568 Isolate Endosphere
322 8004592986 Serratia sp. S119 Isolate Unclassified
323 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
324 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
325 8018221730 Enterobacter sp. CM29 Isolate Unclassified
326 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
327 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
328 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
329 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
330 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
331 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
332 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
333 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
334 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
335 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
336 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.04
Metatranscriptomes 0.14
Isolates 24.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0.14
Endosphere 10.97
Nodule 2.6
Rhizoplane 11.26
Rhizosphere 43
Stem 0.14
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10000014 3300009036 Bacteria 257018
2 SwRhRL2b_contig_2491164 2162886007 Bacteria 7077
3 SwRhRL2b_contig_517513 2162886007 Bacteria 2177
4 JGI25162J39368_1000009 3300002737 Bacteria 389795
5 JGI25163J39215_1000068 3300002771 Bacteria 47173
6 JGI25164J39214_1000002 3300002772 Bacteria 406570
7 JGI25152J39213_1000258 3300002773 Bacteria 35248
8 JGI25151J46595_10002101 3300003187 Bacteria 12423
9 JGI25151J46595_10003521 3300003187 Bacteria 8619
10 JGI25151J46595_10025714 3300003187 Bacteria 2389
11 JGI25153J46596_10002505 3300003215 Bacteria 10541
12 rootH2_10040041 3300003320 Bacteria 15643
13 rootH2_10144681 3300003320 Bacteria 1596
14 rootH1_10021808 3300003323 Bacteria 9164
15 Ga0006562J51391_1111623 3300003578 Bacteria 1650
16 Ga0055538_1000015 3300003751 Bacteria 311166
17 Ga0055539_1000009 3300003752 Bacteria 406566
18 Ga0055533_1000012 3300003756 Bacteria 406566
19 Ga0055532_1000196 3300003758 Bacteria 50546
20 Ga0055525_1000014 3300003759 Bacteria 406566
21 Ga0055526_1000298 3300003771 Bacteria 41396
22 Ga0055526_1006163 3300003771 Bacteria 6602
23 Ga0055537_1001342 3300003773 Bacteria 9995
24 Ga0055537_1001615 3300003773 Bacteria 8475
25 Ga0055536_1002027 3300003781 Bacteria 11611
26 Ga0055536_1002102 3300003781 Bacteria 11340
27 Ga0055536_1002172 3300003781 Bacteria 11180
28 Ga0055534_1000145 3300003784 Bacteria 52879
29 Ga0055528_1002402 3300003790 Bacteria 10077
30 Ga0055530_10001996 3300003791 Bacteria 13846
31 Ga0055530_10002647 3300003791 Bacteria 11202
32 Ga0055531_10002729 3300003794 Bacteria 11611
33 Ga0055531_10002839 3300003794 Bacteria 11340
34 Ga0055541_1000006 3300003841 Bacteria 406566
35 Ga0058692_1000038 3300003856 Bacteria 140136
36 Ga0058692_1000101 3300003856 Bacteria 56780
37 Ga0058692_1000814 3300003856 Bacteria 12392
38 Ga0058692_1001389 3300003856 Bacteria 8957
39 Ga0058692_1003329 3300003856 Bacteria 4997
40 Ga0058692_1007994 3300003856 Bacteria 2752
41 Ga0058692_1007997 3300003856 Bacteria 2752
42 Ga0065703_1019619 3300005272 Bacteria 2646
43 Ga0065704_10000115 3300005289 Bacteria 75390
44 Ga0065704_10000297 3300005289 Bacteria 43486
45 Ga0065704_10000854 3300005289 Bacteria 11560
46 Ga0065704_10130302 3300005289 Bacteria 1638
47 Ga0070677_10025649 3300005333 Bacteria 2202
48 Ga0070659_100045840 3300005366 Bacteria 3426
49 Ga0070665_100003098 3300005548 Bacteria 17905
50 Ga0070665_100178209 3300005548 Bacteria 2126
51 Ga0068857_100000773 3300005577 Bacteria 23816
52 Ga0075364_10005738 3300006051 Bacteria 7238
53 Ga0075364_10023478 3300006051 Bacteria 3904
54 Ga0075369_10004726 3300006186 Bacteria 5053
55 Ga0075366_10093392 3300006195 Bacteria 1803
56 Ga0079104_1000083 3300006946 Bacteria 137254
57 Ga0079104_1000218 3300006946 Bacteria 80243
58 Ga0079104_1000263 3300006946 Bacteria 69767
59 Ga0079104_1000292 3300006946 Bacteria 63382
60 Ga0079104_1000716 3300006946 Bacteria 29970
61 Ga0079104_1000733 3300006946 Bacteria 29076
62 Ga0079104_1002113 3300006946 Bacteria 11343
63 Ga0079104_1002597 3300006946 Bacteria 9472
64 Ga0105251_10000002 3300009011 Bacteria 350843
65 Ga0105251_10000189 3300009011 Bacteria 62590
66 Ga0105251_10000304 3300009011 Bacteria 49243
67 Ga0105251_10002055 3300009011 Bacteria 16280
68 Ga0105251_10006273 3300009011 Bacteria 7615
69 Ga0105251_10010712 3300009011 Bacteria 5290
70 Ga0105251_10011006 3300009011 Bacteria 5197
71 Ga0105251_10012033 3300009011 Bacteria 4910
72 Ga0105251_10012464 3300009011 Bacteria 4810
73 Ga0105251_10101355 3300009011 Bacteria 1316
74 Ga0105244_10000195 3300009036 Bacteria 61365
75 Ga0105244_10000411 3300009036 Bacteria 39919
76 Ga0105244_10000960 3300009036 Bacteria 24197
77 Ga0105244_10002160 3300009036 Bacteria 15082
78 Ga0105244_10002374 3300009036 Bacteria 14273
79 Ga0105244_10002576 3300009036 Bacteria 13611
80 Ga0105244_10002696 3300009036 Bacteria 13279
81 Ga0105244_10006949 3300009036 Bacteria 7250
82 Ga0105244_10008124 3300009036 Bacteria 6589
83 Ga0105244_10016952 3300009036 Bacteria 4133
84 Ga0105244_10030995 3300009036 Bacteria 2840
85 Ga0105244_10055243 3300009036 Bacteria 2012
86 Ga0105250_10000002 3300009092 Bacteria 566949
87 Ga0105250_10000113 3300009092 Bacteria 72385
88 Ga0105250_10000837 3300009092 Bacteria 18280
89 Ga0105250_10001894 3300009092 Bacteria 10870
90 Ga0105250_10003290 3300009092 Bacteria 7691
91 Ga0105250_10011666 3300009092 Bacteria 3643
92 Ga0105250_10015474 3300009092 Bacteria 3123
93 Ga0105247_10000129 3300009101 Bacteria 73190
94 Ga0105243_10060480 3300009148 Bacteria 3026
95 Ga0105241_10000002 3300009174 Bacteria 869480
96 Ga0157373_10000405 3300013100 Bacteria 34603
97 Ga0157373_10022690 3300013100 Bacteria 4553
98 Ga0157373_10024015 3300013100 Bacteria 4418
99 Ga0157373_10077177 3300013100 Bacteria 2350
100 Ga0157373_10091599 3300013100 Bacteria 2141
101 Ga0157373_10103422 3300013100 Bacteria 2003
102 Ga0157371_10000008 3300013102 Bacteria 393028
103 Ga0157371_10000397 3300013102 Bacteria 54547
104 Ga0157371_10002962 3300013102 Bacteria 15794
105 Ga0157371_10003325 3300013102 Bacteria 14690
106 Ga0157371_10005800 3300013102 Bacteria 10334
107 Ga0157371_10009336 3300013102 Bacteria 7732
108 Ga0157371_10010131 3300013102 Bacteria 7364
109 Ga0157371_10011525 3300013102 Bacteria 6799
110 Ga0157371_10048547 3300013102 Bacteria 3017
111 Ga0157371_10053873 3300013102 Bacteria 2857
112 Ga0157370_10000064 3300013104 Bacteria 114340
113 Ga0157370_10000918 3300013104 Bacteria 37372
114 Ga0157370_10002375 3300013104 Bacteria 22690
115 Ga0157370_10003134 3300013104 Bacteria 19581
116 Ga0157370_10043702 3300013104 Bacteria 4311
117 Ga0157369_10005175 3300013105 Bacteria 15256
118 Ga0157369_10020840 3300013105 Bacteria 7328
119 Ga0163162_10072842 3300013306 Bacteria 3491
120 Ga0163162_10076831 3300013306 Bacteria 3402
121 Ga0157372_10079979 3300013307 Bacteria 3697
122 Ga0157372_10224730 3300013307 Bacteria 2176
123 Ga0182008_10000076 3300014497 Bacteria 77484
124 Ga0182008_10001234 3300014497 Bacteria 17552
125 Ga0182008_10001733 3300014497 Bacteria 14318
126 Ga0182008_10010929 3300014497 Bacteria 4842
127 Ga0182008_10092202 3300014497 Bacteria 1494
128 Ga0182006_1000047 3300015261 Bacteria 187006
129 Ga0182006_1004480 3300015261 Bacteria 6875
130 Ga0182006_1017559 3300015261 Bacteria 3037
131 Ga0182007_10000079 3300015262 Bacteria 73543
132 Ga0182005_1000166 3300015265 Bacteria 45594
133 Ga0183366_1001 3300015679 Bacteria 2743932
134 Ga0183370_1001 3300015680 Bacteria 2743932
135 Ga0183369_1001 3300015685 Bacteria 2743932
136 Ga0183368_1001 3300015687 Bacteria 2743932
137 Ga0163161_10000001 3300017792 Bacteria 2041488
138 Ga0163161_10002679 3300017792 Bacteria 12658
139 Ga0163161_10030436 3300017792 Bacteria 3842
140 Ga0163161_10039512 3300017792 Bacteria 3388
141 Ga0213872_10084229 3300021361 Bacteria 1426
142 Ga0213876_10000055 3300021384 Bacteria 136037
143 Ga0209760_100120 3300025207 Bacteria 53842
144 Ga0209784_100001 3300025224 Bacteria 3600592
145 Ga0209566_100001 3300025225 Bacteria 3600765
146 Ga0209674_100002 3300025226 Bacteria 3600592
147 Ga0209147_100088 3300025229 Bacteria 179728
148 Ga0209563_100002 3300025230 Bacteria 2045675
149 Ga0207427_100020 3300025231 Bacteria 507515
150 Ga0209437_100001 3300025233 Bacteria 2045675
151 Ga0209437_100073 3300025233 Bacteria 302948
152 Ga0209677_100002 3300025253 Bacteria 2045675
153 Ga0209129_1000004 3300025258 Bacteria 884499
154 Ga0209129_1000025 3300025258 Bacteria 413639
155 Ga0209129_1003781 3300025258 Bacteria 6359
156 Ga0209233_1002662 3300025261 Bacteria 6469
157 Ga0209565_1000060 3300025263 Bacteria 188543
158 Ga0209673_1000047 3300025273 Bacteria 289276
159 Ga0209673_1041020 3300025273 Bacteria 1319
160 Ga0209675_1000007 3300025291 Bacteria 683430
161 Ga0209676_1000018 3300025292 Bacteria 631385
162 Ga0209676_1000471 3300025292 Bacteria 67223
163 Ga0209676_1002858 3300025292 Bacteria 11392
164 Ga0209025_1000041 3300025294 Bacteria 373694
165 Ga0209025_1000680 3300025294 Bacteria 58342
166 Ga0209025_1008260 3300025294 Bacteria 7522
167 Ga0209564_1000039 3300025295 Bacteria 413604
168 Ga0209564_1000252 3300025295 Bacteria 114416
169 Ga0209758_1000210 3300025297 Bacteria 127919
170 Ga0209050_1000146 3300025298 Bacteria 166930
171 Ga0209050_1000592 3300025298 Bacteria 57827
172 Ga0209256_1003699 3300025299 Bacteria 10388
173 Ga0209256_1004039 3300025299 Bacteria 9549
174 Ga0209051_1001427 3300025303 Bacteria 20456
175 Ga0209257_1000035 3300025304 Bacteria 631463
176 Ga0209257_1001448 3300025304 Bacteria 28059
177 Ga0209257_1006792 3300025304 Bacteria 7201
178 Ga0209257_1041757 3300025304 Bacteria 1359
179 Ga0207696_1000001 3300025711 Bacteria 2579611
180 Ga0207696_1000005 3300025711 Bacteria 642078
181 Ga0207696_1000086 3300025711 Bacteria 194626
182 Ga0207696_1000218 3300025711 Bacteria 83242
183 Ga0207696_1000292 3300025711 Bacteria 58466
184 Ga0207696_1000398 3300025711 Bacteria 40651
185 Ga0207696_1000858 3300025711 Bacteria 19072
186 Ga0207696_1002113 3300025711 Bacteria 9985
187 Ga0207696_1003125 3300025711 Bacteria 7717
188 Ga0207696_1018621 3300025711 Bacteria 2276
189 Ga0207655_1000001 3300025728 Bacteria 1866413
190 Ga0207655_1000009 3300025728 Bacteria 664676
191 Ga0207655_1000037 3300025728 Bacteria 354473
192 Ga0207655_1000063 3300025728 Bacteria 257028
193 Ga0207655_1000069 3300025728 Bacteria 239968
194 Ga0207655_1003246 3300025728 Bacteria 12211
195 Ga0207655_1003752 3300025728 Bacteria 11139
196 Ga0207655_1005519 3300025728 Bacteria 8581
197 Ga0207655_1007953 3300025728 Bacteria 6807
198 Ga0207655_1008130 3300025728 Bacteria 6710
199 Ga0207655_1008944 3300025728 Bacteria 6283
200 Ga0207655_1010790 3300025728 Bacteria 5508
201 Ga0207655_1026155 3300025728 Bacteria 2809
202 Ga0207655_1035201 3300025728 Bacteria 2239
203 Ga0207655_1038384 3300025728 Bacteria 2094
204 Ga0207655_1040779 3300025728 Bacteria 1998
205 Ga0207713_1000001 3300025735 Bacteria 2295391
206 Ga0207713_1000002 3300025735 Bacteria 1061749
207 Ga0207713_1000003 3300025735 Bacteria 860698
208 Ga0207713_1000008 3300025735 Bacteria 553952
209 Ga0207713_1000016 3300025735 Bacteria 421689
210 Ga0207713_1000029 3300025735 Bacteria 285054
211 Ga0207713_1001124 3300025735 Bacteria 22760
212 Ga0207713_1002516 3300025735 Bacteria 13272
213 Ga0207713_1009037 3300025735 Bacteria 5661
214 Ga0207713_1052423 3300025735 Bacteria 1615
215 Ga0207710_10000113 3300025900 Bacteria 102300
216 Ga0207654_10000005 3300025911 Bacteria 869492
217 Ga0207674_10003836 3300026116 Bacteria 18318
218 Ga0209281_1000001 3300027111 Bacteria 1933496
219 Ga0209281_1000003 3300027111 Bacteria 1260089
220 Ga0209281_1000006 3300027111 Bacteria 1170244
221 Ga0209281_1000130 3300027111 Bacteria 191756
222 Ga0209281_1000181 3300027111 Bacteria 146200
223 Ga0209281_1000287 3300027111 Bacteria 93918
224 Ga0209281_1000414 3300027111 Bacteria 64365
225 Ga0209281_1000494 3300027111 Bacteria 53600
226 Ga0209281_1000638 3300027111 Bacteria 38391
227 Ga0209371_1000001 3300027312 Bacteria 2771503
228 Ga0209371_1000002 3300027312 Bacteria 1551985
229 Ga0209371_1000041 3300027312 Bacteria 340377
230 Ga0209371_1000093 3300027312 Bacteria 171050
231 Ga0209371_1000109 3300027312 Bacteria 141217
232 Ga0209371_1000124 3300027312 Bacteria 131108
233 Ga0209371_1000212 3300027312 Bacteria 80989
234 Ga0209371_1001290 3300027312 Bacteria 17602
235 Ga0209371_1002149 3300027312 Bacteria 11598
236 Ga0209371_1005278 3300027312 Bacteria 5207
237 Ga0209371_1006190 3300027312 Bacteria 4508
238 Ga0209371_1012305 3300027312 Bacteria 2487
239 Ga0209371_1013386 3300027312 Bacteria 2307
240 Ga0268266_10151515 3300028379 Bacteria 2090
241 Ga0268256_1000001 3300030500 Bacteria 2771065
242 Ga0268256_1000002 3300030500 Bacteria 1535763
243 Ga0268256_1000003 3300030500 Bacteria 1289401
244 Ga0268256_1000081 3300030500 Bacteria 171742
245 Ga0268256_1000239 3300030500 Bacteria 57839
246 Ga0268256_1001101 3300030500 Bacteria 17602
247 Ga0268256_1001624 3300030500 Bacteria 13011
248 Ga0268256_1005142 3300030500 Bacteria 5207
249 Ga0268256_1006179 3300030500 Bacteria 4509
250 Ga0268256_1012218 3300030500 Bacteria 2668
251 Ga0268256_1013394 3300030500 Bacteria 2487
252 Ga0268256_1014725 3300030500 Bacteria 2307
253 Ga0316176_1055173 3300030732 Bacteria 5650
254 Ga0316183_1005705 3300030742 Bacteria 10165
255 Ga0307414_10103292 3300032004 Bacteria 2150
256 Ga0307414_10115032 3300032004 Bacteria 2056
257 Ga0307507_10022053 3300033179 Bacteria 7058
258 Ga0436365_0971002 3300039437 Bacteria 167792
259 Ga0436361_0711746 3300039447 Bacteria 5310
260 Ga0439438_000001 3300041405 Bacteria 1263568
261 Ga0439438_001385 3300041405 Bacteria 10689
262 Ga0439438_002283 3300041405 Bacteria 8220
263 Ga0439447_001346 3300041407 Bacteria 8958
264 Ga0439447_003034 3300041407 Bacteria 6009
265 Ga0439466_0000009 3300041411 Bacteria 232657
266 Ga0439465_0001740 3300041413 Bacteria 7124
267 Ga0439432_003692 3300042006 Bacteria 5664
268 Ga0439432_010647 3300042006 Bacteria 3181
269 Ga0439432_015604 3300042006 Bacteria 2562
270 Ga0439449_0067527 3300042007 Bacteria 1318
271 Ga0439452_000001 3300042010 Bacteria 1725439
272 Ga0439452_000002 3300042010 Bacteria 1377577
273 Ga0439452_000028 3300042010 Bacteria 204513
274 Ga0439452_000493 3300042010 Bacteria 21705
275 Ga0450907_002039 3300042146 Bacteria 4024
276 Ga0439464_0018530 3300042439 Bacteria 1894
277 Ga0466981_0000002 3300044669 Bacteria 313036
278 Ga0495617_006481 3300046452 Bacteria 4100
279 Ga0495627_000116 3300046453 Bacteria 99916
280 Ga0495627_003294 3300046453 Bacteria 7220
281 Ga0495627_038569 3300046453 Bacteria 1476
282 Ga0495591_000013 3300046458 Bacteria 268106
283 Ga0495591_000100 3300046458 Bacteria 99473
284 Ga0495591_000763 3300046458 Bacteria 23259
285 Ga0495591_001170 3300046458 Bacteria 17125
286 Ga0495638_0000526 3300046460 Bacteria 44654
287 Ga0495638_0001608 3300046460 Bacteria 20176
288 Ga0495638_0019714 3300046460 Bacteria 4459
289 Ga0495650_0000043 3300046471 Bacteria 357197
290 Ga0495650_0000204 3300046471 Bacteria 129303
291 Ga0495650_0012129 3300046471 Bacteria 4660
292 Ga0495605_0039397 3300046474 Bacteria 2367
293 Ga0495607_0038746 3300046501 Bacteria 2853
294 Ga0495606_0002305 3300046507 Bacteria 22488
295 Ga0495610_0004372 3300046512 Bacteria 10473
296 Ga0495620_0027564 3300046515 Bacteria 2656
297 Ga0495631_0002447 3300046518 Bacteria 10465
298 Ga0495643_0001815 3300046522 Bacteria 18211
299 Ga0495644_0006198 3300046523 Bacteria 4648
300 Ga0495648_0014018 3300046524 Bacteria 5894
301 Ga0495654_0000041 3300046530 Bacteria 174733
302 Ga0495654_0000149 3300046530 Bacteria 72677
303 Ga0495654_0000167 3300046530 Bacteria 64853
304 Ga0495597_0000396 3300046542 Bacteria 37594
305 Ga0495633_0005215 3300046558 Bacteria 8016
306 Ga0495633_0043870 3300046558 Bacteria 2120
307 Ga0495668_0012121 3300046616 Bacteria 5127
308 Ga0495625_0013061 3300046660 Bacteria 6693
309 Ga0495625_0061379 3300046660 Bacteria 2660
310 Ga0495649_0001040 3300046694 Bacteria 21746
311 Ga0495649_0003204 3300046694 Bacteria 11183
312 Ga0495649_0137113 3300046694 Bacteria 1289
313 Ga0495589_0000001 3300046794 Bacteria 888100
314 Ga0495589_0019855 3300046794 Bacteria 3438
315 Ga0495660_0000012 3300046810 Bacteria 350701
316 Ga0495660_0000048 3300046810 Bacteria 145350
317 Ga0495660_0007665 3300046810 Bacteria 6341
318 Ga0495660_0042475 3300046810 Bacteria 2512
319 Ga0495672_0000002 3300047320 Bacteria 740116
320 Ga0495672_0000034 3300047320 Bacteria 290832
321 Ga0495672_0000043 3300047320 Bacteria 266893
322 Ga0495672_0000087 3300047320 Bacteria 154275
323 Ga0495672_0048070 3300047320 Bacteria 2532
324 Ga0495683_0013394 3300047323 Bacteria 4288
325 Ga0495679_000005 3300047446 Bacteria 455007
326 Ga0495679_001854 3300047446 Bacteria 11414
327 Ga0495679_029594 3300047446 Bacteria 1785
328 Ga0495673_0000070 3300047469 Bacteria 217453
329 Ga0495673_0000167 3300047469 Bacteria 111793
330 Ga0495681_0014421 3300047470 Bacteria 4529
331 Ga0495686_0015934 3300047472 Bacteria 5110
332 Ga0496100_0002684 3300048903 Bacteria 9076
333 Ga0496100_0023957 3300048903 Bacteria 3716
334 Ga0496101_0000055 3300048904 Bacteria 136176
335 Ga0496102_0005316 3300048905 Bacteria 10935
336 Ga0496102_0006086 3300048905 Bacteria 10290
337 Ga0496102_0017820 3300048905 Bacteria 6227
338 Ga0496102_0068372 3300048905 Bacteria 3259
339 Ga0496103_0003104 3300048906 Bacteria 10211
340 Ga0496103_0049310 3300048906 Bacteria 2603
341 Ga0496103_0058195 3300048906 Bacteria 2401
342 Ga0496104_0000091 3300048907 Bacteria 87834
343 Ga0496104_0000233 3300048907 Bacteria 49075
344 Ga0496104_0013159 3300048907 Bacteria 7459
345 Ga0496104_0028267 3300048907 Bacteria 5197
346 Ga0496104_0316953 3300048907 Bacteria 1472
347 Ga0496105_0001055 3300048908 Bacteria 19127
348 Ga0496105_0005125 3300048908 Bacteria 9935
349 Ga0496105_0222983 3300048908 Bacteria 1534
350 Ga0496106_0008226 3300048909 Bacteria 7712
351 Ga0496108_0002755 3300048911 Bacteria 14077
352 Ga0496109_0000702 3300048912 Bacteria 27873
353 Ga0496110_0003465 3300048913 Bacteria 12093
354 Ga0496111_0003764 3300048914 Bacteria 9445
355 Ga0496111_0267856 3300048914 Bacteria 1267
356 Ga0496113_0113586 3300048916 Bacteria 2111
357 Ga0496116_0000001 3300048919 Bacteria 1501681
358 Ga0496116_0000066 3300048919 Bacteria 264035
359 Ga0496116_0000206 3300048919 Bacteria 112462
360 Ga0496116_0000305 3300048919 Bacteria 82397
361 Ga0496116_0004122 3300048919 Bacteria 14002
362 Ga0496116_0013614 3300048919 Bacteria 6541
363 Ga0496116_0014949 3300048919 Bacteria 6160
364 Ga0496116_0017930 3300048919 Bacteria 5474
365 Ga0496116_0028791 3300048919 Bacteria 4017
366 Ga0496116_0035904 3300048919 Bacteria 3476
367 Ga0496116_0050135 3300048919 Bacteria 2783
368 Ga0496116_0064078 3300048919 Bacteria 2363
369 Ga0496116_0070252 3300048919 Bacteria 2223
370 Ga0496116_0109295 3300048919 Bacteria 1630
371 Ga0496116_0146591 3300048919 Bacteria 1318
372 Ga0496117_0000022 3300048920 Bacteria 439512
373 Ga0496117_0000453 3300048920 Bacteria 68285
374 Ga0496117_0001256 3300048920 Bacteria 37763
375 Ga0496117_0001430 3300048920 Bacteria 34487
376 Ga0496117_0002666 3300048920 Bacteria 22108
377 Ga0496117_0006643 3300048920 Bacteria 11599
378 Ga0496117_0007883 3300048920 Bacteria 10239
379 Ga0496117_0012653 3300048920 Bacteria 7414
380 Ga0496117_0022047 3300048920 Bacteria 5121
381 Ga0496117_0035311 3300048920 Bacteria 3753
382 Ga0496117_0035506 3300048920 Bacteria 3740
383 Ga0496117_0048673 3300048920 Bacteria 3024
384 Ga0496117_0064902 3300048920 Bacteria 2485
385 Ga0496117_0069791 3300048920 Bacteria 2364
386 Ga0496117_0072678 3300048920 Bacteria 2298
387 Ga0496117_0085002 3300048920 Bacteria 2062
388 Ga0496117_0113271 3300048920 Bacteria 1685
389 Ga0496118_0000007 3300048921 Bacteria 650986
390 Ga0496118_0000085 3300048921 Bacteria 179731
391 Ga0496118_0001349 3300048921 Bacteria 37069
392 Ga0496118_0003009 3300048921 Bacteria 21768
393 Ga0496118_0003137 3300048921 Bacteria 21147
394 Ga0496118_0004321 3300048921 Bacteria 16946
395 Ga0496118_0004655 3300048921 Bacteria 16095
396 Ga0496118_0007889 3300048921 Bacteria 11154
397 Ga0496118_0016755 3300048921 Bacteria 6702
398 Ga0496118_0018892 3300048921 Bacteria 6183
399 Ga0496118_0040387 3300048921 Bacteria 3711
400 Ga0496118_0045195 3300048921 Bacteria 3441
401 Ga0496118_0051892 3300048921 Bacteria 3133
402 Ga0496118_0051893 3300048921 Bacteria 3133
403 Ga0496118_0058708 3300048921 Bacteria 2872
404 Ga0496118_0099123 3300048921 Bacteria 1976
405 Ga0496118_0140126 3300048921 Bacteria 1535
406 Ga0496118_0199964 3300048921 Bacteria 1185
407 Ga0496119_0000001 3300048922 Bacteria 789520
408 Ga0496119_0000039 3300048922 Bacteria 208631
409 Ga0496119_0000711 3300048922 Bacteria 44692
410 Ga0496119_0002980 3300048922 Bacteria 17974
411 Ga0496119_0004522 3300048922 Bacteria 13800
412 Ga0496119_0008290 3300048922 Bacteria 9169
413 Ga0496119_0008327 3300048922 Bacteria 9138
414 Ga0496119_0008708 3300048922 Bacteria 8855
415 Ga0496119_0008859 3300048922 Bacteria 8752
416 Ga0496119_0014781 3300048922 Bacteria 6076
417 Ga0496119_0015119 3300048922 Bacteria 5974
418 Ga0496119_0017417 3300048922 Bacteria 5404
419 Ga0496119_0046818 3300048922 Bacteria 2696
420 Ga0496119_0048263 3300048922 Bacteria 2641
421 Ga0496119_0053464 3300048922 Bacteria 2466
422 Ga0496119_0096360 3300048922 Bacteria 1669
423 Ga0496120_0000002 3300048923 Bacteria 547999
424 Ga0496120_0000016 3300048923 Bacteria 307608
425 Ga0496120_0000464 3300048923 Bacteria 63910
426 Ga0496120_0000727 3300048923 Bacteria 48259
427 Ga0496120_0000807 3300048923 Bacteria 45013
428 Ga0496120_0000952 3300048923 Bacteria 39508
429 Ga0496120_0003772 3300048923 Bacteria 13386
430 Ga0496120_0009525 3300048923 Bacteria 6878
431 Ga0496120_0017051 3300048923 Bacteria 4722
432 Ga0496120_0023887 3300048923 Bacteria 3820
433 Ga0496120_0086998 3300048923 Bacteria 1679
434 Ga0496121_0000022 3300048924 Bacteria 472849
435 Ga0496121_0002456 3300048924 Bacteria 28303
436 Ga0496121_0002791 3300048924 Bacteria 25878
437 Ga0496121_0006576 3300048924 Bacteria 14344
438 Ga0496121_0009657 3300048924 Bacteria 11051
439 Ga0496121_0009703 3300048924 Bacteria 11019
440 Ga0496121_0017575 3300048924 Bacteria 7292
441 Ga0496121_0023766 3300048924 Bacteria 5888
442 Ga0496121_0043735 3300048924 Bacteria 3874
443 Ga0496121_0065701 3300048924 Bacteria 2950
444 Ga0496122_0000005 3300048925 Bacteria 630659
445 Ga0496122_0000110 3300048925 Bacteria 190142
446 Ga0496122_0000545 3300048925 Bacteria 77927
447 Ga0496122_0001733 3300048925 Bacteria 33832
448 Ga0496122_0003163 3300048925 Bacteria 21971
449 Ga0496122_0008583 3300048925 Bacteria 10984
450 Ga0496122_0008629 3300048925 Bacteria 10938
451 Ga0496122_0014529 3300048925 Bacteria 7601
452 Ga0496122_0097007 3300048925 Bacteria 1985
453 Ga0496122_0099645 3300048925 Bacteria 1947
454 Ga0496122_0175095 3300048925 Bacteria 1287
455 Ga0496123_0000008 3300048926 Bacteria 630628
456 Ga0496123_0000081 3300048926 Bacteria 190142
457 Ga0496123_0000189 3300048926 Bacteria 124719
458 Ga0496123_0001180 3300048926 Bacteria 38508
459 Ga0496123_0002658 3300048926 Bacteria 21604
460 Ga0496123_0003165 3300048926 Bacteria 18795
461 Ga0496123_0010892 3300048926 Bacteria 7962
462 Ga0496123_0014589 3300048926 Bacteria 6499
463 Ga0496123_0014855 3300048926 Bacteria 6426
464 Ga0496123_0019758 3300048926 Bacteria 5296
465 Ga0496123_0035013 3300048926 Bacteria 3586
466 Ga0496123_0061252 3300048926 Bacteria 2419
467 Ga0496124_0000066 3300048927 Bacteria 222815
468 Ga0496124_0000196 3300048927 Bacteria 119375
469 Ga0496124_0000199 3300048927 Bacteria 118647
470 Ga0496124_0000425 3300048927 Bacteria 75572
471 Ga0496124_0001064 3300048927 Bacteria 43365
472 Ga0496124_0001552 3300048927 Bacteria 33193
473 Ga0496124_0002919 3300048927 Bacteria 21557
474 Ga0496124_0003834 3300048927 Bacteria 18012
475 Ga0496124_0010267 3300048927 Bacteria 9508
476 Ga0496124_0011009 3300048927 Bacteria 9084
477 Ga0496124_0011330 3300048927 Bacteria 8919
478 Ga0496124_0011522 3300048927 Bacteria 8825
479 Ga0496124_0012022 3300048927 Bacteria 8603
480 Ga0496124_0012744 3300048927 Bacteria 8265
481 Ga0496124_0015837 3300048927 Bacteria 7203
482 Ga0496124_0023951 3300048927 Bacteria 5559
483 Ga0496124_0027671 3300048927 Bacteria 5083
484 Ga0496124_0028916 3300048927 Bacteria 4948
485 Ga0496124_0069628 3300048927 Bacteria 2921
486 Ga0496124_0089185 3300048927 Bacteria 2518
487 Ga0496124_0137496 3300048927 Bacteria 1932
488 Ga0496125_0000009 3300048928 Bacteria 677678
489 Ga0496125_0000033 3300048928 Bacteria 351850
490 Ga0496125_0000722 3300048928 Bacteria 54697
491 Ga0496125_0002253 3300048928 Bacteria 25624
492 Ga0496125_0006899 3300048928 Bacteria 12156
493 Ga0496125_0007926 3300048928 Bacteria 11213
494 Ga0496125_0008967 3300048928 Bacteria 10374
495 Ga0496125_0010929 3300048928 Bacteria 9126
496 Ga0496125_0012428 3300048928 Bacteria 8453
497 Ga0496125_0012532 3300048928 Bacteria 8409
498 Ga0496125_0013105 3300048928 Bacteria 8174
499 Ga0496125_0017697 3300048928 Bacteria 6783
500 Ga0496125_0035604 3300048928 Bacteria 4362
501 Ga0496126_0001084 3300048929 Bacteria 45796
502 Ga0496126_0001269 3300048929 Bacteria 40626
503 Ga0496126_0002176 3300048929 Bacteria 27230
504 Ga0496126_0003861 3300048929 Bacteria 18507
505 Ga0496126_0028173 3300048929 Bacteria 5356
506 Ga0496126_0041444 3300048929 Bacteria 4260
507 Ga0496126_0043126 3300048929 Bacteria 4163
508 Ga0496126_0070279 3300048929 Bacteria 3119
509 Ga0496126_0178098 3300048929 Bacteria 1807
510 Ga0496126_0243038 3300048929 Bacteria 1503
511 Ga0496126_0245620 3300048929 Bacteria 1493
512 Ga0495678_000354 3300049459 Bacteria 47217
513 Ga0495682_0000001 3300049460 Bacteria 1559116
514 nmdc:mga00v17_14820_c1 3300050491 Bacteria 1399
515 nmdc:mga00v17_51052_c1 3300050491 Bacteria 2515
516 nmdc:mga00v17_5333_c1 3300050491 Bacteria 6771
517 nmdc:mga0yw44_23173_c1 3300050492 Bacteria 3494
518 nmdc:mga0sz30_22044_c1 3300050516 Bacteria 2582
519 Ga0500618_000768 3300053125 Bacteria 18139
520 Ga0500621_000003 3300053126 Bacteria 596975
521 Ga0500622_0002521 3300053156 Bacteria 13153
522 2506578273 2506520007 Bacteria 5442880
523 2506583411 2506520008 Bacteria 5443009
524 2508852282 2508501071 Bacteria 5454741
525 2511382792 2511231025 Bacteria 5324661
526 2511437669 2511231035 Bacteria 5341610
527 2547695225 2547132181 Bacteria 4945084
528 2555257568 2554235234 Bacteria 5762085
529 2562462912 2561511199 Bacteria 5155034
530 2578456973 2576861471 Bacteria 4648976
531 2585829638 2585427591 Bacteria 5482980
532 2585832850 2585427592 Bacteria 5370892
533 2595088063 2593339131 Bacteria 5116855
534 2595451380 2593339239 Bacteria 4124669
535 2599409103 2599185169 Bacteria 5441380
536 2599925587 2599185299 Bacteria 4854625
537 2601522390 2600255254 Bacteria 5281859
538 2601527416 2600255255 Bacteria 5282785
539 2601532429 2600255256 Bacteria 5597742
540 2601537799 2600255257 Bacteria 5597196
541 2601614246 2600255280 Bacteria 5292309
542 2601618968 2600255281 Bacteria 5288753
543 2601642428 2600255287 Bacteria 5210468
544 2601647275 2600255288 Bacteria 5282738
545 2601652394 2600255289 Bacteria 5281907
546 2601657721 2600255290 Bacteria 5282218
547 2601662249 2600255291 Bacteria 5217298
548 2601695206 2600255298 Bacteria 5215185
549 2601699881 2600255299 Bacteria 5218662
550 2601705518 2600255300 Bacteria 5287774
551 2601710546 2600255301 Bacteria 5280532
552 2601715559 2600255302 Bacteria 5288235
553 2601720233 2600255303 Bacteria 5219315
554 2601725964 2600255304 Bacteria 5283973
555 2601730507 2600255305 Bacteria 5282329
556 2601735523 2600255306 Bacteria 5281613
557 2601740221 2600255307 Bacteria 5439064
558 2601750710 2600255309 Bacteria 5431045
559 2601756545 2600255310 Bacteria 5600903
560 2601762974 2600255311 Bacteria 5598766
561 2602017963 2600255392 Bacteria 5437392
562 2603638129 2602042046 Bacteria 5483348
563 2603642626 2602042047 Bacteria 4697674
564 2603659617 2602042052 Bacteria 5215873
565 2603664893 2602042053 Bacteria 5214361
566 2603698333 2602042066 Bacteria 4423871
567 2603703217 2602042067 Bacteria 4863713
568 2603837896 2602042103 Bacteria 5284714
569 2603842973 2602042104 Bacteria 5281639
570 2603848047 2602042105 Bacteria 5282303
571 2603853118 2602042106 Bacteria 5282744
572 2603871172 2602042110 Bacteria 5283285
573 2603876086 2602042111 Bacteria 5212080
574 2606048365 2603880178 Bacteria 5283018
575 2606069320 2603880184 Bacteria 5217896
576 2606145129 2603880202 Bacteria 5284684
577 2606175767 2603880211 Bacteria 5284226
578 2608669380 2608642108 Bacteria 4104624
579 2609913423 2609459761 Bacteria 5513740
580 2637225006 2636415599 Bacteria 5718434
581 2644717592 2643221731 Bacteria 5623886
582 2650898920 2648501693 Bacteria 5069560
583 2656279022 2654587920 Bacteria 5475511
584 2671103150 2667528172 Bacteria 5170840
585 2671109998 2667528173 Bacteria 5375747
586 2671587576 2671180115 Bacteria 5353919
587 2676406245 2675903046 Bacteria 5451247
588 2681997699 2681812866 Bacteria 4552357
589 2682006774 2681812869 Bacteria 5014465
590 2686353304 2684622997 Bacteria 4624240
591 2689444824 2687453601 Bacteria 5546041
592 2712470029 2711768156 Bacteria 4471618
593 2739268085 2738543017 Bacteria 4271950
594 2753855776 2751185917 Bacteria 4551186
595 2757566058 2757320391 Bacteria 4746095
596 2765588773 2765235842 Bacteria 4799256
597 2777023339 2775507074 Bacteria 5532402
598 2777762193 2775507177 Bacteria 4384303
599 2777836767 2775507192 Bacteria 4622234
600 2791922425 2791354903 Bacteria 4937680
601 2792314764 2791355010 Bacteria 4864581
602 2793405702 2791355275 Bacteria 4429597
603 2807179521 2806310673 Bacteria 4801221
604 2813729107 2811995292 Bacteria 5303342
605 2814696672 2814123068 Bacteria 5687681
606 2817481686 2816332295 Bacteria 4352468
607 2819566568 2818991440 Bacteria 4774720
608 2819706670 2818991465 Bacteria 5388835
609 2821119583 2821118458 Bacteria 4714306
610 2823374564 2823373977 Bacteria 4779415
611 2842882942 2842882022 Bacteria 6158489
612 2844427330 2844425489 Bacteria 4854065
613 2844530831 2844528606 Bacteria 4733806
614 2846545135 2846540461 Bacteria 5471451
615 2847087744 2847085930 Bacteria 5070450
616 2847799916 2847797336 Bacteria 5176640
617 2852104838 2852103415 Bacteria 5193810
618 2852652125 2852649853 Bacteria 4036942
619 2857446855 2857442823 Bacteria 4562550
620 2857587023 2857586860 Bacteria 4354574
621 2865015203 2865014394 Bacteria 4764573
622 2869554231 2869551831 Bacteria 5474685
623 2876604334 2876601092 Bacteria 5114497
624 2881612593 2881609920 Bacteria 4405319
625 2884088965 2884086401 Bacteria 5005459
626 2888378071 2888373701 Bacteria 5098052
627 2891670989 2891670763 Bacteria 4967099
628 2904467224 2904463128 Bacteria 4775606
629 2904477170 2904474040 Bacteria 5504324
630 2904508608 2904504865 Bacteria 5152820
631 2904514107 2904513164 Bacteria 5476410
632 2908669943 2908669403 Bacteria 5740494
633 2919108765 2919108558 Bacteria 5897419
634 2919145025 2919143609 Bacteria 6219228
635 2919153337 2919150387 Bacteria 5500879
636 2919404459 2919404418 Bacteria 4232372
637 2919520203 2919517244 Bacteria 5858162
638 2919721336 2919720352 Bacteria 5986006
639 2923634650 2923634449 Bacteria 4753480
640 2927143963 2927143783 Bacteria 5504251
641 2927834300 2927833300 Bacteria 4923934
642 2928094915 2928093941 Bacteria 5965005
643 2932408128 2932406140 Bacteria 5134491
644 2935626847 2935625433 Bacteria 5042964
645 2936341909 2936340661 Bacteria 5139038
646 2936365945 2936361878 Bacteria 5632809
647 2937540360 2937539931 Bacteria 4639830
648 2937967477 2937967321 Bacteria 5094075
649 2939568990 2939568625 Bacteria 4542555
650 2939573722 2939573065 Bacteria 4926053
651 2939578585 2939577877 Bacteria 5132791
652 2939589834 2939589442 Bacteria 4214238
653 2939603405 2939602548 Bacteria 4950493
654 2939607634 2939607340 Bacteria 4719256
655 2939619410 2939617950 Bacteria 4820956
656 2939624947 2939622612 Bacteria 4698046
657 2939643962 2939642701 Bacteria 4475280
658 2941478748 2941475908 Bacteria 4145589
659 2945877521 2945874760 Bacteria 5527237
660 2945953047 2945951305 Bacteria 4918162
661 2956900537 2956897341 Bacteria 5447711
662 2960320824 2960319331 Bacteria 5502575
663 2960376579 2960375949 Bacteria 5361395
664 2969081996 2969079654 Bacteria 5439582
665 2971823335 2971820967 Bacteria 5823634
666 2974307621 2974307012 Bacteria 4172388
667 2974312304 2974310843 Bacteria 4947816
668 2974438288 2974435778 Bacteria 4876478
669 2977248332 2977247770 Bacteria 4160543
670 2978975567 2978975091 Bacteria 4704313
671 2984496591 2984494565 Bacteria 5000175
672 2984517175 2984514374 Bacteria 4172479
673 2984564430 2984559226 Bacteria 5683096
674 2984597162 2984595703 Bacteria 5682994
675 2990262010 2990261002 Bacteria 4919493
676 3000378791 3000376612 Bacteria 4705565
677 3006862117 3006858327 Bacteria 4317835
678 640937788 640753048 Bacteria 5495657
679 8004595770 8004592986 Bacteria 5122074
680 8015398304 8015394850 Bacteria 5064660
681 8016736018 8016733728 Bacteria 5274317
682 8018224747 8018221730 Bacteria 4616064
683 8018408333 8018405270 Bacteria 4978981
684 8019502763 8019499862 Bacteria 5169538
685 8019506294 8019504834 Bacteria 4819156
686 8022894981 8022893055 Bacteria 5300455
687 8022919623 8022914991 Bacteria 5584517
688 8054845717 8054844752 Bacteria 4450330
689 8054853082 8054849141 Bacteria 5232694
690 8055090957 8055087960 Bacteria 4784273
691 8055094551 8055092621 Bacteria 4873875
692 8055099959 8055097453 Bacteria 4865496
693 8057309383 8057304971 Bacteria 4649742
694 Ga0105244_10000014
695 SwRhRL2b_contig_2491164
696 SwRhRL2b_contig_517513
697 JGI25162J39368_1000009
698 JGI25163J39215_1000068
699 JGI25164J39214_1000002
700 JGI25152J39213_1000258
701 JGI25151J46595_10002101
702 JGI25151J46595_10003521
703 JGI25151J46595_10025714
704 JGI25153J46596_10002505
705 rootH2_10040041
706 rootH2_10144681
707 rootH1_10021808
708 Ga0006562J51391_1111623
709 Ga0055538_1000015
710 Ga0055539_1000009
711 Ga0055533_1000012
712 Ga0055532_1000196
713 Ga0055525_1000014
714 Ga0055526_1000298
715 Ga0055526_1006163
716 Ga0055537_1001342
717 Ga0055537_1001615
718 Ga0055536_1002027
719 Ga0055536_1002102
720 Ga0055536_1002172
721 Ga0055534_1000145
722 Ga0055528_1002402
723 Ga0055530_10001996
724 Ga0055530_10002647
725 Ga0055531_10002729
726 Ga0055531_10002839
727 Ga0055541_1000006
728 Ga0058692_1000038
729 Ga0058692_1000101
730 Ga0058692_1000814
731 Ga0058692_1001389
732 Ga0058692_1003329
733 Ga0058692_1007994
734 Ga0058692_1007997
735 Ga0065703_1019619
736 Ga0065704_10000115
737 Ga0065704_10000297
738 Ga0065704_10000854
739 Ga0065704_10130302
740 Ga0070677_10025649
741 Ga0070659_100045840
742 Ga0070665_100003098
743 Ga0070665_100178209
744 Ga0068857_100000773
745 Ga0075364_10005738
746 Ga0075364_10023478
747 Ga0075369_10004726
748 Ga0075366_10093392
749 Ga0079104_1000083
750 Ga0079104_1000218
751 Ga0079104_1000263
752 Ga0079104_1000292
753 Ga0079104_1000716
754 Ga0079104_1000733
755 Ga0079104_1002113
756 Ga0079104_1002597
757 Ga0105251_10000002
758 Ga0105251_10000189
759 Ga0105251_10000304
760 Ga0105251_10002055
761 Ga0105251_10006273
762 Ga0105251_10010712
763 Ga0105251_10011006
764 Ga0105251_10012033
765 Ga0105251_10012464
766 Ga0105251_10101355
767 Ga0105244_10000195
768 Ga0105244_10000411
769 Ga0105244_10000960
770 Ga0105244_10002160
771 Ga0105244_10002374
772 Ga0105244_10002576
773 Ga0105244_10002696
774 Ga0105244_10006949
775 Ga0105244_10008124
776 Ga0105244_10016952
777 Ga0105244_10030995
778 Ga0105244_10055243
779 Ga0105250_10000002
780 Ga0105250_10000113
781 Ga0105250_10000837
782 Ga0105250_10001894
783 Ga0105250_10003290
784 Ga0105250_10011666
785 Ga0105250_10015474
786 Ga0105247_10000129
787 Ga0105243_10060480
788 Ga0105241_10000002
789 Ga0157373_10000405
790 Ga0157373_10022690
791 Ga0157373_10024015
792 Ga0157373_10077177
793 Ga0157373_10091599
794 Ga0157373_10103422
795 Ga0157371_10000008
796 Ga0157371_10000397
797 Ga0157371_10002962
798 Ga0157371_10003325
799 Ga0157371_10005800
800 Ga0157371_10009336
801 Ga0157371_10010131
802 Ga0157371_10011525
803 Ga0157371_10048547
804 Ga0157371_10053873
805 Ga0157370_10000064
806 Ga0157370_10000918
807 Ga0157370_10002375
808 Ga0157370_10003134
809 Ga0157370_10043702
810 Ga0157369_10005175
811 Ga0157369_10020840
812 Ga0163162_10072842
813 Ga0163162_10076831
814 Ga0157372_10079979
815 Ga0157372_10224730
816 Ga0182008_10000076
817 Ga0182008_10001234
818 Ga0182008_10001733
819 Ga0182008_10010929
820 Ga0182008_10092202
821 Ga0182006_1000047
822 Ga0182006_1004480
823 Ga0182006_1017559
824 Ga0182007_10000079
825 Ga0182005_1000166
826 Ga0183366_1001
827 Ga0183370_1001
828 Ga0183369_1001
829 Ga0183368_1001
830 Ga0163161_10000001
831 Ga0163161_10002679
832 Ga0163161_10030436
833 Ga0163161_10039512
834 Ga0213872_10084229
835 Ga0213876_10000055
836 Ga0209760_100120
837 Ga0209784_100001
838 Ga0209566_100001
839 Ga0209674_100002
840 Ga0209147_100088
841 Ga0209563_100002
842 Ga0207427_100020
843 Ga0209437_100001
844 Ga0209437_100073
845 Ga0209677_100002
846 Ga0209129_1000004
847 Ga0209129_1000025
848 Ga0209129_1003781
849 Ga0209233_1002662
850 Ga0209565_1000060
851 Ga0209673_1000047
852 Ga0209673_1041020
853 Ga0209675_1000007
854 Ga0209676_1000018
855 Ga0209676_1000471
856 Ga0209676_1002858
857 Ga0209025_1000041
858 Ga0209025_1000680
859 Ga0209025_1008260
860 Ga0209564_1000039
861 Ga0209564_1000252
862 Ga0209758_1000210
863 Ga0209050_1000146
864 Ga0209050_1000592
865 Ga0209256_1003699
866 Ga0209256_1004039
867 Ga0209051_1001427
868 Ga0209257_1000035
869 Ga0209257_1001448
870 Ga0209257_1006792
871 Ga0209257_1041757
872 Ga0207696_1000001
873 Ga0207696_1000005
874 Ga0207696_1000086
875 Ga0207696_1000218
876 Ga0207696_1000292
877 Ga0207696_1000398
878 Ga0207696_1000858
879 Ga0207696_1002113
880 Ga0207696_1003125
881 Ga0207696_1018621
882 Ga0207655_1000001
883 Ga0207655_1000009
884 Ga0207655_1000037
885 Ga0207655_1000063
886 Ga0207655_1000069
887 Ga0207655_1003246
888 Ga0207655_1003752
889 Ga0207655_1005519
890 Ga0207655_1007953
891 Ga0207655_1008130
892 Ga0207655_1008944
893 Ga0207655_1010790
894 Ga0207655_1026155
895 Ga0207655_1035201
896 Ga0207655_1038384
897 Ga0207655_1040779
898 Ga0207713_1000001
899 Ga0207713_1000002
900 Ga0207713_1000003
901 Ga0207713_1000008
902 Ga0207713_1000016
903 Ga0207713_1000029
904 Ga0207713_1001124
905 Ga0207713_1002516
906 Ga0207713_1009037
907 Ga0207713_1052423
908 Ga0207710_10000113
909 Ga0207654_10000005
910 Ga0207674_10003836
911 Ga0209281_1000001
912 Ga0209281_1000003
913 Ga0209281_1000006
914 Ga0209281_1000130
915 Ga0209281_1000181
916 Ga0209281_1000287
917 Ga0209281_1000414
918 Ga0209281_1000494
919 Ga0209281_1000638
920 Ga0209371_1000001
921 Ga0209371_1000002
922 Ga0209371_1000041
923 Ga0209371_1000093
924 Ga0209371_1000109
925 Ga0209371_1000124
926 Ga0209371_1000212
927 Ga0209371_1001290
928 Ga0209371_1002149
929 Ga0209371_1005278
930 Ga0209371_1006190
931 Ga0209371_1012305
932 Ga0209371_1013386
933 Ga0268266_10151515
934 Ga0268256_1000001
935 Ga0268256_1000002
936 Ga0268256_1000003
937 Ga0268256_1000081
938 Ga0268256_1000239
939 Ga0268256_1001101
940 Ga0268256_1001624
941 Ga0268256_1005142
942 Ga0268256_1006179
943 Ga0268256_1012218
944 Ga0268256_1013394
945 Ga0268256_1014725
946 Ga0316176_1055173
947 Ga0316183_1005705
948 Ga0307414_10103292
949 Ga0307414_10115032
950 Ga0307507_10022053
951 Ga0436365_0971002
952 Ga0436361_0711746
953 Ga0439438_000001
954 Ga0439438_001385
955 Ga0439438_002283
956 Ga0439447_001346
957 Ga0439447_003034
958 Ga0439466_0000009
959 Ga0439465_0001740
960 Ga0439432_003692
961 Ga0439432_010647
962 Ga0439432_015604
963 Ga0439449_0067527
964 Ga0439452_000001
965 Ga0439452_000002
966 Ga0439452_000028
967 Ga0439452_000493
968 Ga0450907_002039
969 Ga0439464_0018530
970 Ga0466981_0000002
971 Ga0495617_006481
972 Ga0495627_000116
973 Ga0495627_003294
974 Ga0495627_038569
975 Ga0495591_000013
976 Ga0495591_000100
977 Ga0495591_000763
978 Ga0495591_001170
979 Ga0495638_0000526
980 Ga0495638_0001608
981 Ga0495638_0019714
982 Ga0495650_0000043
983 Ga0495650_0000204
984 Ga0495650_0012129
985 Ga0495605_0039397
986 Ga0495607_0038746
987 Ga0495606_0002305
988 Ga0495610_0004372
989 Ga0495620_0027564
990 Ga0495631_0002447
991 Ga0495643_0001815
992 Ga0495644_0006198
993 Ga0495648_0014018
994 Ga0495654_0000041
995 Ga0495654_0000149
996 Ga0495654_0000167
997 Ga0495597_0000396
998 Ga0495633_0005215
999 Ga0495633_0043870
1000 Ga0495668_0012121
1001 Ga0495625_0013061
1002 Ga0495625_0061379
1003 Ga0495649_0001040
1004 Ga0495649_0003204
1005 Ga0495649_0137113
1006 Ga0495589_0000001
1007 Ga0495589_0019855
1008 Ga0495660_0000012
1009 Ga0495660_0000048
1010 Ga0495660_0007665
1011 Ga0495660_0042475
1012 Ga0495672_0000002
1013 Ga0495672_0000034
1014 Ga0495672_0000043
1015 Ga0495672_0000087
1016 Ga0495672_0048070
1017 Ga0495683_0013394
1018 Ga0495679_000005
1019 Ga0495679_001854
1020 Ga0495679_029594
1021 Ga0495673_0000070
1022 Ga0495673_0000167
1023 Ga0495681_0014421
1024 Ga0495686_0015934
1025 Ga0496100_0002684
1026 Ga0496100_0023957
1027 Ga0496101_0000055
1028 Ga0496102_0005316
1029 Ga0496102_0006086
1030 Ga0496102_0017820
1031 Ga0496102_0068372
1032 Ga0496103_0003104
1033 Ga0496103_0049310
1034 Ga0496103_0058195
1035 Ga0496104_0000091
1036 Ga0496104_0000233
1037 Ga0496104_0013159
1038 Ga0496104_0028267
1039 Ga0496104_0316953
1040 Ga0496105_0001055
1041 Ga0496105_0005125
1042 Ga0496105_0222983
1043 Ga0496106_0008226
1044 Ga0496108_0002755
1045 Ga0496109_0000702
1046 Ga0496110_0003465
1047 Ga0496111_0003764
1048 Ga0496111_0267856
1049 Ga0496113_0113586
1050 Ga0496116_0000001
1051 Ga0496116_0000066
1052 Ga0496116_0000206
1053 Ga0496116_0000305
1054 Ga0496116_0004122
1055 Ga0496116_0013614
1056 Ga0496116_0014949
1057 Ga0496116_0017930
1058 Ga0496116_0028791
1059 Ga0496116_0035904
1060 Ga0496116_0050135
1061 Ga0496116_0064078
1062 Ga0496116_0070252
1063 Ga0496116_0109295
1064 Ga0496116_0146591
1065 Ga0496117_0000022
1066 Ga0496117_0000453
1067 Ga0496117_0001256
1068 Ga0496117_0001430
1069 Ga0496117_0002666
1070 Ga0496117_0006643
1071 Ga0496117_0007883
1072 Ga0496117_0012653
1073 Ga0496117_0022047
1074 Ga0496117_0035311
1075 Ga0496117_0035506
1076 Ga0496117_0048673
1077 Ga0496117_0064902
1078 Ga0496117_0069791
1079 Ga0496117_0072678
1080 Ga0496117_0085002
1081 Ga0496117_0113271
1082 Ga0496118_0000007
1083 Ga0496118_0000085
1084 Ga0496118_0001349
1085 Ga0496118_0003009
1086 Ga0496118_0003137
1087 Ga0496118_0004321
1088 Ga0496118_0004655
1089 Ga0496118_0007889
1090 Ga0496118_0016755
1091 Ga0496118_0018892
1092 Ga0496118_0040387
1093 Ga0496118_0045195
1094 Ga0496118_0051892
1095 Ga0496118_0051893
1096 Ga0496118_0058708
1097 Ga0496118_0099123
1098 Ga0496118_0140126
1099 Ga0496118_0199964
1100 Ga0496119_0000001
1101 Ga0496119_0000039
1102 Ga0496119_0000711
1103 Ga0496119_0002980
1104 Ga0496119_0004522
1105 Ga0496119_0008290
1106 Ga0496119_0008327
1107 Ga0496119_0008708
1108 Ga0496119_0008859
1109 Ga0496119_0014781
1110 Ga0496119_0015119
1111 Ga0496119_0017417
1112 Ga0496119_0046818
1113 Ga0496119_0048263
1114 Ga0496119_0053464
1115 Ga0496119_0096360
1116 Ga0496120_0000002
1117 Ga0496120_0000016
1118 Ga0496120_0000464
1119 Ga0496120_0000727
1120 Ga0496120_0000807
1121 Ga0496120_0000952
1122 Ga0496120_0003772
1123 Ga0496120_0009525
1124 Ga0496120_0017051
1125 Ga0496120_0023887
1126 Ga0496120_0086998
1127 Ga0496121_0000022
1128 Ga0496121_0002456
1129 Ga0496121_0002791
1130 Ga0496121_0006576
1131 Ga0496121_0009657
1132 Ga0496121_0009703
1133 Ga0496121_0017575
1134 Ga0496121_0023766
1135 Ga0496121_0043735
1136 Ga0496121_0065701
1137 Ga0496122_0000005
1138 Ga0496122_0000110
1139 Ga0496122_0000545
1140 Ga0496122_0001733
1141 Ga0496122_0003163
1142 Ga0496122_0008583
1143 Ga0496122_0008629
1144 Ga0496122_0014529
1145 Ga0496122_0097007
1146 Ga0496122_0099645
1147 Ga0496122_0175095
1148 Ga0496123_0000008
1149 Ga0496123_0000081
1150 Ga0496123_0000189
1151 Ga0496123_0001180
1152 Ga0496123_0002658
1153 Ga0496123_0003165
1154 Ga0496123_0010892
1155 Ga0496123_0014589
1156 Ga0496123_0014855
1157 Ga0496123_0019758
1158 Ga0496123_0035013
1159 Ga0496123_0061252
1160 Ga0496124_0000066
1161 Ga0496124_0000196
1162 Ga0496124_0000199
1163 Ga0496124_0000425
1164 Ga0496124_0001064
1165 Ga0496124_0001552
1166 Ga0496124_0002919
1167 Ga0496124_0003834
1168 Ga0496124_0010267
1169 Ga0496124_0011009
1170 Ga0496124_0011330
1171 Ga0496124_0011522
1172 Ga0496124_0012022
1173 Ga0496124_0012744
1174 Ga0496124_0015837
1175 Ga0496124_0023951
1176 Ga0496124_0027671
1177 Ga0496124_0028916
1178 Ga0496124_0069628
1179 Ga0496124_0089185
1180 Ga0496124_0137496
1181 Ga0496125_0000009
1182 Ga0496125_0000033
1183 Ga0496125_0000722
1184 Ga0496125_0002253
1185 Ga0496125_0006899
1186 Ga0496125_0007926
1187 Ga0496125_0008967
1188 Ga0496125_0010929
1189 Ga0496125_0012428
1190 Ga0496125_0012532
1191 Ga0496125_0013105
1192 Ga0496125_0017697
1193 Ga0496125_0035604
1194 Ga0496126_0001084
1195 Ga0496126_0001269
1196 Ga0496126_0002176
1197 Ga0496126_0003861
1198 Ga0496126_0028173
1199 Ga0496126_0041444
1200 Ga0496126_0043126
1201 Ga0496126_0070279
1202 Ga0496126_0178098
1203 Ga0496126_0243038
1204 Ga0496126_0245620
1205 Ga0495678_000354
1206 Ga0495682_0000001
1207 nmdc:mga00v17_14820_c1
1208 nmdc:mga00v17_51052_c1
1209 nmdc:mga00v17_5333_c1
1210 nmdc:mga0yw44_23173_c1
1211 nmdc:mga0sz30_22044_c1
1212 Ga0500618_000768
1213 Ga0500621_000003
1214 Ga0500622_0002521
1215 2506578273
1216 2506583411
1217 2508852282
1218 2511382792
1219 2511437669
1220 2547695225
1221 2555257568
1222 2562462912
1223 2578456973
1224 2585829638
1225 2585832850
1226 2595088063
1227 2595451380
1228 2599409103
1229 2599925587
1230 2601522390
1231 2601527416
1232 2601532429
1233 2601537799
1234 2601614246
1235 2601618968
1236 2601642428
1237 2601647275
1238 2601652394
1239 2601657721
1240 2601662249
1241 2601695206
1242 2601699881
1243 2601705518
1244 2601710546
1245 2601715559
1246 2601720233
1247 2601725964
1248 2601730507
1249 2601735523
1250 2601740221
1251 2601750710
1252 2601756545
1253 2601762974
1254 2602017963
1255 2603638129
1256 2603642626
1257 2603659617
1258 2603664893
1259 2603698333
1260 2603703217
1261 2603837896
1262 2603842973
1263 2603848047
1264 2603853118
1265 2603871172
1266 2603876086
1267 2606048365
1268 2606069320
1269 2606145129
1270 2606175767
1271 2608669380
1272 2609913423
1273 2637225006
1274 2644717592
1275 2650898920
1276 2656279022
1277 2671103150
1278 2671109998
1279 2671587576
1280 2676406245
1281 2681997699
1282 2682006774
1283 2686353304
1284 2689444824
1285 2712470029
1286 2739268085
1287 2753855776
1288 2757566058
1289 2765588773
1290 2777023339
1291 2777762193
1292 2777836767
1293 2791922425
1294 2792314764
1295 2793405702
1296 2807179521
1297 2813729107
1298 2814696672
1299 2817481686
1300 2819566568
1301 2819706670
1302 2821119583
1303 2823374564
1304 2842882942
1305 2844427330
1306 2844530831
1307 2846545135
1308 2847087744
1309 2847799916
1310 2852104838
1311 2852652125
1312 2857446855
1313 2857587023
1314 2865015203
1315 2869554231
1316 2876604334
1317 2881612593
1318 2884088965
1319 2888378071
1320 2891670989
1321 2904467224
1322 2904477170
1323 2904508608
1324 2904514107
1325 2908669943
1326 2919108765
1327 2919145025
1328 2919153337
1329 2919404459
1330 2919520203
1331 2919721336
1332 2923634650
1333 2927143963
1334 2927834300
1335 2928094915
1336 2932408128
1337 2935626847
1338 2936341909
1339 2936365945
1340 2937540360
1341 2937967477
1342 2939568990
1343 2939573722
1344 2939578585
1345 2939589834
1346 2939603405
1347 2939607634
1348 2939619410
1349 2939624947
1350 2939643962
1351 2941478748
1352 2945877521
1353 2945953047
1354 2956900537
1355 2960320824
1356 2960376579
1357 2969081996
1358 2971823335
1359 2974307621
1360 2974312304
1361 2974438288
1362 2977248332
1363 2978975567
1364 2984496591
1365 2984517175
1366 2984564430
1367 2984597162
1368 2990262010
1369 3000378791
1370 3006862117
1371 640937788
1372 8004595770
1373 8015398304
1374 8016736018
1375 8018224747
1376 8018408333
1377 8019502763
1378 8019506294
1379 8022894981
1380 8022919623
1381 8054845717
1382 8054853082
1383 8055090957
1384 8055094551
1385 8055099959
1386 8057309383

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

83

200

0.98

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

212

423

0.98

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

208

326

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kux-assembly1.cif.gz_A structure of the ypo2259 putative oxidoreductase from yersinia pestis 0.9742 8 355
3e82-assembly1.cif.gz_A crystal structure of a putative oxidoreductase from klebsiella pneumoniae 0.9718 13 354
3e82-assembly2.cif.gz_E crystal structure of a putative oxidoreductase from klebsiella pneumoniae 0.9708 11 354
3gfg-assembly5.cif.gz_I structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9644 13 355
3gfg-assembly5.cif.gz_J structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9638 13 355
ID Description Score Start End Superfamily
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9813 11 130 3.90.1150.10
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9733 11 130 3.90.1150.10
3kuxA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9723 136 355 3.30.360.10
3kuxA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9531 136 355 3.30.360.10
3e82E02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9503 136 354 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A379WUX7-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9877 10 306 GO:0000166
GO:0016491
AF-A0A379SYW5-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9869 35 261 GO:0000166
GO:0016491
AF-A0A377BB82-F1-model_v4 Oxidoreductase (EC 1.-.-.-) 0.9852 101 292 GO:0016491
AF-A0A379WUX7-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9844 10 306 GO:0000166
GO:0016491
AF-A0A357NKC6-F1-model_v4 deleted 0.9821 148 355

Map