F475644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 336 | 1386 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10000014|Ga0105244_1000001420 |
| Length | 424 |
| Sequence | MMRRNQQQKAHAQYNPAHQLDDTIKYHTHNNQCPKESRGKMLPGTWRLRQLKRGVLIKGCEPLTDVVKWRVTTDEGNNMSDTIRVGLIGYGYASKTFHAPLISGTPGMELAAVSSSDEAKVKVDWPGVKVVSEPKHLFNDPSIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELDALARSLGRLLSVFHNRRWDSDFLTVKALIAEGTLGEVTFFESHFDRYRPEVRNRWREQGGPGSGIWYDLAPHLLDQAVNLFGLPVSLTVDLAQLRPGAQSTDYFHAVLNYPQRRVILHGTLLAAAESARYIVHGTRASYVKYGLDPQEERLKNGERLPQEDWGYDMRDGVVTRVNGDDRTEETWLTVPGNYPAYYAGIRDALNGSGENPVPASQAIQIMELIELGIESAKHRATLSLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 48 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 52 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 53 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 54 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 57 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 58 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 91 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 94 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 95 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 96 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 97 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 98 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 99 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 100 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 101 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 102 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 103 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 104 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 105 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 106 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 137 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 138 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 139 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 140 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 141 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 147 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 148 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 149 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 150 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 151 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 152 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 153 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 154 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 155 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 156 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 157 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 163 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 164 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 165 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 166 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 167 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 168 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 169 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 170 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 171 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 172 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 173 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 174 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 175 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 176 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 177 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 178 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 179 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 180 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 181 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 182 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 183 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 184 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 185 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 186 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 187 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 188 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 189 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 190 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 191 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 192 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 193 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 194 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 195 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 196 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 197 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 198 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 199 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 200 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 201 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 202 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 203 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 204 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 205 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 206 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 207 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 208 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 209 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 210 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 211 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 212 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 213 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 214 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 215 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 216 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 217 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 218 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 219 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 220 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 221 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 222 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 223 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 224 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 225 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 226 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 227 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 228 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 229 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 230 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 231 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 232 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 233 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 234 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 235 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 236 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 237 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 238 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 239 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 240 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 241 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 242 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 243 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 244 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 245 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 246 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 247 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 248 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 249 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 250 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 251 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 252 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 253 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 254 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 255 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 256 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 257 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 258 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 259 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 260 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 261 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 262 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 263 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 264 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 265 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 266 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 267 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 268 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 269 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 270 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 271 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 272 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 273 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 274 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 275 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 276 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 277 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 278 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 279 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 280 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 281 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 282 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 283 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 284 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 285 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 286 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 287 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 288 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 289 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 290 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 291 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 292 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 293 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 294 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 295 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 296 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 297 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 298 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 299 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 300 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 301 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 302 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 303 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 304 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 305 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 306 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 307 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 308 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 309 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 310 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 311 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 312 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 313 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 314 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 315 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 316 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 317 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 318 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 319 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 320 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 321 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 322 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 323 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 324 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 325 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 326 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 327 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 328 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 329 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 330 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 331 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 332 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 333 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 334 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 335 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 336 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.04 |
| Metatranscriptomes | 0.14 |
| Isolates | 24.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.72 |
| Bulb | 0.14 |
| Endosphere | 10.97 |
| Nodule | 2.6 |
| Rhizoplane | 11.26 |
| Rhizosphere | 43 |
| Stem | 0.14 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10000014 | 3300009036 | Bacteria | 257018 |
| 2 | SwRhRL2b_contig_2491164 | 2162886007 | Bacteria | 7077 |
| 3 | SwRhRL2b_contig_517513 | 2162886007 | Bacteria | 2177 |
| 4 | JGI25162J39368_1000009 | 3300002737 | Bacteria | 389795 |
| 5 | JGI25163J39215_1000068 | 3300002771 | Bacteria | 47173 |
| 6 | JGI25164J39214_1000002 | 3300002772 | Bacteria | 406570 |
| 7 | JGI25152J39213_1000258 | 3300002773 | Bacteria | 35248 |
| 8 | JGI25151J46595_10002101 | 3300003187 | Bacteria | 12423 |
| 9 | JGI25151J46595_10003521 | 3300003187 | Bacteria | 8619 |
| 10 | JGI25151J46595_10025714 | 3300003187 | Bacteria | 2389 |
| 11 | JGI25153J46596_10002505 | 3300003215 | Bacteria | 10541 |
| 12 | rootH2_10040041 | 3300003320 | Bacteria | 15643 |
| 13 | rootH2_10144681 | 3300003320 | Bacteria | 1596 |
| 14 | rootH1_10021808 | 3300003323 | Bacteria | 9164 |
| 15 | Ga0006562J51391_1111623 | 3300003578 | Bacteria | 1650 |
| 16 | Ga0055538_1000015 | 3300003751 | Bacteria | 311166 |
| 17 | Ga0055539_1000009 | 3300003752 | Bacteria | 406566 |
| 18 | Ga0055533_1000012 | 3300003756 | Bacteria | 406566 |
| 19 | Ga0055532_1000196 | 3300003758 | Bacteria | 50546 |
| 20 | Ga0055525_1000014 | 3300003759 | Bacteria | 406566 |
| 21 | Ga0055526_1000298 | 3300003771 | Bacteria | 41396 |
| 22 | Ga0055526_1006163 | 3300003771 | Bacteria | 6602 |
| 23 | Ga0055537_1001342 | 3300003773 | Bacteria | 9995 |
| 24 | Ga0055537_1001615 | 3300003773 | Bacteria | 8475 |
| 25 | Ga0055536_1002027 | 3300003781 | Bacteria | 11611 |
| 26 | Ga0055536_1002102 | 3300003781 | Bacteria | 11340 |
| 27 | Ga0055536_1002172 | 3300003781 | Bacteria | 11180 |
| 28 | Ga0055534_1000145 | 3300003784 | Bacteria | 52879 |
| 29 | Ga0055528_1002402 | 3300003790 | Bacteria | 10077 |
| 30 | Ga0055530_10001996 | 3300003791 | Bacteria | 13846 |
| 31 | Ga0055530_10002647 | 3300003791 | Bacteria | 11202 |
| 32 | Ga0055531_10002729 | 3300003794 | Bacteria | 11611 |
| 33 | Ga0055531_10002839 | 3300003794 | Bacteria | 11340 |
| 34 | Ga0055541_1000006 | 3300003841 | Bacteria | 406566 |
| 35 | Ga0058692_1000038 | 3300003856 | Bacteria | 140136 |
| 36 | Ga0058692_1000101 | 3300003856 | Bacteria | 56780 |
| 37 | Ga0058692_1000814 | 3300003856 | Bacteria | 12392 |
| 38 | Ga0058692_1001389 | 3300003856 | Bacteria | 8957 |
| 39 | Ga0058692_1003329 | 3300003856 | Bacteria | 4997 |
| 40 | Ga0058692_1007994 | 3300003856 | Bacteria | 2752 |
| 41 | Ga0058692_1007997 | 3300003856 | Bacteria | 2752 |
| 42 | Ga0065703_1019619 | 3300005272 | Bacteria | 2646 |
| 43 | Ga0065704_10000115 | 3300005289 | Bacteria | 75390 |
| 44 | Ga0065704_10000297 | 3300005289 | Bacteria | 43486 |
| 45 | Ga0065704_10000854 | 3300005289 | Bacteria | 11560 |
| 46 | Ga0065704_10130302 | 3300005289 | Bacteria | 1638 |
| 47 | Ga0070677_10025649 | 3300005333 | Bacteria | 2202 |
| 48 | Ga0070659_100045840 | 3300005366 | Bacteria | 3426 |
| 49 | Ga0070665_100003098 | 3300005548 | Bacteria | 17905 |
| 50 | Ga0070665_100178209 | 3300005548 | Bacteria | 2126 |
| 51 | Ga0068857_100000773 | 3300005577 | Bacteria | 23816 |
| 52 | Ga0075364_10005738 | 3300006051 | Bacteria | 7238 |
| 53 | Ga0075364_10023478 | 3300006051 | Bacteria | 3904 |
| 54 | Ga0075369_10004726 | 3300006186 | Bacteria | 5053 |
| 55 | Ga0075366_10093392 | 3300006195 | Bacteria | 1803 |
| 56 | Ga0079104_1000083 | 3300006946 | Bacteria | 137254 |
| 57 | Ga0079104_1000218 | 3300006946 | Bacteria | 80243 |
| 58 | Ga0079104_1000263 | 3300006946 | Bacteria | 69767 |
| 59 | Ga0079104_1000292 | 3300006946 | Bacteria | 63382 |
| 60 | Ga0079104_1000716 | 3300006946 | Bacteria | 29970 |
| 61 | Ga0079104_1000733 | 3300006946 | Bacteria | 29076 |
| 62 | Ga0079104_1002113 | 3300006946 | Bacteria | 11343 |
| 63 | Ga0079104_1002597 | 3300006946 | Bacteria | 9472 |
| 64 | Ga0105251_10000002 | 3300009011 | Bacteria | 350843 |
| 65 | Ga0105251_10000189 | 3300009011 | Bacteria | 62590 |
| 66 | Ga0105251_10000304 | 3300009011 | Bacteria | 49243 |
| 67 | Ga0105251_10002055 | 3300009011 | Bacteria | 16280 |
| 68 | Ga0105251_10006273 | 3300009011 | Bacteria | 7615 |
| 69 | Ga0105251_10010712 | 3300009011 | Bacteria | 5290 |
| 70 | Ga0105251_10011006 | 3300009011 | Bacteria | 5197 |
| 71 | Ga0105251_10012033 | 3300009011 | Bacteria | 4910 |
| 72 | Ga0105251_10012464 | 3300009011 | Bacteria | 4810 |
| 73 | Ga0105251_10101355 | 3300009011 | Bacteria | 1316 |
| 74 | Ga0105244_10000195 | 3300009036 | Bacteria | 61365 |
| 75 | Ga0105244_10000411 | 3300009036 | Bacteria | 39919 |
| 76 | Ga0105244_10000960 | 3300009036 | Bacteria | 24197 |
| 77 | Ga0105244_10002160 | 3300009036 | Bacteria | 15082 |
| 78 | Ga0105244_10002374 | 3300009036 | Bacteria | 14273 |
| 79 | Ga0105244_10002576 | 3300009036 | Bacteria | 13611 |
| 80 | Ga0105244_10002696 | 3300009036 | Bacteria | 13279 |
| 81 | Ga0105244_10006949 | 3300009036 | Bacteria | 7250 |
| 82 | Ga0105244_10008124 | 3300009036 | Bacteria | 6589 |
| 83 | Ga0105244_10016952 | 3300009036 | Bacteria | 4133 |
| 84 | Ga0105244_10030995 | 3300009036 | Bacteria | 2840 |
| 85 | Ga0105244_10055243 | 3300009036 | Bacteria | 2012 |
| 86 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 87 | Ga0105250_10000113 | 3300009092 | Bacteria | 72385 |
| 88 | Ga0105250_10000837 | 3300009092 | Bacteria | 18280 |
| 89 | Ga0105250_10001894 | 3300009092 | Bacteria | 10870 |
| 90 | Ga0105250_10003290 | 3300009092 | Bacteria | 7691 |
| 91 | Ga0105250_10011666 | 3300009092 | Bacteria | 3643 |
| 92 | Ga0105250_10015474 | 3300009092 | Bacteria | 3123 |
| 93 | Ga0105247_10000129 | 3300009101 | Bacteria | 73190 |
| 94 | Ga0105243_10060480 | 3300009148 | Bacteria | 3026 |
| 95 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 96 | Ga0157373_10000405 | 3300013100 | Bacteria | 34603 |
| 97 | Ga0157373_10022690 | 3300013100 | Bacteria | 4553 |
| 98 | Ga0157373_10024015 | 3300013100 | Bacteria | 4418 |
| 99 | Ga0157373_10077177 | 3300013100 | Bacteria | 2350 |
| 100 | Ga0157373_10091599 | 3300013100 | Bacteria | 2141 |
| 101 | Ga0157373_10103422 | 3300013100 | Bacteria | 2003 |
| 102 | Ga0157371_10000008 | 3300013102 | Bacteria | 393028 |
| 103 | Ga0157371_10000397 | 3300013102 | Bacteria | 54547 |
| 104 | Ga0157371_10002962 | 3300013102 | Bacteria | 15794 |
| 105 | Ga0157371_10003325 | 3300013102 | Bacteria | 14690 |
| 106 | Ga0157371_10005800 | 3300013102 | Bacteria | 10334 |
| 107 | Ga0157371_10009336 | 3300013102 | Bacteria | 7732 |
| 108 | Ga0157371_10010131 | 3300013102 | Bacteria | 7364 |
| 109 | Ga0157371_10011525 | 3300013102 | Bacteria | 6799 |
| 110 | Ga0157371_10048547 | 3300013102 | Bacteria | 3017 |
| 111 | Ga0157371_10053873 | 3300013102 | Bacteria | 2857 |
| 112 | Ga0157370_10000064 | 3300013104 | Bacteria | 114340 |
| 113 | Ga0157370_10000918 | 3300013104 | Bacteria | 37372 |
| 114 | Ga0157370_10002375 | 3300013104 | Bacteria | 22690 |
| 115 | Ga0157370_10003134 | 3300013104 | Bacteria | 19581 |
| 116 | Ga0157370_10043702 | 3300013104 | Bacteria | 4311 |
| 117 | Ga0157369_10005175 | 3300013105 | Bacteria | 15256 |
| 118 | Ga0157369_10020840 | 3300013105 | Bacteria | 7328 |
| 119 | Ga0163162_10072842 | 3300013306 | Bacteria | 3491 |
| 120 | Ga0163162_10076831 | 3300013306 | Bacteria | 3402 |
| 121 | Ga0157372_10079979 | 3300013307 | Bacteria | 3697 |
| 122 | Ga0157372_10224730 | 3300013307 | Bacteria | 2176 |
| 123 | Ga0182008_10000076 | 3300014497 | Bacteria | 77484 |
| 124 | Ga0182008_10001234 | 3300014497 | Bacteria | 17552 |
| 125 | Ga0182008_10001733 | 3300014497 | Bacteria | 14318 |
| 126 | Ga0182008_10010929 | 3300014497 | Bacteria | 4842 |
| 127 | Ga0182008_10092202 | 3300014497 | Bacteria | 1494 |
| 128 | Ga0182006_1000047 | 3300015261 | Bacteria | 187006 |
| 129 | Ga0182006_1004480 | 3300015261 | Bacteria | 6875 |
| 130 | Ga0182006_1017559 | 3300015261 | Bacteria | 3037 |
| 131 | Ga0182007_10000079 | 3300015262 | Bacteria | 73543 |
| 132 | Ga0182005_1000166 | 3300015265 | Bacteria | 45594 |
| 133 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 134 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 135 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 136 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 137 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 138 | Ga0163161_10002679 | 3300017792 | Bacteria | 12658 |
| 139 | Ga0163161_10030436 | 3300017792 | Bacteria | 3842 |
| 140 | Ga0163161_10039512 | 3300017792 | Bacteria | 3388 |
| 141 | Ga0213872_10084229 | 3300021361 | Bacteria | 1426 |
| 142 | Ga0213876_10000055 | 3300021384 | Bacteria | 136037 |
| 143 | Ga0209760_100120 | 3300025207 | Bacteria | 53842 |
| 144 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 145 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 146 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 147 | Ga0209147_100088 | 3300025229 | Bacteria | 179728 |
| 148 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 149 | Ga0207427_100020 | 3300025231 | Bacteria | 507515 |
| 150 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 151 | Ga0209437_100073 | 3300025233 | Bacteria | 302948 |
| 152 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 153 | Ga0209129_1000004 | 3300025258 | Bacteria | 884499 |
| 154 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 155 | Ga0209129_1003781 | 3300025258 | Bacteria | 6359 |
| 156 | Ga0209233_1002662 | 3300025261 | Bacteria | 6469 |
| 157 | Ga0209565_1000060 | 3300025263 | Bacteria | 188543 |
| 158 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 159 | Ga0209673_1041020 | 3300025273 | Bacteria | 1319 |
| 160 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 161 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 162 | Ga0209676_1000471 | 3300025292 | Bacteria | 67223 |
| 163 | Ga0209676_1002858 | 3300025292 | Bacteria | 11392 |
| 164 | Ga0209025_1000041 | 3300025294 | Bacteria | 373694 |
| 165 | Ga0209025_1000680 | 3300025294 | Bacteria | 58342 |
| 166 | Ga0209025_1008260 | 3300025294 | Bacteria | 7522 |
| 167 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 168 | Ga0209564_1000252 | 3300025295 | Bacteria | 114416 |
| 169 | Ga0209758_1000210 | 3300025297 | Bacteria | 127919 |
| 170 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 171 | Ga0209050_1000592 | 3300025298 | Bacteria | 57827 |
| 172 | Ga0209256_1003699 | 3300025299 | Bacteria | 10388 |
| 173 | Ga0209256_1004039 | 3300025299 | Bacteria | 9549 |
| 174 | Ga0209051_1001427 | 3300025303 | Bacteria | 20456 |
| 175 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 176 | Ga0209257_1001448 | 3300025304 | Bacteria | 28059 |
| 177 | Ga0209257_1006792 | 3300025304 | Bacteria | 7201 |
| 178 | Ga0209257_1041757 | 3300025304 | Bacteria | 1359 |
| 179 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 180 | Ga0207696_1000005 | 3300025711 | Bacteria | 642078 |
| 181 | Ga0207696_1000086 | 3300025711 | Bacteria | 194626 |
| 182 | Ga0207696_1000218 | 3300025711 | Bacteria | 83242 |
| 183 | Ga0207696_1000292 | 3300025711 | Bacteria | 58466 |
| 184 | Ga0207696_1000398 | 3300025711 | Bacteria | 40651 |
| 185 | Ga0207696_1000858 | 3300025711 | Bacteria | 19072 |
| 186 | Ga0207696_1002113 | 3300025711 | Bacteria | 9985 |
| 187 | Ga0207696_1003125 | 3300025711 | Bacteria | 7717 |
| 188 | Ga0207696_1018621 | 3300025711 | Bacteria | 2276 |
| 189 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 190 | Ga0207655_1000009 | 3300025728 | Bacteria | 664676 |
| 191 | Ga0207655_1000037 | 3300025728 | Bacteria | 354473 |
| 192 | Ga0207655_1000063 | 3300025728 | Bacteria | 257028 |
| 193 | Ga0207655_1000069 | 3300025728 | Bacteria | 239968 |
| 194 | Ga0207655_1003246 | 3300025728 | Bacteria | 12211 |
| 195 | Ga0207655_1003752 | 3300025728 | Bacteria | 11139 |
| 196 | Ga0207655_1005519 | 3300025728 | Bacteria | 8581 |
| 197 | Ga0207655_1007953 | 3300025728 | Bacteria | 6807 |
| 198 | Ga0207655_1008130 | 3300025728 | Bacteria | 6710 |
| 199 | Ga0207655_1008944 | 3300025728 | Bacteria | 6283 |
| 200 | Ga0207655_1010790 | 3300025728 | Bacteria | 5508 |
| 201 | Ga0207655_1026155 | 3300025728 | Bacteria | 2809 |
| 202 | Ga0207655_1035201 | 3300025728 | Bacteria | 2239 |
| 203 | Ga0207655_1038384 | 3300025728 | Bacteria | 2094 |
| 204 | Ga0207655_1040779 | 3300025728 | Bacteria | 1998 |
| 205 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 206 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 207 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 208 | Ga0207713_1000008 | 3300025735 | Bacteria | 553952 |
| 209 | Ga0207713_1000016 | 3300025735 | Bacteria | 421689 |
| 210 | Ga0207713_1000029 | 3300025735 | Bacteria | 285054 |
| 211 | Ga0207713_1001124 | 3300025735 | Bacteria | 22760 |
| 212 | Ga0207713_1002516 | 3300025735 | Bacteria | 13272 |
| 213 | Ga0207713_1009037 | 3300025735 | Bacteria | 5661 |
| 214 | Ga0207713_1052423 | 3300025735 | Bacteria | 1615 |
| 215 | Ga0207710_10000113 | 3300025900 | Bacteria | 102300 |
| 216 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 217 | Ga0207674_10003836 | 3300026116 | Bacteria | 18318 |
| 218 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 219 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 220 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 221 | Ga0209281_1000130 | 3300027111 | Bacteria | 191756 |
| 222 | Ga0209281_1000181 | 3300027111 | Bacteria | 146200 |
| 223 | Ga0209281_1000287 | 3300027111 | Bacteria | 93918 |
| 224 | Ga0209281_1000414 | 3300027111 | Bacteria | 64365 |
| 225 | Ga0209281_1000494 | 3300027111 | Bacteria | 53600 |
| 226 | Ga0209281_1000638 | 3300027111 | Bacteria | 38391 |
| 227 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 228 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 229 | Ga0209371_1000041 | 3300027312 | Bacteria | 340377 |
| 230 | Ga0209371_1000093 | 3300027312 | Bacteria | 171050 |
| 231 | Ga0209371_1000109 | 3300027312 | Bacteria | 141217 |
| 232 | Ga0209371_1000124 | 3300027312 | Bacteria | 131108 |
| 233 | Ga0209371_1000212 | 3300027312 | Bacteria | 80989 |
| 234 | Ga0209371_1001290 | 3300027312 | Bacteria | 17602 |
| 235 | Ga0209371_1002149 | 3300027312 | Bacteria | 11598 |
| 236 | Ga0209371_1005278 | 3300027312 | Bacteria | 5207 |
| 237 | Ga0209371_1006190 | 3300027312 | Bacteria | 4508 |
| 238 | Ga0209371_1012305 | 3300027312 | Bacteria | 2487 |
| 239 | Ga0209371_1013386 | 3300027312 | Bacteria | 2307 |
| 240 | Ga0268266_10151515 | 3300028379 | Bacteria | 2090 |
| 241 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 242 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 243 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 244 | Ga0268256_1000081 | 3300030500 | Bacteria | 171742 |
| 245 | Ga0268256_1000239 | 3300030500 | Bacteria | 57839 |
| 246 | Ga0268256_1001101 | 3300030500 | Bacteria | 17602 |
| 247 | Ga0268256_1001624 | 3300030500 | Bacteria | 13011 |
| 248 | Ga0268256_1005142 | 3300030500 | Bacteria | 5207 |
| 249 | Ga0268256_1006179 | 3300030500 | Bacteria | 4509 |
| 250 | Ga0268256_1012218 | 3300030500 | Bacteria | 2668 |
| 251 | Ga0268256_1013394 | 3300030500 | Bacteria | 2487 |
| 252 | Ga0268256_1014725 | 3300030500 | Bacteria | 2307 |
| 253 | Ga0316176_1055173 | 3300030732 | Bacteria | 5650 |
| 254 | Ga0316183_1005705 | 3300030742 | Bacteria | 10165 |
| 255 | Ga0307414_10103292 | 3300032004 | Bacteria | 2150 |
| 256 | Ga0307414_10115032 | 3300032004 | Bacteria | 2056 |
| 257 | Ga0307507_10022053 | 3300033179 | Bacteria | 7058 |
| 258 | Ga0436365_0971002 | 3300039437 | Bacteria | 167792 |
| 259 | Ga0436361_0711746 | 3300039447 | Bacteria | 5310 |
| 260 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 261 | Ga0439438_001385 | 3300041405 | Bacteria | 10689 |
| 262 | Ga0439438_002283 | 3300041405 | Bacteria | 8220 |
| 263 | Ga0439447_001346 | 3300041407 | Bacteria | 8958 |
| 264 | Ga0439447_003034 | 3300041407 | Bacteria | 6009 |
| 265 | Ga0439466_0000009 | 3300041411 | Bacteria | 232657 |
| 266 | Ga0439465_0001740 | 3300041413 | Bacteria | 7124 |
| 267 | Ga0439432_003692 | 3300042006 | Bacteria | 5664 |
| 268 | Ga0439432_010647 | 3300042006 | Bacteria | 3181 |
| 269 | Ga0439432_015604 | 3300042006 | Bacteria | 2562 |
| 270 | Ga0439449_0067527 | 3300042007 | Bacteria | 1318 |
| 271 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 272 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 273 | Ga0439452_000028 | 3300042010 | Bacteria | 204513 |
| 274 | Ga0439452_000493 | 3300042010 | Bacteria | 21705 |
| 275 | Ga0450907_002039 | 3300042146 | Bacteria | 4024 |
| 276 | Ga0439464_0018530 | 3300042439 | Bacteria | 1894 |
| 277 | Ga0466981_0000002 | 3300044669 | Bacteria | 313036 |
| 278 | Ga0495617_006481 | 3300046452 | Bacteria | 4100 |
| 279 | Ga0495627_000116 | 3300046453 | Bacteria | 99916 |
| 280 | Ga0495627_003294 | 3300046453 | Bacteria | 7220 |
| 281 | Ga0495627_038569 | 3300046453 | Bacteria | 1476 |
| 282 | Ga0495591_000013 | 3300046458 | Bacteria | 268106 |
| 283 | Ga0495591_000100 | 3300046458 | Bacteria | 99473 |
| 284 | Ga0495591_000763 | 3300046458 | Bacteria | 23259 |
| 285 | Ga0495591_001170 | 3300046458 | Bacteria | 17125 |
| 286 | Ga0495638_0000526 | 3300046460 | Bacteria | 44654 |
| 287 | Ga0495638_0001608 | 3300046460 | Bacteria | 20176 |
| 288 | Ga0495638_0019714 | 3300046460 | Bacteria | 4459 |
| 289 | Ga0495650_0000043 | 3300046471 | Bacteria | 357197 |
| 290 | Ga0495650_0000204 | 3300046471 | Bacteria | 129303 |
| 291 | Ga0495650_0012129 | 3300046471 | Bacteria | 4660 |
| 292 | Ga0495605_0039397 | 3300046474 | Bacteria | 2367 |
| 293 | Ga0495607_0038746 | 3300046501 | Bacteria | 2853 |
| 294 | Ga0495606_0002305 | 3300046507 | Bacteria | 22488 |
| 295 | Ga0495610_0004372 | 3300046512 | Bacteria | 10473 |
| 296 | Ga0495620_0027564 | 3300046515 | Bacteria | 2656 |
| 297 | Ga0495631_0002447 | 3300046518 | Bacteria | 10465 |
| 298 | Ga0495643_0001815 | 3300046522 | Bacteria | 18211 |
| 299 | Ga0495644_0006198 | 3300046523 | Bacteria | 4648 |
| 300 | Ga0495648_0014018 | 3300046524 | Bacteria | 5894 |
| 301 | Ga0495654_0000041 | 3300046530 | Bacteria | 174733 |
| 302 | Ga0495654_0000149 | 3300046530 | Bacteria | 72677 |
| 303 | Ga0495654_0000167 | 3300046530 | Bacteria | 64853 |
| 304 | Ga0495597_0000396 | 3300046542 | Bacteria | 37594 |
| 305 | Ga0495633_0005215 | 3300046558 | Bacteria | 8016 |
| 306 | Ga0495633_0043870 | 3300046558 | Bacteria | 2120 |
| 307 | Ga0495668_0012121 | 3300046616 | Bacteria | 5127 |
| 308 | Ga0495625_0013061 | 3300046660 | Bacteria | 6693 |
| 309 | Ga0495625_0061379 | 3300046660 | Bacteria | 2660 |
| 310 | Ga0495649_0001040 | 3300046694 | Bacteria | 21746 |
| 311 | Ga0495649_0003204 | 3300046694 | Bacteria | 11183 |
| 312 | Ga0495649_0137113 | 3300046694 | Bacteria | 1289 |
| 313 | Ga0495589_0000001 | 3300046794 | Bacteria | 888100 |
| 314 | Ga0495589_0019855 | 3300046794 | Bacteria | 3438 |
| 315 | Ga0495660_0000012 | 3300046810 | Bacteria | 350701 |
| 316 | Ga0495660_0000048 | 3300046810 | Bacteria | 145350 |
| 317 | Ga0495660_0007665 | 3300046810 | Bacteria | 6341 |
| 318 | Ga0495660_0042475 | 3300046810 | Bacteria | 2512 |
| 319 | Ga0495672_0000002 | 3300047320 | Bacteria | 740116 |
| 320 | Ga0495672_0000034 | 3300047320 | Bacteria | 290832 |
| 321 | Ga0495672_0000043 | 3300047320 | Bacteria | 266893 |
| 322 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 323 | Ga0495672_0048070 | 3300047320 | Bacteria | 2532 |
| 324 | Ga0495683_0013394 | 3300047323 | Bacteria | 4288 |
| 325 | Ga0495679_000005 | 3300047446 | Bacteria | 455007 |
| 326 | Ga0495679_001854 | 3300047446 | Bacteria | 11414 |
| 327 | Ga0495679_029594 | 3300047446 | Bacteria | 1785 |
| 328 | Ga0495673_0000070 | 3300047469 | Bacteria | 217453 |
| 329 | Ga0495673_0000167 | 3300047469 | Bacteria | 111793 |
| 330 | Ga0495681_0014421 | 3300047470 | Bacteria | 4529 |
| 331 | Ga0495686_0015934 | 3300047472 | Bacteria | 5110 |
| 332 | Ga0496100_0002684 | 3300048903 | Bacteria | 9076 |
| 333 | Ga0496100_0023957 | 3300048903 | Bacteria | 3716 |
| 334 | Ga0496101_0000055 | 3300048904 | Bacteria | 136176 |
| 335 | Ga0496102_0005316 | 3300048905 | Bacteria | 10935 |
| 336 | Ga0496102_0006086 | 3300048905 | Bacteria | 10290 |
| 337 | Ga0496102_0017820 | 3300048905 | Bacteria | 6227 |
| 338 | Ga0496102_0068372 | 3300048905 | Bacteria | 3259 |
| 339 | Ga0496103_0003104 | 3300048906 | Bacteria | 10211 |
| 340 | Ga0496103_0049310 | 3300048906 | Bacteria | 2603 |
| 341 | Ga0496103_0058195 | 3300048906 | Bacteria | 2401 |
| 342 | Ga0496104_0000091 | 3300048907 | Bacteria | 87834 |
| 343 | Ga0496104_0000233 | 3300048907 | Bacteria | 49075 |
| 344 | Ga0496104_0013159 | 3300048907 | Bacteria | 7459 |
| 345 | Ga0496104_0028267 | 3300048907 | Bacteria | 5197 |
| 346 | Ga0496104_0316953 | 3300048907 | Bacteria | 1472 |
| 347 | Ga0496105_0001055 | 3300048908 | Bacteria | 19127 |
| 348 | Ga0496105_0005125 | 3300048908 | Bacteria | 9935 |
| 349 | Ga0496105_0222983 | 3300048908 | Bacteria | 1534 |
| 350 | Ga0496106_0008226 | 3300048909 | Bacteria | 7712 |
| 351 | Ga0496108_0002755 | 3300048911 | Bacteria | 14077 |
| 352 | Ga0496109_0000702 | 3300048912 | Bacteria | 27873 |
| 353 | Ga0496110_0003465 | 3300048913 | Bacteria | 12093 |
| 354 | Ga0496111_0003764 | 3300048914 | Bacteria | 9445 |
| 355 | Ga0496111_0267856 | 3300048914 | Bacteria | 1267 |
| 356 | Ga0496113_0113586 | 3300048916 | Bacteria | 2111 |
| 357 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 358 | Ga0496116_0000066 | 3300048919 | Bacteria | 264035 |
| 359 | Ga0496116_0000206 | 3300048919 | Bacteria | 112462 |
| 360 | Ga0496116_0000305 | 3300048919 | Bacteria | 82397 |
| 361 | Ga0496116_0004122 | 3300048919 | Bacteria | 14002 |
| 362 | Ga0496116_0013614 | 3300048919 | Bacteria | 6541 |
| 363 | Ga0496116_0014949 | 3300048919 | Bacteria | 6160 |
| 364 | Ga0496116_0017930 | 3300048919 | Bacteria | 5474 |
| 365 | Ga0496116_0028791 | 3300048919 | Bacteria | 4017 |
| 366 | Ga0496116_0035904 | 3300048919 | Bacteria | 3476 |
| 367 | Ga0496116_0050135 | 3300048919 | Bacteria | 2783 |
| 368 | Ga0496116_0064078 | 3300048919 | Bacteria | 2363 |
| 369 | Ga0496116_0070252 | 3300048919 | Bacteria | 2223 |
| 370 | Ga0496116_0109295 | 3300048919 | Bacteria | 1630 |
| 371 | Ga0496116_0146591 | 3300048919 | Bacteria | 1318 |
| 372 | Ga0496117_0000022 | 3300048920 | Bacteria | 439512 |
| 373 | Ga0496117_0000453 | 3300048920 | Bacteria | 68285 |
| 374 | Ga0496117_0001256 | 3300048920 | Bacteria | 37763 |
| 375 | Ga0496117_0001430 | 3300048920 | Bacteria | 34487 |
| 376 | Ga0496117_0002666 | 3300048920 | Bacteria | 22108 |
| 377 | Ga0496117_0006643 | 3300048920 | Bacteria | 11599 |
| 378 | Ga0496117_0007883 | 3300048920 | Bacteria | 10239 |
| 379 | Ga0496117_0012653 | 3300048920 | Bacteria | 7414 |
| 380 | Ga0496117_0022047 | 3300048920 | Bacteria | 5121 |
| 381 | Ga0496117_0035311 | 3300048920 | Bacteria | 3753 |
| 382 | Ga0496117_0035506 | 3300048920 | Bacteria | 3740 |
| 383 | Ga0496117_0048673 | 3300048920 | Bacteria | 3024 |
| 384 | Ga0496117_0064902 | 3300048920 | Bacteria | 2485 |
| 385 | Ga0496117_0069791 | 3300048920 | Bacteria | 2364 |
| 386 | Ga0496117_0072678 | 3300048920 | Bacteria | 2298 |
| 387 | Ga0496117_0085002 | 3300048920 | Bacteria | 2062 |
| 388 | Ga0496117_0113271 | 3300048920 | Bacteria | 1685 |
| 389 | Ga0496118_0000007 | 3300048921 | Bacteria | 650986 |
| 390 | Ga0496118_0000085 | 3300048921 | Bacteria | 179731 |
| 391 | Ga0496118_0001349 | 3300048921 | Bacteria | 37069 |
| 392 | Ga0496118_0003009 | 3300048921 | Bacteria | 21768 |
| 393 | Ga0496118_0003137 | 3300048921 | Bacteria | 21147 |
| 394 | Ga0496118_0004321 | 3300048921 | Bacteria | 16946 |
| 395 | Ga0496118_0004655 | 3300048921 | Bacteria | 16095 |
| 396 | Ga0496118_0007889 | 3300048921 | Bacteria | 11154 |
| 397 | Ga0496118_0016755 | 3300048921 | Bacteria | 6702 |
| 398 | Ga0496118_0018892 | 3300048921 | Bacteria | 6183 |
| 399 | Ga0496118_0040387 | 3300048921 | Bacteria | 3711 |
| 400 | Ga0496118_0045195 | 3300048921 | Bacteria | 3441 |
| 401 | Ga0496118_0051892 | 3300048921 | Bacteria | 3133 |
| 402 | Ga0496118_0051893 | 3300048921 | Bacteria | 3133 |
| 403 | Ga0496118_0058708 | 3300048921 | Bacteria | 2872 |
| 404 | Ga0496118_0099123 | 3300048921 | Bacteria | 1976 |
| 405 | Ga0496118_0140126 | 3300048921 | Bacteria | 1535 |
| 406 | Ga0496118_0199964 | 3300048921 | Bacteria | 1185 |
| 407 | Ga0496119_0000001 | 3300048922 | Bacteria | 789520 |
| 408 | Ga0496119_0000039 | 3300048922 | Bacteria | 208631 |
| 409 | Ga0496119_0000711 | 3300048922 | Bacteria | 44692 |
| 410 | Ga0496119_0002980 | 3300048922 | Bacteria | 17974 |
| 411 | Ga0496119_0004522 | 3300048922 | Bacteria | 13800 |
| 412 | Ga0496119_0008290 | 3300048922 | Bacteria | 9169 |
| 413 | Ga0496119_0008327 | 3300048922 | Bacteria | 9138 |
| 414 | Ga0496119_0008708 | 3300048922 | Bacteria | 8855 |
| 415 | Ga0496119_0008859 | 3300048922 | Bacteria | 8752 |
| 416 | Ga0496119_0014781 | 3300048922 | Bacteria | 6076 |
| 417 | Ga0496119_0015119 | 3300048922 | Bacteria | 5974 |
| 418 | Ga0496119_0017417 | 3300048922 | Bacteria | 5404 |
| 419 | Ga0496119_0046818 | 3300048922 | Bacteria | 2696 |
| 420 | Ga0496119_0048263 | 3300048922 | Bacteria | 2641 |
| 421 | Ga0496119_0053464 | 3300048922 | Bacteria | 2466 |
| 422 | Ga0496119_0096360 | 3300048922 | Bacteria | 1669 |
| 423 | Ga0496120_0000002 | 3300048923 | Bacteria | 547999 |
| 424 | Ga0496120_0000016 | 3300048923 | Bacteria | 307608 |
| 425 | Ga0496120_0000464 | 3300048923 | Bacteria | 63910 |
| 426 | Ga0496120_0000727 | 3300048923 | Bacteria | 48259 |
| 427 | Ga0496120_0000807 | 3300048923 | Bacteria | 45013 |
| 428 | Ga0496120_0000952 | 3300048923 | Bacteria | 39508 |
| 429 | Ga0496120_0003772 | 3300048923 | Bacteria | 13386 |
| 430 | Ga0496120_0009525 | 3300048923 | Bacteria | 6878 |
| 431 | Ga0496120_0017051 | 3300048923 | Bacteria | 4722 |
| 432 | Ga0496120_0023887 | 3300048923 | Bacteria | 3820 |
| 433 | Ga0496120_0086998 | 3300048923 | Bacteria | 1679 |
| 434 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 435 | Ga0496121_0002456 | 3300048924 | Bacteria | 28303 |
| 436 | Ga0496121_0002791 | 3300048924 | Bacteria | 25878 |
| 437 | Ga0496121_0006576 | 3300048924 | Bacteria | 14344 |
| 438 | Ga0496121_0009657 | 3300048924 | Bacteria | 11051 |
| 439 | Ga0496121_0009703 | 3300048924 | Bacteria | 11019 |
| 440 | Ga0496121_0017575 | 3300048924 | Bacteria | 7292 |
| 441 | Ga0496121_0023766 | 3300048924 | Bacteria | 5888 |
| 442 | Ga0496121_0043735 | 3300048924 | Bacteria | 3874 |
| 443 | Ga0496121_0065701 | 3300048924 | Bacteria | 2950 |
| 444 | Ga0496122_0000005 | 3300048925 | Bacteria | 630659 |
| 445 | Ga0496122_0000110 | 3300048925 | Bacteria | 190142 |
| 446 | Ga0496122_0000545 | 3300048925 | Bacteria | 77927 |
| 447 | Ga0496122_0001733 | 3300048925 | Bacteria | 33832 |
| 448 | Ga0496122_0003163 | 3300048925 | Bacteria | 21971 |
| 449 | Ga0496122_0008583 | 3300048925 | Bacteria | 10984 |
| 450 | Ga0496122_0008629 | 3300048925 | Bacteria | 10938 |
| 451 | Ga0496122_0014529 | 3300048925 | Bacteria | 7601 |
| 452 | Ga0496122_0097007 | 3300048925 | Bacteria | 1985 |
| 453 | Ga0496122_0099645 | 3300048925 | Bacteria | 1947 |
| 454 | Ga0496122_0175095 | 3300048925 | Bacteria | 1287 |
| 455 | Ga0496123_0000008 | 3300048926 | Bacteria | 630628 |
| 456 | Ga0496123_0000081 | 3300048926 | Bacteria | 190142 |
| 457 | Ga0496123_0000189 | 3300048926 | Bacteria | 124719 |
| 458 | Ga0496123_0001180 | 3300048926 | Bacteria | 38508 |
| 459 | Ga0496123_0002658 | 3300048926 | Bacteria | 21604 |
| 460 | Ga0496123_0003165 | 3300048926 | Bacteria | 18795 |
| 461 | Ga0496123_0010892 | 3300048926 | Bacteria | 7962 |
| 462 | Ga0496123_0014589 | 3300048926 | Bacteria | 6499 |
| 463 | Ga0496123_0014855 | 3300048926 | Bacteria | 6426 |
| 464 | Ga0496123_0019758 | 3300048926 | Bacteria | 5296 |
| 465 | Ga0496123_0035013 | 3300048926 | Bacteria | 3586 |
| 466 | Ga0496123_0061252 | 3300048926 | Bacteria | 2419 |
| 467 | Ga0496124_0000066 | 3300048927 | Bacteria | 222815 |
| 468 | Ga0496124_0000196 | 3300048927 | Bacteria | 119375 |
| 469 | Ga0496124_0000199 | 3300048927 | Bacteria | 118647 |
| 470 | Ga0496124_0000425 | 3300048927 | Bacteria | 75572 |
| 471 | Ga0496124_0001064 | 3300048927 | Bacteria | 43365 |
| 472 | Ga0496124_0001552 | 3300048927 | Bacteria | 33193 |
| 473 | Ga0496124_0002919 | 3300048927 | Bacteria | 21557 |
| 474 | Ga0496124_0003834 | 3300048927 | Bacteria | 18012 |
| 475 | Ga0496124_0010267 | 3300048927 | Bacteria | 9508 |
| 476 | Ga0496124_0011009 | 3300048927 | Bacteria | 9084 |
| 477 | Ga0496124_0011330 | 3300048927 | Bacteria | 8919 |
| 478 | Ga0496124_0011522 | 3300048927 | Bacteria | 8825 |
| 479 | Ga0496124_0012022 | 3300048927 | Bacteria | 8603 |
| 480 | Ga0496124_0012744 | 3300048927 | Bacteria | 8265 |
| 481 | Ga0496124_0015837 | 3300048927 | Bacteria | 7203 |
| 482 | Ga0496124_0023951 | 3300048927 | Bacteria | 5559 |
| 483 | Ga0496124_0027671 | 3300048927 | Bacteria | 5083 |
| 484 | Ga0496124_0028916 | 3300048927 | Bacteria | 4948 |
| 485 | Ga0496124_0069628 | 3300048927 | Bacteria | 2921 |
| 486 | Ga0496124_0089185 | 3300048927 | Bacteria | 2518 |
| 487 | Ga0496124_0137496 | 3300048927 | Bacteria | 1932 |
| 488 | Ga0496125_0000009 | 3300048928 | Bacteria | 677678 |
| 489 | Ga0496125_0000033 | 3300048928 | Bacteria | 351850 |
| 490 | Ga0496125_0000722 | 3300048928 | Bacteria | 54697 |
| 491 | Ga0496125_0002253 | 3300048928 | Bacteria | 25624 |
| 492 | Ga0496125_0006899 | 3300048928 | Bacteria | 12156 |
| 493 | Ga0496125_0007926 | 3300048928 | Bacteria | 11213 |
| 494 | Ga0496125_0008967 | 3300048928 | Bacteria | 10374 |
| 495 | Ga0496125_0010929 | 3300048928 | Bacteria | 9126 |
| 496 | Ga0496125_0012428 | 3300048928 | Bacteria | 8453 |
| 497 | Ga0496125_0012532 | 3300048928 | Bacteria | 8409 |
| 498 | Ga0496125_0013105 | 3300048928 | Bacteria | 8174 |
| 499 | Ga0496125_0017697 | 3300048928 | Bacteria | 6783 |
| 500 | Ga0496125_0035604 | 3300048928 | Bacteria | 4362 |
| 501 | Ga0496126_0001084 | 3300048929 | Bacteria | 45796 |
| 502 | Ga0496126_0001269 | 3300048929 | Bacteria | 40626 |
| 503 | Ga0496126_0002176 | 3300048929 | Bacteria | 27230 |
| 504 | Ga0496126_0003861 | 3300048929 | Bacteria | 18507 |
| 505 | Ga0496126_0028173 | 3300048929 | Bacteria | 5356 |
| 506 | Ga0496126_0041444 | 3300048929 | Bacteria | 4260 |
| 507 | Ga0496126_0043126 | 3300048929 | Bacteria | 4163 |
| 508 | Ga0496126_0070279 | 3300048929 | Bacteria | 3119 |
| 509 | Ga0496126_0178098 | 3300048929 | Bacteria | 1807 |
| 510 | Ga0496126_0243038 | 3300048929 | Bacteria | 1503 |
| 511 | Ga0496126_0245620 | 3300048929 | Bacteria | 1493 |
| 512 | Ga0495678_000354 | 3300049459 | Bacteria | 47217 |
| 513 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 514 | nmdc:mga00v17_14820_c1 | 3300050491 | Bacteria | 1399 |
| 515 | nmdc:mga00v17_51052_c1 | 3300050491 | Bacteria | 2515 |
| 516 | nmdc:mga00v17_5333_c1 | 3300050491 | Bacteria | 6771 |
| 517 | nmdc:mga0yw44_23173_c1 | 3300050492 | Bacteria | 3494 |
| 518 | nmdc:mga0sz30_22044_c1 | 3300050516 | Bacteria | 2582 |
| 519 | Ga0500618_000768 | 3300053125 | Bacteria | 18139 |
| 520 | Ga0500621_000003 | 3300053126 | Bacteria | 596975 |
| 521 | Ga0500622_0002521 | 3300053156 | Bacteria | 13153 |
| 522 | 2506578273 | 2506520007 | Bacteria | 5442880 |
| 523 | 2506583411 | 2506520008 | Bacteria | 5443009 |
| 524 | 2508852282 | 2508501071 | Bacteria | 5454741 |
| 525 | 2511382792 | 2511231025 | Bacteria | 5324661 |
| 526 | 2511437669 | 2511231035 | Bacteria | 5341610 |
| 527 | 2547695225 | 2547132181 | Bacteria | 4945084 |
| 528 | 2555257568 | 2554235234 | Bacteria | 5762085 |
| 529 | 2562462912 | 2561511199 | Bacteria | 5155034 |
| 530 | 2578456973 | 2576861471 | Bacteria | 4648976 |
| 531 | 2585829638 | 2585427591 | Bacteria | 5482980 |
| 532 | 2585832850 | 2585427592 | Bacteria | 5370892 |
| 533 | 2595088063 | 2593339131 | Bacteria | 5116855 |
| 534 | 2595451380 | 2593339239 | Bacteria | 4124669 |
| 535 | 2599409103 | 2599185169 | Bacteria | 5441380 |
| 536 | 2599925587 | 2599185299 | Bacteria | 4854625 |
| 537 | 2601522390 | 2600255254 | Bacteria | 5281859 |
| 538 | 2601527416 | 2600255255 | Bacteria | 5282785 |
| 539 | 2601532429 | 2600255256 | Bacteria | 5597742 |
| 540 | 2601537799 | 2600255257 | Bacteria | 5597196 |
| 541 | 2601614246 | 2600255280 | Bacteria | 5292309 |
| 542 | 2601618968 | 2600255281 | Bacteria | 5288753 |
| 543 | 2601642428 | 2600255287 | Bacteria | 5210468 |
| 544 | 2601647275 | 2600255288 | Bacteria | 5282738 |
| 545 | 2601652394 | 2600255289 | Bacteria | 5281907 |
| 546 | 2601657721 | 2600255290 | Bacteria | 5282218 |
| 547 | 2601662249 | 2600255291 | Bacteria | 5217298 |
| 548 | 2601695206 | 2600255298 | Bacteria | 5215185 |
| 549 | 2601699881 | 2600255299 | Bacteria | 5218662 |
| 550 | 2601705518 | 2600255300 | Bacteria | 5287774 |
| 551 | 2601710546 | 2600255301 | Bacteria | 5280532 |
| 552 | 2601715559 | 2600255302 | Bacteria | 5288235 |
| 553 | 2601720233 | 2600255303 | Bacteria | 5219315 |
| 554 | 2601725964 | 2600255304 | Bacteria | 5283973 |
| 555 | 2601730507 | 2600255305 | Bacteria | 5282329 |
| 556 | 2601735523 | 2600255306 | Bacteria | 5281613 |
| 557 | 2601740221 | 2600255307 | Bacteria | 5439064 |
| 558 | 2601750710 | 2600255309 | Bacteria | 5431045 |
| 559 | 2601756545 | 2600255310 | Bacteria | 5600903 |
| 560 | 2601762974 | 2600255311 | Bacteria | 5598766 |
| 561 | 2602017963 | 2600255392 | Bacteria | 5437392 |
| 562 | 2603638129 | 2602042046 | Bacteria | 5483348 |
| 563 | 2603642626 | 2602042047 | Bacteria | 4697674 |
| 564 | 2603659617 | 2602042052 | Bacteria | 5215873 |
| 565 | 2603664893 | 2602042053 | Bacteria | 5214361 |
| 566 | 2603698333 | 2602042066 | Bacteria | 4423871 |
| 567 | 2603703217 | 2602042067 | Bacteria | 4863713 |
| 568 | 2603837896 | 2602042103 | Bacteria | 5284714 |
| 569 | 2603842973 | 2602042104 | Bacteria | 5281639 |
| 570 | 2603848047 | 2602042105 | Bacteria | 5282303 |
| 571 | 2603853118 | 2602042106 | Bacteria | 5282744 |
| 572 | 2603871172 | 2602042110 | Bacteria | 5283285 |
| 573 | 2603876086 | 2602042111 | Bacteria | 5212080 |
| 574 | 2606048365 | 2603880178 | Bacteria | 5283018 |
| 575 | 2606069320 | 2603880184 | Bacteria | 5217896 |
| 576 | 2606145129 | 2603880202 | Bacteria | 5284684 |
| 577 | 2606175767 | 2603880211 | Bacteria | 5284226 |
| 578 | 2608669380 | 2608642108 | Bacteria | 4104624 |
| 579 | 2609913423 | 2609459761 | Bacteria | 5513740 |
| 580 | 2637225006 | 2636415599 | Bacteria | 5718434 |
| 581 | 2644717592 | 2643221731 | Bacteria | 5623886 |
| 582 | 2650898920 | 2648501693 | Bacteria | 5069560 |
| 583 | 2656279022 | 2654587920 | Bacteria | 5475511 |
| 584 | 2671103150 | 2667528172 | Bacteria | 5170840 |
| 585 | 2671109998 | 2667528173 | Bacteria | 5375747 |
| 586 | 2671587576 | 2671180115 | Bacteria | 5353919 |
| 587 | 2676406245 | 2675903046 | Bacteria | 5451247 |
| 588 | 2681997699 | 2681812866 | Bacteria | 4552357 |
| 589 | 2682006774 | 2681812869 | Bacteria | 5014465 |
| 590 | 2686353304 | 2684622997 | Bacteria | 4624240 |
| 591 | 2689444824 | 2687453601 | Bacteria | 5546041 |
| 592 | 2712470029 | 2711768156 | Bacteria | 4471618 |
| 593 | 2739268085 | 2738543017 | Bacteria | 4271950 |
| 594 | 2753855776 | 2751185917 | Bacteria | 4551186 |
| 595 | 2757566058 | 2757320391 | Bacteria | 4746095 |
| 596 | 2765588773 | 2765235842 | Bacteria | 4799256 |
| 597 | 2777023339 | 2775507074 | Bacteria | 5532402 |
| 598 | 2777762193 | 2775507177 | Bacteria | 4384303 |
| 599 | 2777836767 | 2775507192 | Bacteria | 4622234 |
| 600 | 2791922425 | 2791354903 | Bacteria | 4937680 |
| 601 | 2792314764 | 2791355010 | Bacteria | 4864581 |
| 602 | 2793405702 | 2791355275 | Bacteria | 4429597 |
| 603 | 2807179521 | 2806310673 | Bacteria | 4801221 |
| 604 | 2813729107 | 2811995292 | Bacteria | 5303342 |
| 605 | 2814696672 | 2814123068 | Bacteria | 5687681 |
| 606 | 2817481686 | 2816332295 | Bacteria | 4352468 |
| 607 | 2819566568 | 2818991440 | Bacteria | 4774720 |
| 608 | 2819706670 | 2818991465 | Bacteria | 5388835 |
| 609 | 2821119583 | 2821118458 | Bacteria | 4714306 |
| 610 | 2823374564 | 2823373977 | Bacteria | 4779415 |
| 611 | 2842882942 | 2842882022 | Bacteria | 6158489 |
| 612 | 2844427330 | 2844425489 | Bacteria | 4854065 |
| 613 | 2844530831 | 2844528606 | Bacteria | 4733806 |
| 614 | 2846545135 | 2846540461 | Bacteria | 5471451 |
| 615 | 2847087744 | 2847085930 | Bacteria | 5070450 |
| 616 | 2847799916 | 2847797336 | Bacteria | 5176640 |
| 617 | 2852104838 | 2852103415 | Bacteria | 5193810 |
| 618 | 2852652125 | 2852649853 | Bacteria | 4036942 |
| 619 | 2857446855 | 2857442823 | Bacteria | 4562550 |
| 620 | 2857587023 | 2857586860 | Bacteria | 4354574 |
| 621 | 2865015203 | 2865014394 | Bacteria | 4764573 |
| 622 | 2869554231 | 2869551831 | Bacteria | 5474685 |
| 623 | 2876604334 | 2876601092 | Bacteria | 5114497 |
| 624 | 2881612593 | 2881609920 | Bacteria | 4405319 |
| 625 | 2884088965 | 2884086401 | Bacteria | 5005459 |
| 626 | 2888378071 | 2888373701 | Bacteria | 5098052 |
| 627 | 2891670989 | 2891670763 | Bacteria | 4967099 |
| 628 | 2904467224 | 2904463128 | Bacteria | 4775606 |
| 629 | 2904477170 | 2904474040 | Bacteria | 5504324 |
| 630 | 2904508608 | 2904504865 | Bacteria | 5152820 |
| 631 | 2904514107 | 2904513164 | Bacteria | 5476410 |
| 632 | 2908669943 | 2908669403 | Bacteria | 5740494 |
| 633 | 2919108765 | 2919108558 | Bacteria | 5897419 |
| 634 | 2919145025 | 2919143609 | Bacteria | 6219228 |
| 635 | 2919153337 | 2919150387 | Bacteria | 5500879 |
| 636 | 2919404459 | 2919404418 | Bacteria | 4232372 |
| 637 | 2919520203 | 2919517244 | Bacteria | 5858162 |
| 638 | 2919721336 | 2919720352 | Bacteria | 5986006 |
| 639 | 2923634650 | 2923634449 | Bacteria | 4753480 |
| 640 | 2927143963 | 2927143783 | Bacteria | 5504251 |
| 641 | 2927834300 | 2927833300 | Bacteria | 4923934 |
| 642 | 2928094915 | 2928093941 | Bacteria | 5965005 |
| 643 | 2932408128 | 2932406140 | Bacteria | 5134491 |
| 644 | 2935626847 | 2935625433 | Bacteria | 5042964 |
| 645 | 2936341909 | 2936340661 | Bacteria | 5139038 |
| 646 | 2936365945 | 2936361878 | Bacteria | 5632809 |
| 647 | 2937540360 | 2937539931 | Bacteria | 4639830 |
| 648 | 2937967477 | 2937967321 | Bacteria | 5094075 |
| 649 | 2939568990 | 2939568625 | Bacteria | 4542555 |
| 650 | 2939573722 | 2939573065 | Bacteria | 4926053 |
| 651 | 2939578585 | 2939577877 | Bacteria | 5132791 |
| 652 | 2939589834 | 2939589442 | Bacteria | 4214238 |
| 653 | 2939603405 | 2939602548 | Bacteria | 4950493 |
| 654 | 2939607634 | 2939607340 | Bacteria | 4719256 |
| 655 | 2939619410 | 2939617950 | Bacteria | 4820956 |
| 656 | 2939624947 | 2939622612 | Bacteria | 4698046 |
| 657 | 2939643962 | 2939642701 | Bacteria | 4475280 |
| 658 | 2941478748 | 2941475908 | Bacteria | 4145589 |
| 659 | 2945877521 | 2945874760 | Bacteria | 5527237 |
| 660 | 2945953047 | 2945951305 | Bacteria | 4918162 |
| 661 | 2956900537 | 2956897341 | Bacteria | 5447711 |
| 662 | 2960320824 | 2960319331 | Bacteria | 5502575 |
| 663 | 2960376579 | 2960375949 | Bacteria | 5361395 |
| 664 | 2969081996 | 2969079654 | Bacteria | 5439582 |
| 665 | 2971823335 | 2971820967 | Bacteria | 5823634 |
| 666 | 2974307621 | 2974307012 | Bacteria | 4172388 |
| 667 | 2974312304 | 2974310843 | Bacteria | 4947816 |
| 668 | 2974438288 | 2974435778 | Bacteria | 4876478 |
| 669 | 2977248332 | 2977247770 | Bacteria | 4160543 |
| 670 | 2978975567 | 2978975091 | Bacteria | 4704313 |
| 671 | 2984496591 | 2984494565 | Bacteria | 5000175 |
| 672 | 2984517175 | 2984514374 | Bacteria | 4172479 |
| 673 | 2984564430 | 2984559226 | Bacteria | 5683096 |
| 674 | 2984597162 | 2984595703 | Bacteria | 5682994 |
| 675 | 2990262010 | 2990261002 | Bacteria | 4919493 |
| 676 | 3000378791 | 3000376612 | Bacteria | 4705565 |
| 677 | 3006862117 | 3006858327 | Bacteria | 4317835 |
| 678 | 640937788 | 640753048 | Bacteria | 5495657 |
| 679 | 8004595770 | 8004592986 | Bacteria | 5122074 |
| 680 | 8015398304 | 8015394850 | Bacteria | 5064660 |
| 681 | 8016736018 | 8016733728 | Bacteria | 5274317 |
| 682 | 8018224747 | 8018221730 | Bacteria | 4616064 |
| 683 | 8018408333 | 8018405270 | Bacteria | 4978981 |
| 684 | 8019502763 | 8019499862 | Bacteria | 5169538 |
| 685 | 8019506294 | 8019504834 | Bacteria | 4819156 |
| 686 | 8022894981 | 8022893055 | Bacteria | 5300455 |
| 687 | 8022919623 | 8022914991 | Bacteria | 5584517 |
| 688 | 8054845717 | 8054844752 | Bacteria | 4450330 |
| 689 | 8054853082 | 8054849141 | Bacteria | 5232694 |
| 690 | 8055090957 | 8055087960 | Bacteria | 4784273 |
| 691 | 8055094551 | 8055092621 | Bacteria | 4873875 |
| 692 | 8055099959 | 8055097453 | Bacteria | 4865496 |
| 693 | 8057309383 | 8057304971 | Bacteria | 4649742 |
| 694 | Ga0105244_10000014 | |||
| 695 | SwRhRL2b_contig_2491164 | |||
| 696 | SwRhRL2b_contig_517513 | |||
| 697 | JGI25162J39368_1000009 | |||
| 698 | JGI25163J39215_1000068 | |||
| 699 | JGI25164J39214_1000002 | |||
| 700 | JGI25152J39213_1000258 | |||
| 701 | JGI25151J46595_10002101 | |||
| 702 | JGI25151J46595_10003521 | |||
| 703 | JGI25151J46595_10025714 | |||
| 704 | JGI25153J46596_10002505 | |||
| 705 | rootH2_10040041 | |||
| 706 | rootH2_10144681 | |||
| 707 | rootH1_10021808 | |||
| 708 | Ga0006562J51391_1111623 | |||
| 709 | Ga0055538_1000015 | |||
| 710 | Ga0055539_1000009 | |||
| 711 | Ga0055533_1000012 | |||
| 712 | Ga0055532_1000196 | |||
| 713 | Ga0055525_1000014 | |||
| 714 | Ga0055526_1000298 | |||
| 715 | Ga0055526_1006163 | |||
| 716 | Ga0055537_1001342 | |||
| 717 | Ga0055537_1001615 | |||
| 718 | Ga0055536_1002027 | |||
| 719 | Ga0055536_1002102 | |||
| 720 | Ga0055536_1002172 | |||
| 721 | Ga0055534_1000145 | |||
| 722 | Ga0055528_1002402 | |||
| 723 | Ga0055530_10001996 | |||
| 724 | Ga0055530_10002647 | |||
| 725 | Ga0055531_10002729 | |||
| 726 | Ga0055531_10002839 | |||
| 727 | Ga0055541_1000006 | |||
| 728 | Ga0058692_1000038 | |||
| 729 | Ga0058692_1000101 | |||
| 730 | Ga0058692_1000814 | |||
| 731 | Ga0058692_1001389 | |||
| 732 | Ga0058692_1003329 | |||
| 733 | Ga0058692_1007994 | |||
| 734 | Ga0058692_1007997 | |||
| 735 | Ga0065703_1019619 | |||
| 736 | Ga0065704_10000115 | |||
| 737 | Ga0065704_10000297 | |||
| 738 | Ga0065704_10000854 | |||
| 739 | Ga0065704_10130302 | |||
| 740 | Ga0070677_10025649 | |||
| 741 | Ga0070659_100045840 | |||
| 742 | Ga0070665_100003098 | |||
| 743 | Ga0070665_100178209 | |||
| 744 | Ga0068857_100000773 | |||
| 745 | Ga0075364_10005738 | |||
| 746 | Ga0075364_10023478 | |||
| 747 | Ga0075369_10004726 | |||
| 748 | Ga0075366_10093392 | |||
| 749 | Ga0079104_1000083 | |||
| 750 | Ga0079104_1000218 | |||
| 751 | Ga0079104_1000263 | |||
| 752 | Ga0079104_1000292 | |||
| 753 | Ga0079104_1000716 | |||
| 754 | Ga0079104_1000733 | |||
| 755 | Ga0079104_1002113 | |||
| 756 | Ga0079104_1002597 | |||
| 757 | Ga0105251_10000002 | |||
| 758 | Ga0105251_10000189 | |||
| 759 | Ga0105251_10000304 | |||
| 760 | Ga0105251_10002055 | |||
| 761 | Ga0105251_10006273 | |||
| 762 | Ga0105251_10010712 | |||
| 763 | Ga0105251_10011006 | |||
| 764 | Ga0105251_10012033 | |||
| 765 | Ga0105251_10012464 | |||
| 766 | Ga0105251_10101355 | |||
| 767 | Ga0105244_10000195 | |||
| 768 | Ga0105244_10000411 | |||
| 769 | Ga0105244_10000960 | |||
| 770 | Ga0105244_10002160 | |||
| 771 | Ga0105244_10002374 | |||
| 772 | Ga0105244_10002576 | |||
| 773 | Ga0105244_10002696 | |||
| 774 | Ga0105244_10006949 | |||
| 775 | Ga0105244_10008124 | |||
| 776 | Ga0105244_10016952 | |||
| 777 | Ga0105244_10030995 | |||
| 778 | Ga0105244_10055243 | |||
| 779 | Ga0105250_10000002 | |||
| 780 | Ga0105250_10000113 | |||
| 781 | Ga0105250_10000837 | |||
| 782 | Ga0105250_10001894 | |||
| 783 | Ga0105250_10003290 | |||
| 784 | Ga0105250_10011666 | |||
| 785 | Ga0105250_10015474 | |||
| 786 | Ga0105247_10000129 | |||
| 787 | Ga0105243_10060480 | |||
| 788 | Ga0105241_10000002 | |||
| 789 | Ga0157373_10000405 | |||
| 790 | Ga0157373_10022690 | |||
| 791 | Ga0157373_10024015 | |||
| 792 | Ga0157373_10077177 | |||
| 793 | Ga0157373_10091599 | |||
| 794 | Ga0157373_10103422 | |||
| 795 | Ga0157371_10000008 | |||
| 796 | Ga0157371_10000397 | |||
| 797 | Ga0157371_10002962 | |||
| 798 | Ga0157371_10003325 | |||
| 799 | Ga0157371_10005800 | |||
| 800 | Ga0157371_10009336 | |||
| 801 | Ga0157371_10010131 | |||
| 802 | Ga0157371_10011525 | |||
| 803 | Ga0157371_10048547 | |||
| 804 | Ga0157371_10053873 | |||
| 805 | Ga0157370_10000064 | |||
| 806 | Ga0157370_10000918 | |||
| 807 | Ga0157370_10002375 | |||
| 808 | Ga0157370_10003134 | |||
| 809 | Ga0157370_10043702 | |||
| 810 | Ga0157369_10005175 | |||
| 811 | Ga0157369_10020840 | |||
| 812 | Ga0163162_10072842 | |||
| 813 | Ga0163162_10076831 | |||
| 814 | Ga0157372_10079979 | |||
| 815 | Ga0157372_10224730 | |||
| 816 | Ga0182008_10000076 | |||
| 817 | Ga0182008_10001234 | |||
| 818 | Ga0182008_10001733 | |||
| 819 | Ga0182008_10010929 | |||
| 820 | Ga0182008_10092202 | |||
| 821 | Ga0182006_1000047 | |||
| 822 | Ga0182006_1004480 | |||
| 823 | Ga0182006_1017559 | |||
| 824 | Ga0182007_10000079 | |||
| 825 | Ga0182005_1000166 | |||
| 826 | Ga0183366_1001 | |||
| 827 | Ga0183370_1001 | |||
| 828 | Ga0183369_1001 | |||
| 829 | Ga0183368_1001 | |||
| 830 | Ga0163161_10000001 | |||
| 831 | Ga0163161_10002679 | |||
| 832 | Ga0163161_10030436 | |||
| 833 | Ga0163161_10039512 | |||
| 834 | Ga0213872_10084229 | |||
| 835 | Ga0213876_10000055 | |||
| 836 | Ga0209760_100120 | |||
| 837 | Ga0209784_100001 | |||
| 838 | Ga0209566_100001 | |||
| 839 | Ga0209674_100002 | |||
| 840 | Ga0209147_100088 | |||
| 841 | Ga0209563_100002 | |||
| 842 | Ga0207427_100020 | |||
| 843 | Ga0209437_100001 | |||
| 844 | Ga0209437_100073 | |||
| 845 | Ga0209677_100002 | |||
| 846 | Ga0209129_1000004 | |||
| 847 | Ga0209129_1000025 | |||
| 848 | Ga0209129_1003781 | |||
| 849 | Ga0209233_1002662 | |||
| 850 | Ga0209565_1000060 | |||
| 851 | Ga0209673_1000047 | |||
| 852 | Ga0209673_1041020 | |||
| 853 | Ga0209675_1000007 | |||
| 854 | Ga0209676_1000018 | |||
| 855 | Ga0209676_1000471 | |||
| 856 | Ga0209676_1002858 | |||
| 857 | Ga0209025_1000041 | |||
| 858 | Ga0209025_1000680 | |||
| 859 | Ga0209025_1008260 | |||
| 860 | Ga0209564_1000039 | |||
| 861 | Ga0209564_1000252 | |||
| 862 | Ga0209758_1000210 | |||
| 863 | Ga0209050_1000146 | |||
| 864 | Ga0209050_1000592 | |||
| 865 | Ga0209256_1003699 | |||
| 866 | Ga0209256_1004039 | |||
| 867 | Ga0209051_1001427 | |||
| 868 | Ga0209257_1000035 | |||
| 869 | Ga0209257_1001448 | |||
| 870 | Ga0209257_1006792 | |||
| 871 | Ga0209257_1041757 | |||
| 872 | Ga0207696_1000001 | |||
| 873 | Ga0207696_1000005 | |||
| 874 | Ga0207696_1000086 | |||
| 875 | Ga0207696_1000218 | |||
| 876 | Ga0207696_1000292 | |||
| 877 | Ga0207696_1000398 | |||
| 878 | Ga0207696_1000858 | |||
| 879 | Ga0207696_1002113 | |||
| 880 | Ga0207696_1003125 | |||
| 881 | Ga0207696_1018621 | |||
| 882 | Ga0207655_1000001 | |||
| 883 | Ga0207655_1000009 | |||
| 884 | Ga0207655_1000037 | |||
| 885 | Ga0207655_1000063 | |||
| 886 | Ga0207655_1000069 | |||
| 887 | Ga0207655_1003246 | |||
| 888 | Ga0207655_1003752 | |||
| 889 | Ga0207655_1005519 | |||
| 890 | Ga0207655_1007953 | |||
| 891 | Ga0207655_1008130 | |||
| 892 | Ga0207655_1008944 | |||
| 893 | Ga0207655_1010790 | |||
| 894 | Ga0207655_1026155 | |||
| 895 | Ga0207655_1035201 | |||
| 896 | Ga0207655_1038384 | |||
| 897 | Ga0207655_1040779 | |||
| 898 | Ga0207713_1000001 | |||
| 899 | Ga0207713_1000002 | |||
| 900 | Ga0207713_1000003 | |||
| 901 | Ga0207713_1000008 | |||
| 902 | Ga0207713_1000016 | |||
| 903 | Ga0207713_1000029 | |||
| 904 | Ga0207713_1001124 | |||
| 905 | Ga0207713_1002516 | |||
| 906 | Ga0207713_1009037 | |||
| 907 | Ga0207713_1052423 | |||
| 908 | Ga0207710_10000113 | |||
| 909 | Ga0207654_10000005 | |||
| 910 | Ga0207674_10003836 | |||
| 911 | Ga0209281_1000001 | |||
| 912 | Ga0209281_1000003 | |||
| 913 | Ga0209281_1000006 | |||
| 914 | Ga0209281_1000130 | |||
| 915 | Ga0209281_1000181 | |||
| 916 | Ga0209281_1000287 | |||
| 917 | Ga0209281_1000414 | |||
| 918 | Ga0209281_1000494 | |||
| 919 | Ga0209281_1000638 | |||
| 920 | Ga0209371_1000001 | |||
| 921 | Ga0209371_1000002 | |||
| 922 | Ga0209371_1000041 | |||
| 923 | Ga0209371_1000093 | |||
| 924 | Ga0209371_1000109 | |||
| 925 | Ga0209371_1000124 | |||
| 926 | Ga0209371_1000212 | |||
| 927 | Ga0209371_1001290 | |||
| 928 | Ga0209371_1002149 | |||
| 929 | Ga0209371_1005278 | |||
| 930 | Ga0209371_1006190 | |||
| 931 | Ga0209371_1012305 | |||
| 932 | Ga0209371_1013386 | |||
| 933 | Ga0268266_10151515 | |||
| 934 | Ga0268256_1000001 | |||
| 935 | Ga0268256_1000002 | |||
| 936 | Ga0268256_1000003 | |||
| 937 | Ga0268256_1000081 | |||
| 938 | Ga0268256_1000239 | |||
| 939 | Ga0268256_1001101 | |||
| 940 | Ga0268256_1001624 | |||
| 941 | Ga0268256_1005142 | |||
| 942 | Ga0268256_1006179 | |||
| 943 | Ga0268256_1012218 | |||
| 944 | Ga0268256_1013394 | |||
| 945 | Ga0268256_1014725 | |||
| 946 | Ga0316176_1055173 | |||
| 947 | Ga0316183_1005705 | |||
| 948 | Ga0307414_10103292 | |||
| 949 | Ga0307414_10115032 | |||
| 950 | Ga0307507_10022053 | |||
| 951 | Ga0436365_0971002 | |||
| 952 | Ga0436361_0711746 | |||
| 953 | Ga0439438_000001 | |||
| 954 | Ga0439438_001385 | |||
| 955 | Ga0439438_002283 | |||
| 956 | Ga0439447_001346 | |||
| 957 | Ga0439447_003034 | |||
| 958 | Ga0439466_0000009 | |||
| 959 | Ga0439465_0001740 | |||
| 960 | Ga0439432_003692 | |||
| 961 | Ga0439432_010647 | |||
| 962 | Ga0439432_015604 | |||
| 963 | Ga0439449_0067527 | |||
| 964 | Ga0439452_000001 | |||
| 965 | Ga0439452_000002 | |||
| 966 | Ga0439452_000028 | |||
| 967 | Ga0439452_000493 | |||
| 968 | Ga0450907_002039 | |||
| 969 | Ga0439464_0018530 | |||
| 970 | Ga0466981_0000002 | |||
| 971 | Ga0495617_006481 | |||
| 972 | Ga0495627_000116 | |||
| 973 | Ga0495627_003294 | |||
| 974 | Ga0495627_038569 | |||
| 975 | Ga0495591_000013 | |||
| 976 | Ga0495591_000100 | |||
| 977 | Ga0495591_000763 | |||
| 978 | Ga0495591_001170 | |||
| 979 | Ga0495638_0000526 | |||
| 980 | Ga0495638_0001608 | |||
| 981 | Ga0495638_0019714 | |||
| 982 | Ga0495650_0000043 | |||
| 983 | Ga0495650_0000204 | |||
| 984 | Ga0495650_0012129 | |||
| 985 | Ga0495605_0039397 | |||
| 986 | Ga0495607_0038746 | |||
| 987 | Ga0495606_0002305 | |||
| 988 | Ga0495610_0004372 | |||
| 989 | Ga0495620_0027564 | |||
| 990 | Ga0495631_0002447 | |||
| 991 | Ga0495643_0001815 | |||
| 992 | Ga0495644_0006198 | |||
| 993 | Ga0495648_0014018 | |||
| 994 | Ga0495654_0000041 | |||
| 995 | Ga0495654_0000149 | |||
| 996 | Ga0495654_0000167 | |||
| 997 | Ga0495597_0000396 | |||
| 998 | Ga0495633_0005215 | |||
| 999 | Ga0495633_0043870 | |||
| 1000 | Ga0495668_0012121 | |||
| 1001 | Ga0495625_0013061 | |||
| 1002 | Ga0495625_0061379 | |||
| 1003 | Ga0495649_0001040 | |||
| 1004 | Ga0495649_0003204 | |||
| 1005 | Ga0495649_0137113 | |||
| 1006 | Ga0495589_0000001 | |||
| 1007 | Ga0495589_0019855 | |||
| 1008 | Ga0495660_0000012 | |||
| 1009 | Ga0495660_0000048 | |||
| 1010 | Ga0495660_0007665 | |||
| 1011 | Ga0495660_0042475 | |||
| 1012 | Ga0495672_0000002 | |||
| 1013 | Ga0495672_0000034 | |||
| 1014 | Ga0495672_0000043 | |||
| 1015 | Ga0495672_0000087 | |||
| 1016 | Ga0495672_0048070 | |||
| 1017 | Ga0495683_0013394 | |||
| 1018 | Ga0495679_000005 | |||
| 1019 | Ga0495679_001854 | |||
| 1020 | Ga0495679_029594 | |||
| 1021 | Ga0495673_0000070 | |||
| 1022 | Ga0495673_0000167 | |||
| 1023 | Ga0495681_0014421 | |||
| 1024 | Ga0495686_0015934 | |||
| 1025 | Ga0496100_0002684 | |||
| 1026 | Ga0496100_0023957 | |||
| 1027 | Ga0496101_0000055 | |||
| 1028 | Ga0496102_0005316 | |||
| 1029 | Ga0496102_0006086 | |||
| 1030 | Ga0496102_0017820 | |||
| 1031 | Ga0496102_0068372 | |||
| 1032 | Ga0496103_0003104 | |||
| 1033 | Ga0496103_0049310 | |||
| 1034 | Ga0496103_0058195 | |||
| 1035 | Ga0496104_0000091 | |||
| 1036 | Ga0496104_0000233 | |||
| 1037 | Ga0496104_0013159 | |||
| 1038 | Ga0496104_0028267 | |||
| 1039 | Ga0496104_0316953 | |||
| 1040 | Ga0496105_0001055 | |||
| 1041 | Ga0496105_0005125 | |||
| 1042 | Ga0496105_0222983 | |||
| 1043 | Ga0496106_0008226 | |||
| 1044 | Ga0496108_0002755 | |||
| 1045 | Ga0496109_0000702 | |||
| 1046 | Ga0496110_0003465 | |||
| 1047 | Ga0496111_0003764 | |||
| 1048 | Ga0496111_0267856 | |||
| 1049 | Ga0496113_0113586 | |||
| 1050 | Ga0496116_0000001 | |||
| 1051 | Ga0496116_0000066 | |||
| 1052 | Ga0496116_0000206 | |||
| 1053 | Ga0496116_0000305 | |||
| 1054 | Ga0496116_0004122 | |||
| 1055 | Ga0496116_0013614 | |||
| 1056 | Ga0496116_0014949 | |||
| 1057 | Ga0496116_0017930 | |||
| 1058 | Ga0496116_0028791 | |||
| 1059 | Ga0496116_0035904 | |||
| 1060 | Ga0496116_0050135 | |||
| 1061 | Ga0496116_0064078 | |||
| 1062 | Ga0496116_0070252 | |||
| 1063 | Ga0496116_0109295 | |||
| 1064 | Ga0496116_0146591 | |||
| 1065 | Ga0496117_0000022 | |||
| 1066 | Ga0496117_0000453 | |||
| 1067 | Ga0496117_0001256 | |||
| 1068 | Ga0496117_0001430 | |||
| 1069 | Ga0496117_0002666 | |||
| 1070 | Ga0496117_0006643 | |||
| 1071 | Ga0496117_0007883 | |||
| 1072 | Ga0496117_0012653 | |||
| 1073 | Ga0496117_0022047 | |||
| 1074 | Ga0496117_0035311 | |||
| 1075 | Ga0496117_0035506 | |||
| 1076 | Ga0496117_0048673 | |||
| 1077 | Ga0496117_0064902 | |||
| 1078 | Ga0496117_0069791 | |||
| 1079 | Ga0496117_0072678 | |||
| 1080 | Ga0496117_0085002 | |||
| 1081 | Ga0496117_0113271 | |||
| 1082 | Ga0496118_0000007 | |||
| 1083 | Ga0496118_0000085 | |||
| 1084 | Ga0496118_0001349 | |||
| 1085 | Ga0496118_0003009 | |||
| 1086 | Ga0496118_0003137 | |||
| 1087 | Ga0496118_0004321 | |||
| 1088 | Ga0496118_0004655 | |||
| 1089 | Ga0496118_0007889 | |||
| 1090 | Ga0496118_0016755 | |||
| 1091 | Ga0496118_0018892 | |||
| 1092 | Ga0496118_0040387 | |||
| 1093 | Ga0496118_0045195 | |||
| 1094 | Ga0496118_0051892 | |||
| 1095 | Ga0496118_0051893 | |||
| 1096 | Ga0496118_0058708 | |||
| 1097 | Ga0496118_0099123 | |||
| 1098 | Ga0496118_0140126 | |||
| 1099 | Ga0496118_0199964 | |||
| 1100 | Ga0496119_0000001 | |||
| 1101 | Ga0496119_0000039 | |||
| 1102 | Ga0496119_0000711 | |||
| 1103 | Ga0496119_0002980 | |||
| 1104 | Ga0496119_0004522 | |||
| 1105 | Ga0496119_0008290 | |||
| 1106 | Ga0496119_0008327 | |||
| 1107 | Ga0496119_0008708 | |||
| 1108 | Ga0496119_0008859 | |||
| 1109 | Ga0496119_0014781 | |||
| 1110 | Ga0496119_0015119 | |||
| 1111 | Ga0496119_0017417 | |||
| 1112 | Ga0496119_0046818 | |||
| 1113 | Ga0496119_0048263 | |||
| 1114 | Ga0496119_0053464 | |||
| 1115 | Ga0496119_0096360 | |||
| 1116 | Ga0496120_0000002 | |||
| 1117 | Ga0496120_0000016 | |||
| 1118 | Ga0496120_0000464 | |||
| 1119 | Ga0496120_0000727 | |||
| 1120 | Ga0496120_0000807 | |||
| 1121 | Ga0496120_0000952 | |||
| 1122 | Ga0496120_0003772 | |||
| 1123 | Ga0496120_0009525 | |||
| 1124 | Ga0496120_0017051 | |||
| 1125 | Ga0496120_0023887 | |||
| 1126 | Ga0496120_0086998 | |||
| 1127 | Ga0496121_0000022 | |||
| 1128 | Ga0496121_0002456 | |||
| 1129 | Ga0496121_0002791 | |||
| 1130 | Ga0496121_0006576 | |||
| 1131 | Ga0496121_0009657 | |||
| 1132 | Ga0496121_0009703 | |||
| 1133 | Ga0496121_0017575 | |||
| 1134 | Ga0496121_0023766 | |||
| 1135 | Ga0496121_0043735 | |||
| 1136 | Ga0496121_0065701 | |||
| 1137 | Ga0496122_0000005 | |||
| 1138 | Ga0496122_0000110 | |||
| 1139 | Ga0496122_0000545 | |||
| 1140 | Ga0496122_0001733 | |||
| 1141 | Ga0496122_0003163 | |||
| 1142 | Ga0496122_0008583 | |||
| 1143 | Ga0496122_0008629 | |||
| 1144 | Ga0496122_0014529 | |||
| 1145 | Ga0496122_0097007 | |||
| 1146 | Ga0496122_0099645 | |||
| 1147 | Ga0496122_0175095 | |||
| 1148 | Ga0496123_0000008 | |||
| 1149 | Ga0496123_0000081 | |||
| 1150 | Ga0496123_0000189 | |||
| 1151 | Ga0496123_0001180 | |||
| 1152 | Ga0496123_0002658 | |||
| 1153 | Ga0496123_0003165 | |||
| 1154 | Ga0496123_0010892 | |||
| 1155 | Ga0496123_0014589 | |||
| 1156 | Ga0496123_0014855 | |||
| 1157 | Ga0496123_0019758 | |||
| 1158 | Ga0496123_0035013 | |||
| 1159 | Ga0496123_0061252 | |||
| 1160 | Ga0496124_0000066 | |||
| 1161 | Ga0496124_0000196 | |||
| 1162 | Ga0496124_0000199 | |||
| 1163 | Ga0496124_0000425 | |||
| 1164 | Ga0496124_0001064 | |||
| 1165 | Ga0496124_0001552 | |||
| 1166 | Ga0496124_0002919 | |||
| 1167 | Ga0496124_0003834 | |||
| 1168 | Ga0496124_0010267 | |||
| 1169 | Ga0496124_0011009 | |||
| 1170 | Ga0496124_0011330 | |||
| 1171 | Ga0496124_0011522 | |||
| 1172 | Ga0496124_0012022 | |||
| 1173 | Ga0496124_0012744 | |||
| 1174 | Ga0496124_0015837 | |||
| 1175 | Ga0496124_0023951 | |||
| 1176 | Ga0496124_0027671 | |||
| 1177 | Ga0496124_0028916 | |||
| 1178 | Ga0496124_0069628 | |||
| 1179 | Ga0496124_0089185 | |||
| 1180 | Ga0496124_0137496 | |||
| 1181 | Ga0496125_0000009 | |||
| 1182 | Ga0496125_0000033 | |||
| 1183 | Ga0496125_0000722 | |||
| 1184 | Ga0496125_0002253 | |||
| 1185 | Ga0496125_0006899 | |||
| 1186 | Ga0496125_0007926 | |||
| 1187 | Ga0496125_0008967 | |||
| 1188 | Ga0496125_0010929 | |||
| 1189 | Ga0496125_0012428 | |||
| 1190 | Ga0496125_0012532 | |||
| 1191 | Ga0496125_0013105 | |||
| 1192 | Ga0496125_0017697 | |||
| 1193 | Ga0496125_0035604 | |||
| 1194 | Ga0496126_0001084 | |||
| 1195 | Ga0496126_0001269 | |||
| 1196 | Ga0496126_0002176 | |||
| 1197 | Ga0496126_0003861 | |||
| 1198 | Ga0496126_0028173 | |||
| 1199 | Ga0496126_0041444 | |||
| 1200 | Ga0496126_0043126 | |||
| 1201 | Ga0496126_0070279 | |||
| 1202 | Ga0496126_0178098 | |||
| 1203 | Ga0496126_0243038 | |||
| 1204 | Ga0496126_0245620 | |||
| 1205 | Ga0495678_000354 | |||
| 1206 | Ga0495682_0000001 | |||
| 1207 | nmdc:mga00v17_14820_c1 | |||
| 1208 | nmdc:mga00v17_51052_c1 | |||
| 1209 | nmdc:mga00v17_5333_c1 | |||
| 1210 | nmdc:mga0yw44_23173_c1 | |||
| 1211 | nmdc:mga0sz30_22044_c1 | |||
| 1212 | Ga0500618_000768 | |||
| 1213 | Ga0500621_000003 | |||
| 1214 | Ga0500622_0002521 | |||
| 1215 | 2506578273 | |||
| 1216 | 2506583411 | |||
| 1217 | 2508852282 | |||
| 1218 | 2511382792 | |||
| 1219 | 2511437669 | |||
| 1220 | 2547695225 | |||
| 1221 | 2555257568 | |||
| 1222 | 2562462912 | |||
| 1223 | 2578456973 | |||
| 1224 | 2585829638 | |||
| 1225 | 2585832850 | |||
| 1226 | 2595088063 | |||
| 1227 | 2595451380 | |||
| 1228 | 2599409103 | |||
| 1229 | 2599925587 | |||
| 1230 | 2601522390 | |||
| 1231 | 2601527416 | |||
| 1232 | 2601532429 | |||
| 1233 | 2601537799 | |||
| 1234 | 2601614246 | |||
| 1235 | 2601618968 | |||
| 1236 | 2601642428 | |||
| 1237 | 2601647275 | |||
| 1238 | 2601652394 | |||
| 1239 | 2601657721 | |||
| 1240 | 2601662249 | |||
| 1241 | 2601695206 | |||
| 1242 | 2601699881 | |||
| 1243 | 2601705518 | |||
| 1244 | 2601710546 | |||
| 1245 | 2601715559 | |||
| 1246 | 2601720233 | |||
| 1247 | 2601725964 | |||
| 1248 | 2601730507 | |||
| 1249 | 2601735523 | |||
| 1250 | 2601740221 | |||
| 1251 | 2601750710 | |||
| 1252 | 2601756545 | |||
| 1253 | 2601762974 | |||
| 1254 | 2602017963 | |||
| 1255 | 2603638129 | |||
| 1256 | 2603642626 | |||
| 1257 | 2603659617 | |||
| 1258 | 2603664893 | |||
| 1259 | 2603698333 | |||
| 1260 | 2603703217 | |||
| 1261 | 2603837896 | |||
| 1262 | 2603842973 | |||
| 1263 | 2603848047 | |||
| 1264 | 2603853118 | |||
| 1265 | 2603871172 | |||
| 1266 | 2603876086 | |||
| 1267 | 2606048365 | |||
| 1268 | 2606069320 | |||
| 1269 | 2606145129 | |||
| 1270 | 2606175767 | |||
| 1271 | 2608669380 | |||
| 1272 | 2609913423 | |||
| 1273 | 2637225006 | |||
| 1274 | 2644717592 | |||
| 1275 | 2650898920 | |||
| 1276 | 2656279022 | |||
| 1277 | 2671103150 | |||
| 1278 | 2671109998 | |||
| 1279 | 2671587576 | |||
| 1280 | 2676406245 | |||
| 1281 | 2681997699 | |||
| 1282 | 2682006774 | |||
| 1283 | 2686353304 | |||
| 1284 | 2689444824 | |||
| 1285 | 2712470029 | |||
| 1286 | 2739268085 | |||
| 1287 | 2753855776 | |||
| 1288 | 2757566058 | |||
| 1289 | 2765588773 | |||
| 1290 | 2777023339 | |||
| 1291 | 2777762193 | |||
| 1292 | 2777836767 | |||
| 1293 | 2791922425 | |||
| 1294 | 2792314764 | |||
| 1295 | 2793405702 | |||
| 1296 | 2807179521 | |||
| 1297 | 2813729107 | |||
| 1298 | 2814696672 | |||
| 1299 | 2817481686 | |||
| 1300 | 2819566568 | |||
| 1301 | 2819706670 | |||
| 1302 | 2821119583 | |||
| 1303 | 2823374564 | |||
| 1304 | 2842882942 | |||
| 1305 | 2844427330 | |||
| 1306 | 2844530831 | |||
| 1307 | 2846545135 | |||
| 1308 | 2847087744 | |||
| 1309 | 2847799916 | |||
| 1310 | 2852104838 | |||
| 1311 | 2852652125 | |||
| 1312 | 2857446855 | |||
| 1313 | 2857587023 | |||
| 1314 | 2865015203 | |||
| 1315 | 2869554231 | |||
| 1316 | 2876604334 | |||
| 1317 | 2881612593 | |||
| 1318 | 2884088965 | |||
| 1319 | 2888378071 | |||
| 1320 | 2891670989 | |||
| 1321 | 2904467224 | |||
| 1322 | 2904477170 | |||
| 1323 | 2904508608 | |||
| 1324 | 2904514107 | |||
| 1325 | 2908669943 | |||
| 1326 | 2919108765 | |||
| 1327 | 2919145025 | |||
| 1328 | 2919153337 | |||
| 1329 | 2919404459 | |||
| 1330 | 2919520203 | |||
| 1331 | 2919721336 | |||
| 1332 | 2923634650 | |||
| 1333 | 2927143963 | |||
| 1334 | 2927834300 | |||
| 1335 | 2928094915 | |||
| 1336 | 2932408128 | |||
| 1337 | 2935626847 | |||
| 1338 | 2936341909 | |||
| 1339 | 2936365945 | |||
| 1340 | 2937540360 | |||
| 1341 | 2937967477 | |||
| 1342 | 2939568990 | |||
| 1343 | 2939573722 | |||
| 1344 | 2939578585 | |||
| 1345 | 2939589834 | |||
| 1346 | 2939603405 | |||
| 1347 | 2939607634 | |||
| 1348 | 2939619410 | |||
| 1349 | 2939624947 | |||
| 1350 | 2939643962 | |||
| 1351 | 2941478748 | |||
| 1352 | 2945877521 | |||
| 1353 | 2945953047 | |||
| 1354 | 2956900537 | |||
| 1355 | 2960320824 | |||
| 1356 | 2960376579 | |||
| 1357 | 2969081996 | |||
| 1358 | 2971823335 | |||
| 1359 | 2974307621 | |||
| 1360 | 2974312304 | |||
| 1361 | 2974438288 | |||
| 1362 | 2977248332 | |||
| 1363 | 2978975567 | |||
| 1364 | 2984496591 | |||
| 1365 | 2984517175 | |||
| 1366 | 2984564430 | |||
| 1367 | 2984597162 | |||
| 1368 | 2990262010 | |||
| 1369 | 3000378791 | |||
| 1370 | 3006862117 | |||
| 1371 | 640937788 | |||
| 1372 | 8004595770 | |||
| 1373 | 8015398304 | |||
| 1374 | 8016736018 | |||
| 1375 | 8018224747 | |||
| 1376 | 8018408333 | |||
| 1377 | 8019502763 | |||
| 1378 | 8019506294 | |||
| 1379 | 8022894981 | |||
| 1380 | 8022919623 | |||
| 1381 | 8054845717 | |||
| 1382 | 8054853082 | |||
| 1383 | 8055090957 | |||
| 1384 | 8055094551 | |||
| 1385 | 8055099959 | |||
| 1386 | 8057309383 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kux-assembly1.cif.gz_A | structure of the ypo2259 putative oxidoreductase from yersinia pestis | 0.9742 | 8 | 355 |
| 3e82-assembly1.cif.gz_A | crystal structure of a putative oxidoreductase from klebsiella pneumoniae | 0.9718 | 13 | 354 |
| 3e82-assembly2.cif.gz_E | crystal structure of a putative oxidoreductase from klebsiella pneumoniae | 0.9708 | 11 | 354 |
| 3gfg-assembly5.cif.gz_I | structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form | 0.9644 | 13 | 355 |
| 3gfg-assembly5.cif.gz_J | structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form | 0.9638 | 13 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77376_2_121_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9813 | 11 | 130 | 3.90.1150.10 |
| af_P77376_2_121_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9733 | 11 | 130 | 3.90.1150.10 |
| 3kuxA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9723 | 136 | 355 | 3.30.360.10 |
| 3kuxA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9531 | 136 | 355 | 3.30.360.10 |
| 3e82E02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9503 | 136 | 354 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A379WUX7-F1-model_v4 | Putative oxidoreductase (EC 1.-.-.-) | 0.9877 | 10 | 306 |
GO:0000166
GO:0016491 |
| AF-A0A379SYW5-F1-model_v4 | Putative oxidoreductase (EC 1.-.-.-) | 0.9869 | 35 | 261 |
GO:0000166
GO:0016491 |
| AF-A0A377BB82-F1-model_v4 | Oxidoreductase (EC 1.-.-.-) | 0.9852 | 101 | 292 |
GO:0016491
|
| AF-A0A379WUX7-F1-model_v4 | Putative oxidoreductase (EC 1.-.-.-) | 0.9844 | 10 | 306 |
GO:0000166
GO:0016491 |
| AF-A0A357NKC6-F1-model_v4 | deleted | 0.9821 | 148 | 355 |
|