F475668

General Info

Members Datasets Scaffolds Average Seq Length
693 203 1386 247

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0056198|Ga0466963_0056198_882_1697
Length 271
Sequence LTIEIRVDARARAPDAPNKGGIGMSRVLSLLFAIVCYAIFFATFLYLIAFVGDIMVPKTIDAPPSSLAPLPAAAIDVALIALFGLQHSIMARPGFKRAWTRLISPAIERSIFVLFASIALLILFWFWQPIDMRVWQVSPNARWLSEILWVMFWGGFGIVLVSTFLINHFELFGLQQAWFNLQGRELPAPELREPLFYRWVAHPLYAGFFLAFWATPHMTVGHLLLAIALSIYMLIAIRYEEHDLAGIFGDDYRRYREHVGMLWPRFRRRSA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4.76
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0056198 3300044694 Bacteria 2618
2 JGI24736J21556_1027078 3300001904 Bacteria 889
3 JGI24741J21665_1005952 3300001915 Bacteria 2496
4 JGI24741J21665_1015401 3300001915 Bacteria 1262
5 JGI24740J21852_10010639 3300001979 Bacteria 3533
6 JGI24740J21852_10011240 3300001979 Bacteria 3415
7 JGI24739J22299_10028206 3300001989 Bacteria 1958
8 JGI24739J22299_10031542 3300001989 Bacteria 1830
9 JGI24737J22298_10013867 3300001990 Unclassified 2621
10 JGI24737J22298_10026699 3300001990 Bacteria 1823
11 JGI24737J22298_10077473 3300001990 Bacteria 991
12 JGI24735J21928_10010334 3300002067 Bacteria 2979
13 JGI24735J21928_10021837 3300002067 Bacteria 1952
14 JGI24735J21928_10028930 3300002067 Bacteria 1653
15 JGI24735J21928_10069807 3300002067 Bacteria 1007
16 JGI24744J21845_10000550 3300002077 Bacteria 6750
17 Ga0065715_10361050 3300005293 Bacteria 928
18 Ga0070658_10010002 3300005327 Bacteria 7618
19 Ga0070658_10012293 3300005327 Bacteria 6873
20 Ga0070658_10070206 3300005327 Bacteria 2867
21 Ga0070658_10080963 3300005327 Bacteria 2667
22 Ga0070658_10089528 3300005327 Bacteria 2534
23 Ga0070658_10130345 3300005327 Bacteria 2095
24 Ga0070658_10157115 3300005327 Bacteria 1907
25 Ga0070658_10203398 3300005327 Bacteria 1671
26 Ga0070658_10231805 3300005327 Bacteria 1563
27 Ga0070658_10245839 3300005327 Bacteria 1517
28 Ga0070658_10495075 3300005327 Bacteria 1055
29 Ga0070683_100004410 3300005329 Bacteria 11593
30 Ga0070683_100024152 3300005329 Bacteria 5441
31 Ga0070683_100125212 3300005329 Bacteria 2429
32 Ga0070683_100174155 3300005329 Bacteria 2043
33 Ga0070690_100004711 3300005330 Bacteria 7603
34 Ga0070690_100014947 3300005330 Bacteria 4618
35 Ga0070670_100010428 3300005331 Bacteria 7930
36 Ga0070670_100090737 3300005331 Bacteria 2626
37 Ga0070670_100789609 3300005331 Bacteria 857
38 Ga0070677_10217798 3300005333 Bacteria 931
39 Ga0068869_100064347 3300005334 Bacteria 2697
40 Ga0068869_100156979 3300005334 Bacteria 1768
41 Ga0070666_10000753 3300005335 Bacteria 19635
42 Ga0070666_10014487 3300005335 Bacteria 5022
43 Ga0070666_10015349 3300005335 Bacteria 4884
44 Ga0070680_100000683 3300005336 Bacteria 23493
45 Ga0070680_100002724 3300005336 Bacteria 13103
46 Ga0070680_100030548 3300005336 Bacteria 4328
47 Ga0070680_100088510 3300005336 Bacteria 2561
48 Ga0070680_100102190 3300005336 Bacteria 2380
49 Ga0070680_100468479 3300005336 Bacteria 1076
50 Ga0070682_100021462 3300005337 Bacteria 3811
51 Ga0070682_100074382 3300005337 Unclassified 2182
52 Ga0070682_100134859 3300005337 Bacteria 1676
53 Ga0068868_100015820 3300005338 Bacteria 5588
54 Ga0068868_100025829 3300005338 Bacteria 4471
55 Ga0068868_100076475 3300005338 Bacteria 2676
56 Ga0068868_100172603 3300005338 Bacteria 1790
57 Ga0068868_100771039 3300005338 Bacteria 866
58 Ga0070660_100017677 3300005339 Bacteria 5198
59 Ga0070660_100026442 3300005339 Bacteria 4320
60 Ga0070660_100026526 3300005339 Bacteria 4314
61 Ga0070660_100051584 3300005339 Bacteria 3168
62 Ga0070660_100121414 3300005339 Bacteria 2085
63 Ga0070660_100123766 3300005339 Bacteria 2065
64 Ga0070660_100139168 3300005339 Bacteria 1946
65 Ga0070660_100200870 3300005339 Bacteria 1617
66 Ga0070691_10028952 3300005341 Bacteria 2590
67 Ga0070661_100017688 3300005344 Bacteria 5059
68 Ga0070661_100028711 3300005344 Bacteria 4014
69 Ga0070661_100136456 3300005344 Bacteria 1846
70 Ga0070661_100194531 3300005344 Bacteria 1548
71 Ga0070661_100326998 3300005344 Bacteria 1198
72 Ga0070692_10007183 3300005345 Bacteria 4890
73 Ga0070692_10076955 3300005345 Bacteria 1789
74 Ga0070692_10151236 3300005345 Bacteria 1322
75 Ga0070692_10191333 3300005345 Bacteria 1192
76 Ga0070692_10197524 3300005345 Bacteria 1176
77 Ga0070668_100253873 3300005347 Bacteria 1460
78 Ga0070669_100124771 3300005353 Bacteria 1969
79 Ga0070669_100263121 3300005353 Bacteria 1377
80 Ga0070675_100061581 3300005354 Bacteria 3099
81 Ga0070675_100109026 3300005354 Bacteria 2339
82 Ga0070675_100186770 3300005354 Bacteria 1794
83 Ga0070671_100005658 3300005355 Bacteria 9948
84 Ga0070671_100008324 3300005355 Bacteria 8304
85 Ga0070671_100028479 3300005355 Bacteria 4600
86 Ga0070671_100059547 3300005355 Bacteria 3178
87 Ga0070671_100061989 3300005355 Bacteria 3114
88 Ga0070671_100075750 3300005355 Bacteria 2811
89 Ga0070671_100147609 3300005355 Bacteria 1985
90 Ga0070674_100009008 3300005356 Bacteria 5965
91 Ga0070674_100016218 3300005356 Bacteria 4668
92 Ga0070674_100105223 3300005356 Bacteria 2063
93 Ga0070674_100259599 3300005356 Bacteria 1368
94 Ga0070673_100013891 3300005364 Bacteria 5590
95 Ga0070673_100016122 3300005364 Bacteria 5273
96 Ga0070673_100023632 3300005364 Bacteria 4493
97 Ga0070673_100052110 3300005364 Bacteria 3209
98 Ga0070673_100127015 3300005364 Bacteria 2135
99 Ga0070673_100129701 3300005364 Bacteria 2114
100 Ga0070673_100354990 3300005364 Bacteria 1302
101 Ga0070659_100002531 3300005366 Bacteria 12994
102 Ga0070659_100023365 3300005366 Bacteria 4730
103 Ga0070659_100030921 3300005366 Bacteria 4145
104 Ga0070659_100032659 3300005366 Bacteria 4039
105 Ga0070659_100084394 3300005366 Bacteria 2540
106 Ga0070659_100099415 3300005366 Bacteria 2340
107 Ga0070659_100103667 3300005366 Bacteria 2291
108 Ga0070659_100139330 3300005366 Bacteria 1974
109 Ga0070659_100153824 3300005366 Bacteria 1877
110 Ga0070659_100179363 3300005366 Bacteria 1738
111 Ga0070659_100212652 3300005366 Bacteria 1594
112 Ga0070659_100242839 3300005366 Bacteria 1491
113 Ga0070659_100293063 3300005366 Bacteria 1355
114 Ga0070659_100674401 3300005366 Bacteria 892
115 Ga0070667_100004843 3300005367 Bacteria 11279
116 Ga0070667_100010621 3300005367 Bacteria 7602
117 Ga0070667_100053782 3300005367 Bacteria 3398
118 Ga0070667_100157027 3300005367 Bacteria 2001
119 Ga0070714_100103378 3300005435 Bacteria 2513
120 Ga0070714_100111177 3300005435 Bacteria 2426
121 Ga0070714_100158992 3300005435 Bacteria 2042
122 Ga0070714_100187374 3300005435 Bacteria 1886
123 Ga0070713_100416355 3300005436 Bacteria 1257
124 Ga0070663_100020724 3300005455 Bacteria 4356
125 Ga0070663_100024430 3300005455 Bacteria 4068
126 Ga0070663_100047615 3300005455 Bacteria 3037
127 Ga0070663_100068894 3300005455 Bacteria 2569
128 Ga0070663_100082758 3300005455 Bacteria 2362
129 Ga0070663_100130835 3300005455 Bacteria 1905
130 Ga0070678_100006559 3300005456 Bacteria 6839
131 Ga0070678_100008022 3300005456 Bacteria 6295
132 Ga0070678_100320353 3300005456 Bacteria 1324
133 Ga0070678_100371378 3300005456 Bacteria 1235
134 Ga0070662_100003219 3300005457 Bacteria 10152
135 Ga0070662_100038748 3300005457 Bacteria 3386
136 Ga0070662_100041402 3300005457 Bacteria 3286
137 Ga0070662_100090724 3300005457 Bacteria 2294
138 Ga0070662_100116066 3300005457 Bacteria 2046
139 Ga0070681_10081440 3300005458 Bacteria 3193
140 Ga0070681_10145066 3300005458 Bacteria 2303
141 Ga0070681_10434345 3300005458 Bacteria 1225
142 Ga0070681_10510786 3300005458 Bacteria 1115
143 Ga0068867_100007760 3300005459 Bacteria 7587
144 Ga0068867_100024893 3300005459 Bacteria 4291
145 Ga0068867_100047780 3300005459 Bacteria 3147
146 Ga0068867_100094307 3300005459 Bacteria 2276
147 Ga0070685_10014719 3300005466 Bacteria 4146
148 Ga0070685_10088397 3300005466 Bacteria 1871
149 Ga0070679_100317833 3300005530 Bacteria 1506
150 Ga0070679_100337957 3300005530 Bacteria 1454
151 Ga0070679_100342349 3300005530 Bacteria 1443
152 Ga0070679_100365315 3300005530 Bacteria 1391
153 Ga0070684_100013261 3300005535 Bacteria 6640
154 Ga0070684_100115223 3300005535 Bacteria 2413
155 Ga0070684_100147618 3300005535 Bacteria 2129
156 Ga0070684_100220175 3300005535 Bacteria 1732
157 Ga0068853_100035125 3300005539 Bacteria 4257
158 Ga0068853_100111764 3300005539 Unclassified 2427
159 Ga0068853_100182981 3300005539 Bacteria 1901
160 Ga0068853_100364729 3300005539 Bacteria 1346
161 Ga0070672_100003732 3300005543 Bacteria 9912
162 Ga0070672_100012806 3300005543 Bacteria 5905
163 Ga0070672_100268806 3300005543 Bacteria 1439
164 Ga0070686_100082749 3300005544 Bacteria 2129
165 Ga0070693_100056962 3300005547 Bacteria 2257
166 Ga0070665_100045702 3300005548 Bacteria 4397
167 Ga0070665_100430022 3300005548 Bacteria 1329
168 Ga0068855_100044189 3300005563 Bacteria 5273
169 Ga0068855_100104982 3300005563 Bacteria 3249
170 Ga0068855_100321669 3300005563 Bacteria 1710
171 Ga0068855_100371987 3300005563 Bacteria 1571
172 Ga0068855_100659876 3300005563 Bacteria 1122
173 Ga0070664_100014495 3300005564 Bacteria 6428
174 Ga0070664_100026954 3300005564 Bacteria 4773
175 Ga0070664_100123868 3300005564 Bacteria 2265
176 Ga0070664_100157203 3300005564 Bacteria 2009
177 Ga0070664_100179137 3300005564 Bacteria 1883
178 Ga0070664_100217941 3300005564 Bacteria 1707
179 Ga0070664_100260110 3300005564 Bacteria 1562
180 Ga0070664_100368008 3300005564 Bacteria 1310
181 Ga0068857_100048554 3300005577 Bacteria 3768
182 Ga0068857_100055560 3300005577 Bacteria 3513
183 Ga0068857_100150724 3300005577 Bacteria 2106
184 Ga0068857_100166876 3300005577 Bacteria 2000
185 Ga0068857_100237125 3300005577 Bacteria 1669
186 Ga0068854_100002329 3300005578 Bacteria 11711
187 Ga0068854_100012239 3300005578 Bacteria 5615
188 Ga0068854_100017667 3300005578 Bacteria 4777
189 Ga0068854_100058080 3300005578 Bacteria 2791
190 Ga0068854_100131098 3300005578 Bacteria 1914
191 Ga0068854_100153295 3300005578 Bacteria 1778
192 Ga0068854_100212652 3300005578 Bacteria 1526
193 Ga0068854_100317673 3300005578 Bacteria 1265
194 Ga0068854_100464349 3300005578 Bacteria 1060
195 Ga0068856_100037313 3300005614 Bacteria 4768
196 Ga0068856_100039087 3300005614 Bacteria 4659
197 Ga0068856_100047342 3300005614 Bacteria 4235
198 Ga0068856_100110001 3300005614 Bacteria 2752
199 Ga0068856_100133321 3300005614 Bacteria 2489
200 Ga0068852_100000992 3300005616 Bacteria 18727
201 Ga0068852_100014616 3300005616 Bacteria 6051
202 Ga0068852_100017959 3300005616 Bacteria 5563
203 Ga0068852_100044650 3300005616 Bacteria 3766
204 Ga0068852_100048730 3300005616 Bacteria 3621
205 Ga0068852_100245707 3300005616 Bacteria 1712
206 Ga0068852_100249983 3300005616 Bacteria 1698
207 Ga0068852_100279994 3300005616 Bacteria 1607
208 Ga0068859_100098596 3300005617 Bacteria 2976
209 Ga0068864_100020538 3300005618 Bacteria 5526
210 Ga0068864_100038673 3300005618 Bacteria 4075
211 Ga0068866_10032261 3300005718 Bacteria 2531
212 Ga0068866_10043558 3300005718 Bacteria 2241
213 Ga0068851_10034066 3300005834 Bacteria 2541
214 Ga0068851_10164608 3300005834 Bacteria 1220
215 Ga0068863_100026373 3300005841 Bacteria 5544
216 Ga0068863_100037237 3300005841 Bacteria 4632
217 Ga0068858_100018345 3300005842 Bacteria 6552
218 Ga0068858_100027855 3300005842 Bacteria 5249
219 Ga0068858_100178836 3300005842 Bacteria 2002
220 Ga0068858_100191433 3300005842 Bacteria 1933
221 Ga0068860_100081612 3300005843 Bacteria 3075
222 Ga0097621_100013809 3300006237 Bacteria 6029
223 Ga0097621_100030354 3300006237 Bacteria 4278
224 Ga0097621_100362096 3300006237 Bacteria 1292
225 Ga0097621_100770025 3300006237 Bacteria 890
226 Ga0068871_100019859 3300006358 Bacteria 5136
227 Ga0068871_100073340 3300006358 Bacteria 2821
228 Ga0075434_100000249 3300006871 Bacteria 37720
229 Ga0068865_100067256 3300006881 Bacteria 2530
230 Ga0097620_100098598 3300006931 Bacteria 2976
231 Ga0105240_10079294 3300009093 Bacteria 4041
232 Ga0105240_10096990 3300009093 Bacteria 3592
233 Ga0105240_10122400 3300009093 Bacteria 3131
234 Ga0105240_10126571 3300009093 Bacteria 3070
235 Ga0105240_10254026 3300009093 Bacteria 2031
236 Ga0105245_10013595 3300009098 Bacteria 7091
237 Ga0105245_10044859 3300009098 Bacteria 3946
238 Ga0105245_10254925 3300009098 Bacteria 1706
239 Ga0105245_10501425 3300009098 Bacteria 1230
240 Ga0105243_10051458 3300009148 Bacteria 3258
241 Ga0105241_10070244 3300009174 Bacteria 2717
242 Ga0105241_10226945 3300009174 Bacteria 1573
243 Ga0105241_10399448 3300009174 Bacteria 1205
244 Ga0105242_10022015 3300009176 Bacteria 5009
245 Ga0105242_10709164 3300009176 Bacteria 985
246 Ga0105248_10011642 3300009177 Bacteria 9692
247 Ga0105248_10025655 3300009177 Bacteria 6554
248 Ga0105248_10051957 3300009177 Bacteria 4599
249 Ga0105248_10095943 3300009177 Bacteria 3339
250 Ga0105248_10322128 3300009177 Bacteria 1741
251 Ga0105248_10447874 3300009177 Bacteria 1455
252 Ga0105237_10056171 3300009545 Bacteria 3941
253 Ga0105237_10143831 3300009545 Bacteria 2379
254 Ga0105238_10043379 3300009551 Bacteria 4551
255 Ga0105238_10047590 3300009551 Bacteria 4323
256 Ga0105238_10047987 3300009551 Bacteria 4304
257 Ga0105238_10195702 3300009551 Bacteria 1997
258 Ga0105239_10031979 3300010375 Bacteria 5782
259 Ga0105246_10168820 3300011119 Bacteria 1674
260 Ga0105246_10622320 3300011119 Bacteria 936
261 Ga0157373_10006944 3300013100 Bacteria 8430
262 Ga0157373_10016085 3300013100 Bacteria 5461
263 Ga0157373_10042678 3300013100 Bacteria 3241
264 Ga0157373_10066079 3300013100 Bacteria 2559
265 Ga0157373_10073636 3300013100 Bacteria 2410
266 Ga0157373_10129930 3300013100 Bacteria 1771
267 Ga0157373_10180324 3300013100 Bacteria 1487
268 Ga0157373_10273457 3300013100 Bacteria 1196
269 Ga0157371_10009986 3300013102 Bacteria 7430
270 Ga0157371_10017317 3300013102 Bacteria 5357
271 Ga0157371_10056390 3300013102 Bacteria 2787
272 Ga0157371_10069129 3300013102 Bacteria 2500
273 Ga0157371_10080497 3300013102 Bacteria 2307
274 Ga0157371_10102969 3300013102 Bacteria 2026
275 Ga0157371_10127075 3300013102 Bacteria 1813
276 Ga0157371_10161793 3300013102 Bacteria 1599
277 Ga0157371_10191993 3300013102 Bacteria 1462
278 Ga0157371_10257272 3300013102 Bacteria 1258
279 Ga0157371_10311490 3300013102 Bacteria 1141
280 Ga0157370_10122831 3300013104 Bacteria 2425
281 Ga0157370_10148397 3300013104 Bacteria 2183
282 Ga0157370_10158100 3300013104 Bacteria 2108
283 Ga0157370_10161998 3300013104 Bacteria 2081
284 Ga0157370_10201109 3300013104 Bacteria 1848
285 Ga0157370_10688470 3300013104 Bacteria 933
286 Ga0157369_10062548 3300013105 Bacteria 4010
287 Ga0157369_10092040 3300013105 Bacteria 3236
288 Ga0157369_10221541 3300013105 Bacteria 1980
289 Ga0157369_10240855 3300013105 Bacteria 1889
290 Ga0157369_10522635 3300013105 Bacteria 1228
291 Ga0157374_10011026 3300013296 Bacteria 7805
292 Ga0157374_10051583 3300013296 Bacteria 3828
293 Ga0157374_10070953 3300013296 Bacteria 3283
294 Ga0157374_10173181 3300013296 Bacteria 2106
295 Ga0157378_10038607 3300013297 Bacteria 4233
296 Ga0157378_10069268 3300013297 Bacteria 3164
297 Ga0157378_10387971 3300013297 Bacteria 1373
298 Ga0163162_10008489 3300013306 Bacteria 10023
299 Ga0163162_10053795 3300013306 Bacteria 4046
300 Ga0163162_10481227 3300013306 Bacteria 1373
301 Ga0157372_10008481 3300013307 Bacteria 10908
302 Ga0157372_10092526 3300013307 Bacteria 3440
303 Ga0157372_10129321 3300013307 Bacteria 2904
304 Ga0157372_10162635 3300013307 Bacteria 2580
305 Ga0157372_10194622 3300013307 Bacteria 2349
306 Ga0157372_10609867 3300013307 Bacteria 1272
307 Ga0157372_10891420 3300013307 Bacteria 1032
308 Ga0157375_10009672 3300013308 Bacteria 8477
309 Ga0157375_10079159 3300013308 Bacteria 3321
310 Ga0157375_10125442 3300013308 Bacteria 2681
311 Ga0157375_10722023 3300013308 Bacteria 1149
312 Ga0163163_10003869 3300014325 Bacteria 12754
313 Ga0163163_10017657 3300014325 Bacteria 6661
314 Ga0157377_10023993 3300014745 Bacteria 3239
315 Ga0157377_10097190 3300014745 Bacteria 1748
316 Ga0157379_10017522 3300014968 Bacteria 6304
317 Ga0157376_10023310 3300014969 Bacteria 4842
318 Ga0157376_10145098 3300014969 Bacteria 2134
319 Ga0206353_10060407 3300020082 Bacteria 1127
320 Ga0206353_10496975 3300020082 Bacteria 2497
321 Ga0207697_10012116 3300025315 Bacteria 3628
322 Ga0207697_10051789 3300025315 Bacteria 1697
323 Ga0207697_10059364 3300025315 Unclassified 1590
324 Ga0207697_10079698 3300025315 Bacteria 1379
325 Ga0207656_10008586 3300025321 Bacteria 3765
326 Ga0207656_10033202 3300025321 Bacteria 2148
327 Ga0207682_10064759 3300025893 Bacteria 1537
328 Ga0207682_10171992 3300025893 Bacteria 986
329 Ga0207688_10116128 3300025901 Bacteria 1558
330 Ga0207680_10002819 3300025903 Bacteria 8141
331 Ga0207680_10123373 3300025903 Bacteria 1697
332 Ga0207647_10007320 3300025904 Bacteria 7984
333 Ga0207647_10023562 3300025904 Bacteria 4070
334 Ga0207647_10032914 3300025904 Bacteria 3325
335 Ga0207647_10039292 3300025904 Bacteria 2986
336 Ga0207647_10062277 3300025904 Bacteria 2273
337 Ga0207647_10091309 3300025904 Bacteria 1816
338 Ga0207647_10123794 3300025904 Unclassified 1523
339 Ga0207647_10173446 3300025904 Bacteria 1255
340 Ga0207647_10175312 3300025904 Bacteria 1247
341 Ga0207645_10019263 3300025907 Bacteria 4475
342 Ga0207645_10048966 3300025907 Bacteria 2699
343 Ga0207645_10186465 3300025907 Bacteria 1362
344 Ga0207643_10227947 3300025908 Bacteria 1142
345 Ga0207705_10000030 3300025909 Bacteria 239341
346 Ga0207705_10014792 3300025909 Bacteria 5610
347 Ga0207705_10053709 3300025909 Bacteria 2903
348 Ga0207705_10071502 3300025909 Bacteria 2515
349 Ga0207705_10103080 3300025909 Bacteria 2101
350 Ga0207705_10158479 3300025909 Bacteria 1699
351 Ga0207705_10184883 3300025909 Bacteria 1574
352 Ga0207707_10164391 3300025912 Bacteria 1940
353 Ga0207707_10189917 3300025912 Bacteria 1792
354 Ga0207695_10008696 3300025913 Bacteria 12665
355 Ga0207695_10065597 3300025913 Bacteria 3733
356 Ga0207671_10320936 3300025914 Bacteria 1226
357 Ga0207660_10000438 3300025917 Bacteria 27496
358 Ga0207660_10000522 3300025917 Bacteria 25663
359 Ga0207660_10040305 3300025917 Bacteria 3270
360 Ga0207660_10055818 3300025917 Bacteria 2824
361 Ga0207660_10069032 3300025917 Bacteria 2565
362 Ga0207657_10006672 3300025919 Bacteria 11938
363 Ga0207657_10011457 3300025919 Bacteria 8804
364 Ga0207657_10014835 3300025919 Bacteria 7585
365 Ga0207657_10020788 3300025919 Bacteria 6195
366 Ga0207657_10023453 3300025919 Bacteria 5745
367 Ga0207657_10031434 3300025919 Bacteria 4809
368 Ga0207657_10032552 3300025919 Bacteria 4709
369 Ga0207657_10100863 3300025919 Bacteria 2396
370 Ga0207657_10120334 3300025919 Unclassified 2160
371 Ga0207657_10234284 3300025919 Bacteria 1467
372 Ga0207657_10284744 3300025919 Unclassified 1311
373 Ga0207657_10454192 3300025919 Bacteria 1005
374 Ga0207649_10001000 3300025920 Bacteria 17495
375 Ga0207649_10010472 3300025920 Bacteria 5096
376 Ga0207649_10014726 3300025920 Bacteria 4385
377 Ga0207649_10037336 3300025920 Bacteria 2934
378 Ga0207649_10134267 3300025920 Bacteria 1685
379 Ga0207649_10275994 3300025920 Bacteria 1220
380 Ga0207652_10037733 3300025921 Bacteria 4090
381 Ga0207652_10079314 3300025921 Bacteria 2868
382 Ga0207652_10091999 3300025921 Bacteria 2667
383 Ga0207652_10172448 3300025921 Bacteria 1941
384 Ga0207652_10211101 3300025921 Bacteria 1748
385 Ga0207681_10249655 3300025923 Bacteria 1385
386 Ga0207694_10014383 3300025924 Bacteria 5964
387 Ga0207694_10052961 3300025924 Bacteria 3146
388 Ga0207694_10267142 3300025924 Bacteria 1402
389 Ga0207694_10469002 3300025924 Bacteria 1052
390 Ga0207650_10410401 3300025925 Bacteria 1122
391 Ga0207650_10425561 3300025925 Bacteria 1102
392 Ga0207659_10011691 3300025926 Bacteria 5554
393 Ga0207659_10100135 3300025926 Bacteria 2183
394 Ga0207659_10562210 3300025926 Bacteria 970
395 Ga0207687_10024032 3300025927 Bacteria 4066
396 Ga0207687_10367602 3300025927 Bacteria 1175
397 Ga0207664_10129522 3300025929 Bacteria 2122
398 Ga0207664_10139560 3300025929 Bacteria 2048
399 Ga0207644_10000243 3300025931 Bacteria 37412
400 Ga0207644_10003259 3300025931 Bacteria 10480
401 Ga0207644_10004423 3300025931 Bacteria 9121
402 Ga0207644_10066054 3300025931 Bacteria 2632
403 Ga0207644_10160076 3300025931 Bacteria 1749
404 Ga0207644_10186645 3300025931 Bacteria 1628
405 Ga0207644_10468584 3300025931 Bacteria 1036
406 Ga0207690_10003400 3300025932 Bacteria 9509
407 Ga0207690_10005651 3300025932 Bacteria 7390
408 Ga0207690_10009186 3300025932 Bacteria 5869
409 Ga0207690_10018027 3300025932 Bacteria 4323
410 Ga0207690_10114978 3300025932 Bacteria 1944
411 Ga0207690_10133972 3300025932 Bacteria 1817
412 Ga0207690_10189646 3300025932 Bacteria 1554
413 Ga0207690_10197901 3300025932 Bacteria 1524
414 Ga0207690_10358681 3300025932 Bacteria 1154
415 Ga0207706_10000614 3300025933 Bacteria 37833
416 Ga0207706_10012750 3300025933 Bacteria 7650
417 Ga0207706_10017400 3300025933 Bacteria 6476
418 Ga0207706_10029145 3300025933 Bacteria 4929
419 Ga0207706_10031954 3300025933 Bacteria 4690
420 Ga0207706_10044628 3300025933 Bacteria 3929
421 Ga0207706_10058768 3300025933 Bacteria 3386
422 Ga0207706_10059934 3300025933 Bacteria 3352
423 Ga0207706_10234872 3300025933 Bacteria 1603
424 Ga0207686_10096963 3300025934 Bacteria 1960
425 Ga0207669_10005421 3300025937 Bacteria 5723
426 Ga0207669_10016552 3300025937 Bacteria 3750
427 Ga0207669_10195538 3300025937 Bacteria 1463
428 Ga0207704_10022279 3300025938 Bacteria 3391
429 Ga0207704_10167204 3300025938 Bacteria 1572
430 Ga0207691_10008543 3300025940 Bacteria 9832
431 Ga0207691_10026627 3300025940 Bacteria 5425
432 Ga0207691_10277372 3300025940 Bacteria 1443
433 Ga0207711_10001208 3300025941 Bacteria 24465
434 Ga0207711_10004361 3300025941 Bacteria 12073
435 Ga0207711_10039055 3300025941 Bacteria 4037
436 Ga0207711_10110682 3300025941 Bacteria 2442
437 Ga0207711_10218744 3300025941 Bacteria 1741
438 Ga0207689_10019180 3300025942 Bacteria 5766
439 Ga0207689_10417576 3300025942 Bacteria 1119
440 Ga0207689_10547702 3300025942 Bacteria 972
441 Ga0207661_10213608 3300025944 Bacteria 1701
442 Ga0207661_10488674 3300025944 Bacteria 1124
443 Ga0207679_10069214 3300025945 Bacteria 2655
444 Ga0207679_10106066 3300025945 Bacteria 2208
445 Ga0207679_10108555 3300025945 Bacteria 2185
446 Ga0207679_10128221 3300025945 Bacteria 2031
447 Ga0207679_10208977 3300025945 Bacteria 1635
448 Ga0207679_10233828 3300025945 Bacteria 1553
449 Ga0207679_10852542 3300025945 Bacteria 832
450 Ga0207667_10007585 3300025949 Bacteria 13014
451 Ga0207667_10056324 3300025949 Bacteria 4130
452 Ga0207667_10167647 3300025949 Bacteria 2257
453 Ga0207667_10239442 3300025949 Bacteria 1857
454 Ga0207667_10253451 3300025949 Bacteria 1800
455 Ga0207651_10004605 3300025960 Bacteria 6982
456 Ga0207651_10007284 3300025960 Bacteria 5880
457 Ga0207651_10018623 3300025960 Bacteria 4138
458 Ga0207651_10020708 3300025960 Bacteria 3977
459 Ga0207651_10043587 3300025960 Bacteria 2996
460 Ga0207651_10221539 3300025960 Bacteria 1529
461 Ga0207640_10005014 3300025981 Bacteria 7199
462 Ga0207640_10010452 3300025981 Bacteria 5228
463 Ga0207640_10043563 3300025981 Bacteria 2869
464 Ga0207640_10059719 3300025981 Bacteria 2518
465 Ga0207640_10178042 3300025981 Bacteria 1592
466 Ga0207658_10002850 3300025986 Bacteria 12385
467 Ga0207658_10008745 3300025986 Bacteria 6879
468 Ga0207658_10022779 3300025986 Bacteria 4363
469 Ga0207658_10558145 3300025986 Bacteria 1025
470 Ga0207677_10000529 3300026023 Bacteria 24143
471 Ga0207677_10011520 3300026023 Bacteria 5047
472 Ga0207677_10109180 3300026023 Bacteria 2056
473 Ga0207703_10003391 3300026035 Bacteria 13382
474 Ga0207703_10012417 3300026035 Bacteria 6639
475 Ga0207703_10499086 3300026035 Bacteria 1142
476 Ga0207639_10006339 3300026041 Bacteria 8033
477 Ga0207639_10110332 3300026041 Bacteria 2241
478 Ga0207639_10187095 3300026041 Bacteria 1766
479 Ga0207639_10283602 3300026041 Bacteria 1457
480 Ga0207678_10007662 3300026067 Bacteria 9536
481 Ga0207678_10011032 3300026067 Bacteria 7936
482 Ga0207678_10012837 3300026067 Bacteria 7354
483 Ga0207678_10016026 3300026067 Bacteria 6585
484 Ga0207678_10031229 3300026067 Bacteria 4647
485 Ga0207678_10042935 3300026067 Bacteria 3914
486 Ga0207678_10101379 3300026067 Bacteria 2458
487 Ga0207702_10004609 3300026078 Bacteria 12211
488 Ga0207702_10017653 3300026078 Bacteria 5904
489 Ga0207702_10030325 3300026078 Bacteria 4506
490 Ga0207702_10104553 3300026078 Bacteria 2506
491 Ga0207702_10322584 3300026078 Unclassified 1471
492 Ga0207702_10392627 3300026078 Bacteria 1336
493 Ga0207641_10027657 3300026088 Bacteria 4684
494 Ga0207641_10104078 3300026088 Bacteria 2505
495 Ga0207648_10011459 3300026089 Bacteria 8349
496 Ga0207648_10015863 3300026089 Bacteria 6907
497 Ga0207648_10035351 3300026089 Bacteria 4401
498 Ga0207648_10040779 3300026089 Bacteria 4079
499 Ga0207676_10045412 3300026095 Bacteria 3394
500 Ga0207674_10001687 3300026116 Bacteria 28359
501 Ga0207674_10025523 3300026116 Bacteria 6300
502 Ga0207674_10031516 3300026116 Bacteria 5569
503 Ga0207674_10038234 3300026116 Bacteria 4985
504 Ga0207674_10049173 3300026116 Bacteria 4314
505 Ga0207674_10068656 3300026116 Bacteria 3567
506 Ga0207674_10647790 3300026116 Bacteria 1020
507 Ga0207683_10000846 3300026121 Bacteria 28093
508 Ga0207683_10003293 3300026121 Bacteria 14080
509 Ga0207683_10004238 3300026121 Bacteria 12379
510 Ga0207683_10013463 3300026121 Bacteria 6978
511 Ga0207683_10440000 3300026121 Bacteria 1202
512 Ga0207698_10000739 3300026142 Bacteria 18966
513 Ga0207698_10009108 3300026142 Bacteria 6309
514 Ga0207698_10027136 3300026142 Bacteria 4062
515 Ga0207698_10042442 3300026142 Bacteria 3398
516 Ga0207698_10049263 3300026142 Bacteria 3205
517 Ga0207698_10276171 3300026142 Bacteria 1552
518 Ga0207698_10326628 3300026142 Bacteria 1439
519 Ga0209974_10035446 3300027876 Unclassified 1657
520 Ga0268266_10032066 3300028379 Bacteria 4463
521 Ga0268266_10357130 3300028379 Bacteria 1374
522 Ga0268264_10070538 3300028381 Bacteria 2958
523 Ga0307517_10046543 3300028786 Bacteria 4521
524 Ga0316182_1087467 3300030745 Unclassified 1066
525 Ga0316182_1092649 3300030745 Bacteria 1973
526 Ga0307408_100016656 3300031548 Bacteria 4911
527 Ga0307408_100033445 3300031548 Bacteria 3592
528 Ga0307408_100316316 3300031548 Bacteria 1313
529 Ga0307405_10009331 3300031731 Bacteria 5024
530 Ga0307405_10017649 3300031731 Bacteria 3922
531 Ga0307405_10099537 3300031731 Bacteria 1946
532 Ga0307405_10163476 3300031731 Bacteria 1580
533 Ga0307413_10002633 3300031824 Bacteria 7345
534 Ga0307413_10026191 3300031824 Bacteria 3210
535 Ga0307410_10008532 3300031852 Bacteria 5688
536 Ga0307410_10045089 3300031852 Bacteria 2933
537 Ga0307410_10335885 3300031852 Bacteria 1203
538 Ga0307410_10518455 3300031852 Bacteria 983
539 Ga0307406_10005210 3300031901 Bacteria 7104
540 Ga0307406_10006066 3300031901 Bacteria 6641
541 Ga0307406_10036445 3300031901 Bacteria 3031
542 Ga0307407_10007325 3300031903 Bacteria 4988
543 Ga0307407_10061866 3300031903 Bacteria 2190
544 Ga0307407_10069924 3300031903 Bacteria 2085
545 Ga0307412_10024284 3300031911 Bacteria 3741
546 Ga0307412_10150465 3300031911 Bacteria 1717
547 Ga0307409_100004995 3300031995 Bacteria 7552
548 Ga0307409_100057300 3300031995 Bacteria 3018
549 Ga0307416_100001470 3300032002 Bacteria 12838
550 Ga0307416_100086559 3300032002 Bacteria 2672
551 Ga0307416_100138581 3300032002 Bacteria 2206
552 Ga0307416_100218924 3300032002 Bacteria 1824
553 Ga0307416_100558895 3300032002 Bacteria 1219
554 Ga0307416_100606253 3300032002 Bacteria 1175
555 Ga0307416_100866184 3300032002 Bacteria 1002
556 Ga0307414_10024082 3300032004 Bacteria 3875
557 Ga0307411_10005177 3300032005 Bacteria 6375
558 Ga0307411_10006005 3300032005 Bacteria 6034
559 Ga0307411_10021236 3300032005 Bacteria 3794
560 Ga0307415_100000898 3300032126 Bacteria 13619
561 Ga0307415_100008028 3300032126 Bacteria 5823
562 Ga0307415_100204911 3300032126 Bacteria 1568
563 Ga0373932_0049454 3300035112 Bacteria 1243
564 Ga0373931_0339761 3300035691 Bacteria 937
565 Ga0395899_0007795 3300037312 Bacteria 8256
566 Ga0395899_0068769 3300037312 Bacteria 2595
567 Ga0395899_0105000 3300037312 Bacteria 2036
568 Ga0395899_0167088 3300037312 Bacteria 1551
569 Ga0395899_0179320 3300037312 Bacteria 1488
570 Ga0395899_0246502 3300037312 Bacteria 1227
571 Ga0395900_0039490 3300037418 Bacteria 4863
572 Ga0395900_0044753 3300037418 Bacteria 4560
573 Ga0395900_0046474 3300037418 Bacteria 4470
574 Ga0395900_0046853 3300037418 Bacteria 4451
575 Ga0395900_0054284 3300037418 Bacteria 4125
576 Ga0395900_0057224 3300037418 Bacteria 4013
577 Ga0395900_0076977 3300037418 Bacteria 3427
578 Ga0395900_0088680 3300037418 Bacteria 3180
579 Ga0395900_0102787 3300037418 Bacteria 2935
580 Ga0395900_0114450 3300037418 Bacteria 2768
581 Ga0395900_0205261 3300037418 Bacteria 1992
582 Ga0395900_0218827 3300037418 Bacteria 1920
583 Ga0395900_0225118 3300037418 Bacteria 1889
584 Ga0395900_0255616 3300037418 Bacteria 1751
585 Ga0395900_0336332 3300037418 Bacteria 1486
586 Ga0395900_0413624 3300037418 Bacteria 1310
587 Ga0395900_0466753 3300037418 Bacteria 1216
588 Ga0395900_0640887 3300037418 Bacteria 1000
589 Ga0395900_0741115 3300037418 Bacteria 913
590 Ga0395898_0037311 3300037466 Bacteria 4822
591 Ga0395898_0138450 3300037466 Bacteria 2330
592 Ga0395898_0152257 3300037466 Bacteria 2212
593 Ga0395898_0157882 3300037466 Bacteria 2169
594 Ga0395898_0235509 3300037466 Bacteria 1746
595 Ga0395898_0264936 3300037466 Bacteria 1639
596 Ga0395905_0000226 3300037471 Bacteria 85938
597 Ga0395905_0005143 3300037471 Bacteria 13426
598 Ga0395905_0005435 3300037471 Bacteria 13014
599 Ga0395905_0016861 3300037471 Bacteria 6941
600 Ga0395905_0028576 3300037471 Bacteria 5256
601 Ga0395905_0029552 3300037471 Bacteria 5164
602 Ga0395905_0043361 3300037471 Bacteria 4220
603 Ga0395905_0048262 3300037471 Bacteria 3990
604 Ga0395905_0096105 3300037471 Bacteria 2781
605 Ga0395905_0132699 3300037471 Bacteria 2342
606 Ga0395905_0188134 3300037471 Bacteria 1937
607 Ga0395905_0404044 3300037471 Bacteria 1261
608 Ga0395905_0449963 3300037471 Bacteria 1186
609 Ga0395905_0594126 3300037471 Bacteria 1009
610 Ga0395905_0684623 3300037471 Bacteria 928
611 Ga0395901_0000516 3300038443 Bacteria 44694
612 Ga0395901_0019225 3300038443 Bacteria 6983
613 Ga0395901_0036450 3300038443 Bacteria 5084
614 Ga0395901_0063228 3300038443 Bacteria 3852
615 Ga0395901_0083516 3300038443 Bacteria 3338
616 Ga0395901_0131118 3300038443 Bacteria 2634
617 Ga0395901_0420783 3300038443 Bacteria 1370
618 Ga0395901_0530839 3300038443 Bacteria 1194
619 Ga0451791_1947175 3300041451 Bacteria 2460
620 Ga0451797_1305776 3300041453 Bacteria 1381
621 Ga0451807_0169169 3300041486 Bacteria 1174
622 Ga0451853_3172401 3300041512 Bacteria 1810
623 Ga0439442_074015 3300042002 Bacteria 726
624 Ga0439445_0000271 3300042004 Bacteria 10008
625 Ga0466963_0001244 3300044694 Bacteria 13468
626 Ga0466963_0031748 3300044694 Bacteria 3415
627 Ga0466963_0097060 3300044694 Bacteria 2013
628 Ga0466963_0097762 3300044694 Bacteria 2006
629 Ga0466963_0171420 3300044694 Unclassified 1513
630 Ga0466957_0027232 3300044842 Bacteria 3396
631 Ga0466957_0139358 3300044842 Unclassified 1562
632 Ga0466957_0273344 3300044842 Bacteria 1129
633 Ga0466957_0310496 3300044842 Unclassified 1062
634 Ga0466959_0169896 3300045049 Bacteria 1529
635 Ga0466958_0025271 3300045836 Unclassified 3500
636 Ga0466958_0157946 3300045836 Bacteria 1431
637 Ga0466958_0240217 3300045836 Bacteria 1158
638 Ga0466967_0003821 3300045976 Bacteria 9965
639 Ga0466967_0014645 3300045976 Bacteria 6119
640 Ga0466967_0092625 3300045976 Bacteria 2748
641 Ga0466967_0094828 3300045976 Bacteria 2718
642 Ga0466967_0102570 3300045976 Bacteria 2617
643 Ga0466967_0157795 3300045976 Bacteria 2127
644 Ga0495580_0365298 3300046472 Bacteria 976
645 Ga0495616_0001887 3300046513 Bacteria 14157
646 Ga0495663_0049186 3300046525 Bacteria 1301
647 Ga0495598_0007096 3300046537 Bacteria 2556
648 Ga0495621_0014562 3300046539 Bacteria 2491
649 Ga0495633_0024554 3300046558 Bacteria 2977
650 Ga0495669_0007001 3300046684 Bacteria 4721
651 Ga0495669_0025351 3300046684 Bacteria 2586
652 Ga0495669_0029398 3300046684 Bacteria 2409
653 Ga0495670_0026037 3300046691 Bacteria 2895
654 Ga0495670_0047286 3300046691 Bacteria 2150
655 Ga0496100_0000774 3300048903 Bacteria 15222
656 Ga0496100_0012042 3300048903 Bacteria 4945
657 Ga0496101_0000256 3300048904 Bacteria 37912
658 Ga0496101_0009833 3300048904 Bacteria 6301
659 Ga0496102_0095370 3300048905 Bacteria 2757
660 Ga0496103_0006781 3300048906 Bacteria 6833
661 Ga0496103_0175434 3300048906 Bacteria 1377
662 Ga0496104_0028310 3300048907 Bacteria 5194
663 Ga0496105_0041939 3300048908 Bacteria 3772
664 Ga0496106_0053723 3300048909 Bacteria 3043
665 Ga0496106_0076790 3300048909 Bacteria 2561
666 Ga0496106_0092637 3300048909 Bacteria 2334
667 Ga0496107_0001584 3300048910 Bacteria 14147
668 Ga0496107_0008008 3300048910 Bacteria 7293
669 Ga0496108_0000673 3300048911 Bacteria 26408
670 Ga0496108_0004508 3300048911 Bacteria 11220
671 Ga0496109_0005202 3300048912 Bacteria 10866
672 Ga0496109_0022324 3300048912 Bacteria 5604
673 Ga0496110_0001683 3300048913 Bacteria 16224
674 Ga0496110_0026844 3300048913 Bacteria 4931
675 Ga0496111_0000420 3300048914 Bacteria 21379
676 Ga0496111_0034917 3300048914 Bacteria 3591
677 Ga0496112_0061448 3300048915 Bacteria 3703
678 Ga0496112_0349300 3300048915 Unclassified 1421
679 Ga0496112_0417348 3300048915 Bacteria 1281
680 Ga0496113_0000242 3300048916 Bacteria 25756
681 Ga0496114_0000016 3300048917 Bacteria 274656
682 Ga0496114_0032733 3300048917 Bacteria 4281
683 Ga0496114_0170287 3300048917 Bacteria 1897
684 Ga0496115_0069416 3300048918 Bacteria 2854
685 Ga0501068_0149480 3300049584 Bacteria 1467
686 Ga0501070_0105959 3300049586 Bacteria 2324
687 Ga0501074_0186257 3300049590 Unclassified 1480
688 Ga0501209_118276 3300049656 Bacteria 785
689 nmdc:mga0n895_1016_c1 3300050512 Bacteria 20401
690 nmdc:mga0rr50_906_c2 3300050513 Bacteria 4995
691 nmdc:mga08x19_114437_c1 3300050514 Bacteria 1802
692 Ga0500643_000004 3300053087 Bacteria 857484
693 Ga0466962_0164313 3300061719 Bacteria 1080
694 Ga0466963_0056198
695 JGI24736J21556_1027078
696 JGI24741J21665_1005952
697 JGI24741J21665_1015401
698 JGI24740J21852_10010639
699 JGI24740J21852_10011240
700 JGI24739J22299_10028206
701 JGI24739J22299_10031542
702 JGI24737J22298_10013867
703 JGI24737J22298_10026699
704 JGI24737J22298_10077473
705 JGI24735J21928_10010334
706 JGI24735J21928_10021837
707 JGI24735J21928_10028930
708 JGI24735J21928_10069807
709 JGI24744J21845_10000550
710 Ga0065715_10361050
711 Ga0070658_10010002
712 Ga0070658_10012293
713 Ga0070658_10070206
714 Ga0070658_10080963
715 Ga0070658_10089528
716 Ga0070658_10130345
717 Ga0070658_10157115
718 Ga0070658_10203398
719 Ga0070658_10231805
720 Ga0070658_10245839
721 Ga0070658_10495075
722 Ga0070683_100004410
723 Ga0070683_100024152
724 Ga0070683_100125212
725 Ga0070683_100174155
726 Ga0070690_100004711
727 Ga0070690_100014947
728 Ga0070670_100010428
729 Ga0070670_100090737
730 Ga0070670_100789609
731 Ga0070677_10217798
732 Ga0068869_100064347
733 Ga0068869_100156979
734 Ga0070666_10000753
735 Ga0070666_10014487
736 Ga0070666_10015349
737 Ga0070680_100000683
738 Ga0070680_100002724
739 Ga0070680_100030548
740 Ga0070680_100088510
741 Ga0070680_100102190
742 Ga0070680_100468479
743 Ga0070682_100021462
744 Ga0070682_100074382
745 Ga0070682_100134859
746 Ga0068868_100015820
747 Ga0068868_100025829
748 Ga0068868_100076475
749 Ga0068868_100172603
750 Ga0068868_100771039
751 Ga0070660_100017677
752 Ga0070660_100026442
753 Ga0070660_100026526
754 Ga0070660_100051584
755 Ga0070660_100121414
756 Ga0070660_100123766
757 Ga0070660_100139168
758 Ga0070660_100200870
759 Ga0070691_10028952
760 Ga0070661_100017688
761 Ga0070661_100028711
762 Ga0070661_100136456
763 Ga0070661_100194531
764 Ga0070661_100326998
765 Ga0070692_10007183
766 Ga0070692_10076955
767 Ga0070692_10151236
768 Ga0070692_10191333
769 Ga0070692_10197524
770 Ga0070668_100253873
771 Ga0070669_100124771
772 Ga0070669_100263121
773 Ga0070675_100061581
774 Ga0070675_100109026
775 Ga0070675_100186770
776 Ga0070671_100005658
777 Ga0070671_100008324
778 Ga0070671_100028479
779 Ga0070671_100059547
780 Ga0070671_100061989
781 Ga0070671_100075750
782 Ga0070671_100147609
783 Ga0070674_100009008
784 Ga0070674_100016218
785 Ga0070674_100105223
786 Ga0070674_100259599
787 Ga0070673_100013891
788 Ga0070673_100016122
789 Ga0070673_100023632
790 Ga0070673_100052110
791 Ga0070673_100127015
792 Ga0070673_100129701
793 Ga0070673_100354990
794 Ga0070659_100002531
795 Ga0070659_100023365
796 Ga0070659_100030921
797 Ga0070659_100032659
798 Ga0070659_100084394
799 Ga0070659_100099415
800 Ga0070659_100103667
801 Ga0070659_100139330
802 Ga0070659_100153824
803 Ga0070659_100179363
804 Ga0070659_100212652
805 Ga0070659_100242839
806 Ga0070659_100293063
807 Ga0070659_100674401
808 Ga0070667_100004843
809 Ga0070667_100010621
810 Ga0070667_100053782
811 Ga0070667_100157027
812 Ga0070714_100103378
813 Ga0070714_100111177
814 Ga0070714_100158992
815 Ga0070714_100187374
816 Ga0070713_100416355
817 Ga0070663_100020724
818 Ga0070663_100024430
819 Ga0070663_100047615
820 Ga0070663_100068894
821 Ga0070663_100082758
822 Ga0070663_100130835
823 Ga0070678_100006559
824 Ga0070678_100008022
825 Ga0070678_100320353
826 Ga0070678_100371378
827 Ga0070662_100003219
828 Ga0070662_100038748
829 Ga0070662_100041402
830 Ga0070662_100090724
831 Ga0070662_100116066
832 Ga0070681_10081440
833 Ga0070681_10145066
834 Ga0070681_10434345
835 Ga0070681_10510786
836 Ga0068867_100007760
837 Ga0068867_100024893
838 Ga0068867_100047780
839 Ga0068867_100094307
840 Ga0070685_10014719
841 Ga0070685_10088397
842 Ga0070679_100317833
843 Ga0070679_100337957
844 Ga0070679_100342349
845 Ga0070679_100365315
846 Ga0070684_100013261
847 Ga0070684_100115223
848 Ga0070684_100147618
849 Ga0070684_100220175
850 Ga0068853_100035125
851 Ga0068853_100111764
852 Ga0068853_100182981
853 Ga0068853_100364729
854 Ga0070672_100003732
855 Ga0070672_100012806
856 Ga0070672_100268806
857 Ga0070686_100082749
858 Ga0070693_100056962
859 Ga0070665_100045702
860 Ga0070665_100430022
861 Ga0068855_100044189
862 Ga0068855_100104982
863 Ga0068855_100321669
864 Ga0068855_100371987
865 Ga0068855_100659876
866 Ga0070664_100014495
867 Ga0070664_100026954
868 Ga0070664_100123868
869 Ga0070664_100157203
870 Ga0070664_100179137
871 Ga0070664_100217941
872 Ga0070664_100260110
873 Ga0070664_100368008
874 Ga0068857_100048554
875 Ga0068857_100055560
876 Ga0068857_100150724
877 Ga0068857_100166876
878 Ga0068857_100237125
879 Ga0068854_100002329
880 Ga0068854_100012239
881 Ga0068854_100017667
882 Ga0068854_100058080
883 Ga0068854_100131098
884 Ga0068854_100153295
885 Ga0068854_100212652
886 Ga0068854_100317673
887 Ga0068854_100464349
888 Ga0068856_100037313
889 Ga0068856_100039087
890 Ga0068856_100047342
891 Ga0068856_100110001
892 Ga0068856_100133321
893 Ga0068852_100000992
894 Ga0068852_100014616
895 Ga0068852_100017959
896 Ga0068852_100044650
897 Ga0068852_100048730
898 Ga0068852_100245707
899 Ga0068852_100249983
900 Ga0068852_100279994
901 Ga0068859_100098596
902 Ga0068864_100020538
903 Ga0068864_100038673
904 Ga0068866_10032261
905 Ga0068866_10043558
906 Ga0068851_10034066
907 Ga0068851_10164608
908 Ga0068863_100026373
909 Ga0068863_100037237
910 Ga0068858_100018345
911 Ga0068858_100027855
912 Ga0068858_100178836
913 Ga0068858_100191433
914 Ga0068860_100081612
915 Ga0097621_100013809
916 Ga0097621_100030354
917 Ga0097621_100362096
918 Ga0097621_100770025
919 Ga0068871_100019859
920 Ga0068871_100073340
921 Ga0075434_100000249
922 Ga0068865_100067256
923 Ga0097620_100098598
924 Ga0105240_10079294
925 Ga0105240_10096990
926 Ga0105240_10122400
927 Ga0105240_10126571
928 Ga0105240_10254026
929 Ga0105245_10013595
930 Ga0105245_10044859
931 Ga0105245_10254925
932 Ga0105245_10501425
933 Ga0105243_10051458
934 Ga0105241_10070244
935 Ga0105241_10226945
936 Ga0105241_10399448
937 Ga0105242_10022015
938 Ga0105242_10709164
939 Ga0105248_10011642
940 Ga0105248_10025655
941 Ga0105248_10051957
942 Ga0105248_10095943
943 Ga0105248_10322128
944 Ga0105248_10447874
945 Ga0105237_10056171
946 Ga0105237_10143831
947 Ga0105238_10043379
948 Ga0105238_10047590
949 Ga0105238_10047987
950 Ga0105238_10195702
951 Ga0105239_10031979
952 Ga0105246_10168820
953 Ga0105246_10622320
954 Ga0157373_10006944
955 Ga0157373_10016085
956 Ga0157373_10042678
957 Ga0157373_10066079
958 Ga0157373_10073636
959 Ga0157373_10129930
960 Ga0157373_10180324
961 Ga0157373_10273457
962 Ga0157371_10009986
963 Ga0157371_10017317
964 Ga0157371_10056390
965 Ga0157371_10069129
966 Ga0157371_10080497
967 Ga0157371_10102969
968 Ga0157371_10127075
969 Ga0157371_10161793
970 Ga0157371_10191993
971 Ga0157371_10257272
972 Ga0157371_10311490
973 Ga0157370_10122831
974 Ga0157370_10148397
975 Ga0157370_10158100
976 Ga0157370_10161998
977 Ga0157370_10201109
978 Ga0157370_10688470
979 Ga0157369_10062548
980 Ga0157369_10092040
981 Ga0157369_10221541
982 Ga0157369_10240855
983 Ga0157369_10522635
984 Ga0157374_10011026
985 Ga0157374_10051583
986 Ga0157374_10070953
987 Ga0157374_10173181
988 Ga0157378_10038607
989 Ga0157378_10069268
990 Ga0157378_10387971
991 Ga0163162_10008489
992 Ga0163162_10053795
993 Ga0163162_10481227
994 Ga0157372_10008481
995 Ga0157372_10092526
996 Ga0157372_10129321
997 Ga0157372_10162635
998 Ga0157372_10194622
999 Ga0157372_10609867
1000 Ga0157372_10891420
1001 Ga0157375_10009672
1002 Ga0157375_10079159
1003 Ga0157375_10125442
1004 Ga0157375_10722023
1005 Ga0163163_10003869
1006 Ga0163163_10017657
1007 Ga0157377_10023993
1008 Ga0157377_10097190
1009 Ga0157379_10017522
1010 Ga0157376_10023310
1011 Ga0157376_10145098
1012 Ga0206353_10060407
1013 Ga0206353_10496975
1014 Ga0207697_10012116
1015 Ga0207697_10051789
1016 Ga0207697_10059364
1017 Ga0207697_10079698
1018 Ga0207656_10008586
1019 Ga0207656_10033202
1020 Ga0207682_10064759
1021 Ga0207682_10171992
1022 Ga0207688_10116128
1023 Ga0207680_10002819
1024 Ga0207680_10123373
1025 Ga0207647_10007320
1026 Ga0207647_10023562
1027 Ga0207647_10032914
1028 Ga0207647_10039292
1029 Ga0207647_10062277
1030 Ga0207647_10091309
1031 Ga0207647_10123794
1032 Ga0207647_10173446
1033 Ga0207647_10175312
1034 Ga0207645_10019263
1035 Ga0207645_10048966
1036 Ga0207645_10186465
1037 Ga0207643_10227947
1038 Ga0207705_10000030
1039 Ga0207705_10014792
1040 Ga0207705_10053709
1041 Ga0207705_10071502
1042 Ga0207705_10103080
1043 Ga0207705_10158479
1044 Ga0207705_10184883
1045 Ga0207707_10164391
1046 Ga0207707_10189917
1047 Ga0207695_10008696
1048 Ga0207695_10065597
1049 Ga0207671_10320936
1050 Ga0207660_10000438
1051 Ga0207660_10000522
1052 Ga0207660_10040305
1053 Ga0207660_10055818
1054 Ga0207660_10069032
1055 Ga0207657_10006672
1056 Ga0207657_10011457
1057 Ga0207657_10014835
1058 Ga0207657_10020788
1059 Ga0207657_10023453
1060 Ga0207657_10031434
1061 Ga0207657_10032552
1062 Ga0207657_10100863
1063 Ga0207657_10120334
1064 Ga0207657_10234284
1065 Ga0207657_10284744
1066 Ga0207657_10454192
1067 Ga0207649_10001000
1068 Ga0207649_10010472
1069 Ga0207649_10014726
1070 Ga0207649_10037336
1071 Ga0207649_10134267
1072 Ga0207649_10275994
1073 Ga0207652_10037733
1074 Ga0207652_10079314
1075 Ga0207652_10091999
1076 Ga0207652_10172448
1077 Ga0207652_10211101
1078 Ga0207681_10249655
1079 Ga0207694_10014383
1080 Ga0207694_10052961
1081 Ga0207694_10267142
1082 Ga0207694_10469002
1083 Ga0207650_10410401
1084 Ga0207650_10425561
1085 Ga0207659_10011691
1086 Ga0207659_10100135
1087 Ga0207659_10562210
1088 Ga0207687_10024032
1089 Ga0207687_10367602
1090 Ga0207664_10129522
1091 Ga0207664_10139560
1092 Ga0207644_10000243
1093 Ga0207644_10003259
1094 Ga0207644_10004423
1095 Ga0207644_10066054
1096 Ga0207644_10160076
1097 Ga0207644_10186645
1098 Ga0207644_10468584
1099 Ga0207690_10003400
1100 Ga0207690_10005651
1101 Ga0207690_10009186
1102 Ga0207690_10018027
1103 Ga0207690_10114978
1104 Ga0207690_10133972
1105 Ga0207690_10189646
1106 Ga0207690_10197901
1107 Ga0207690_10358681
1108 Ga0207706_10000614
1109 Ga0207706_10012750
1110 Ga0207706_10017400
1111 Ga0207706_10029145
1112 Ga0207706_10031954
1113 Ga0207706_10044628
1114 Ga0207706_10058768
1115 Ga0207706_10059934
1116 Ga0207706_10234872
1117 Ga0207686_10096963
1118 Ga0207669_10005421
1119 Ga0207669_10016552
1120 Ga0207669_10195538
1121 Ga0207704_10022279
1122 Ga0207704_10167204
1123 Ga0207691_10008543
1124 Ga0207691_10026627
1125 Ga0207691_10277372
1126 Ga0207711_10001208
1127 Ga0207711_10004361
1128 Ga0207711_10039055
1129 Ga0207711_10110682
1130 Ga0207711_10218744
1131 Ga0207689_10019180
1132 Ga0207689_10417576
1133 Ga0207689_10547702
1134 Ga0207661_10213608
1135 Ga0207661_10488674
1136 Ga0207679_10069214
1137 Ga0207679_10106066
1138 Ga0207679_10108555
1139 Ga0207679_10128221
1140 Ga0207679_10208977
1141 Ga0207679_10233828
1142 Ga0207679_10852542
1143 Ga0207667_10007585
1144 Ga0207667_10056324
1145 Ga0207667_10167647
1146 Ga0207667_10239442
1147 Ga0207667_10253451
1148 Ga0207651_10004605
1149 Ga0207651_10007284
1150 Ga0207651_10018623
1151 Ga0207651_10020708
1152 Ga0207651_10043587
1153 Ga0207651_10221539
1154 Ga0207640_10005014
1155 Ga0207640_10010452
1156 Ga0207640_10043563
1157 Ga0207640_10059719
1158 Ga0207640_10178042
1159 Ga0207658_10002850
1160 Ga0207658_10008745
1161 Ga0207658_10022779
1162 Ga0207658_10558145
1163 Ga0207677_10000529
1164 Ga0207677_10011520
1165 Ga0207677_10109180
1166 Ga0207703_10003391
1167 Ga0207703_10012417
1168 Ga0207703_10499086
1169 Ga0207639_10006339
1170 Ga0207639_10110332
1171 Ga0207639_10187095
1172 Ga0207639_10283602
1173 Ga0207678_10007662
1174 Ga0207678_10011032
1175 Ga0207678_10012837
1176 Ga0207678_10016026
1177 Ga0207678_10031229
1178 Ga0207678_10042935
1179 Ga0207678_10101379
1180 Ga0207702_10004609
1181 Ga0207702_10017653
1182 Ga0207702_10030325
1183 Ga0207702_10104553
1184 Ga0207702_10322584
1185 Ga0207702_10392627
1186 Ga0207641_10027657
1187 Ga0207641_10104078
1188 Ga0207648_10011459
1189 Ga0207648_10015863
1190 Ga0207648_10035351
1191 Ga0207648_10040779
1192 Ga0207676_10045412
1193 Ga0207674_10001687
1194 Ga0207674_10025523
1195 Ga0207674_10031516
1196 Ga0207674_10038234
1197 Ga0207674_10049173
1198 Ga0207674_10068656
1199 Ga0207674_10647790
1200 Ga0207683_10000846
1201 Ga0207683_10003293
1202 Ga0207683_10004238
1203 Ga0207683_10013463
1204 Ga0207683_10440000
1205 Ga0207698_10000739
1206 Ga0207698_10009108
1207 Ga0207698_10027136
1208 Ga0207698_10042442
1209 Ga0207698_10049263
1210 Ga0207698_10276171
1211 Ga0207698_10326628
1212 Ga0209974_10035446
1213 Ga0268266_10032066
1214 Ga0268266_10357130
1215 Ga0268264_10070538
1216 Ga0307517_10046543
1217 Ga0316182_1087467
1218 Ga0316182_1092649
1219 Ga0307408_100016656
1220 Ga0307408_100033445
1221 Ga0307408_100316316
1222 Ga0307405_10009331
1223 Ga0307405_10017649
1224 Ga0307405_10099537
1225 Ga0307405_10163476
1226 Ga0307413_10002633
1227 Ga0307413_10026191
1228 Ga0307410_10008532
1229 Ga0307410_10045089
1230 Ga0307410_10335885
1231 Ga0307410_10518455
1232 Ga0307406_10005210
1233 Ga0307406_10006066
1234 Ga0307406_10036445
1235 Ga0307407_10007325
1236 Ga0307407_10061866
1237 Ga0307407_10069924
1238 Ga0307412_10024284
1239 Ga0307412_10150465
1240 Ga0307409_100004995
1241 Ga0307409_100057300
1242 Ga0307416_100001470
1243 Ga0307416_100086559
1244 Ga0307416_100138581
1245 Ga0307416_100218924
1246 Ga0307416_100558895
1247 Ga0307416_100606253
1248 Ga0307416_100866184
1249 Ga0307414_10024082
1250 Ga0307411_10005177
1251 Ga0307411_10006005
1252 Ga0307411_10021236
1253 Ga0307415_100000898
1254 Ga0307415_100008028
1255 Ga0307415_100204911
1256 Ga0373932_0049454
1257 Ga0373931_0339761
1258 Ga0395899_0007795
1259 Ga0395899_0068769
1260 Ga0395899_0105000
1261 Ga0395899_0167088
1262 Ga0395899_0179320
1263 Ga0395899_0246502
1264 Ga0395900_0039490
1265 Ga0395900_0044753
1266 Ga0395900_0046474
1267 Ga0395900_0046853
1268 Ga0395900_0054284
1269 Ga0395900_0057224
1270 Ga0395900_0076977
1271 Ga0395900_0088680
1272 Ga0395900_0102787
1273 Ga0395900_0114450
1274 Ga0395900_0205261
1275 Ga0395900_0218827
1276 Ga0395900_0225118
1277 Ga0395900_0255616
1278 Ga0395900_0336332
1279 Ga0395900_0413624
1280 Ga0395900_0466753
1281 Ga0395900_0640887
1282 Ga0395900_0741115
1283 Ga0395898_0037311
1284 Ga0395898_0138450
1285 Ga0395898_0152257
1286 Ga0395898_0157882
1287 Ga0395898_0235509
1288 Ga0395898_0264936
1289 Ga0395905_0000226
1290 Ga0395905_0005143
1291 Ga0395905_0005435
1292 Ga0395905_0016861
1293 Ga0395905_0028576
1294 Ga0395905_0029552
1295 Ga0395905_0043361
1296 Ga0395905_0048262
1297 Ga0395905_0096105
1298 Ga0395905_0132699
1299 Ga0395905_0188134
1300 Ga0395905_0404044
1301 Ga0395905_0449963
1302 Ga0395905_0594126
1303 Ga0395905_0684623
1304 Ga0395901_0000516
1305 Ga0395901_0019225
1306 Ga0395901_0036450
1307 Ga0395901_0063228
1308 Ga0395901_0083516
1309 Ga0395901_0131118
1310 Ga0395901_0420783
1311 Ga0395901_0530839
1312 Ga0451791_1947175
1313 Ga0451797_1305776
1314 Ga0451807_0169169
1315 Ga0451853_3172401
1316 Ga0439442_074015
1317 Ga0439445_0000271
1318 Ga0466963_0001244
1319 Ga0466963_0031748
1320 Ga0466963_0097060
1321 Ga0466963_0097762
1322 Ga0466963_0171420
1323 Ga0466957_0027232
1324 Ga0466957_0139358
1325 Ga0466957_0273344
1326 Ga0466957_0310496
1327 Ga0466959_0169896
1328 Ga0466958_0025271
1329 Ga0466958_0157946
1330 Ga0466958_0240217
1331 Ga0466967_0003821
1332 Ga0466967_0014645
1333 Ga0466967_0092625
1334 Ga0466967_0094828
1335 Ga0466967_0102570
1336 Ga0466967_0157795
1337 Ga0495580_0365298
1338 Ga0495616_0001887
1339 Ga0495663_0049186
1340 Ga0495598_0007096
1341 Ga0495621_0014562
1342 Ga0495633_0024554
1343 Ga0495669_0007001
1344 Ga0495669_0025351
1345 Ga0495669_0029398
1346 Ga0495670_0026037
1347 Ga0495670_0047286
1348 Ga0496100_0000774
1349 Ga0496100_0012042
1350 Ga0496101_0000256
1351 Ga0496101_0009833
1352 Ga0496102_0095370
1353 Ga0496103_0006781
1354 Ga0496103_0175434
1355 Ga0496104_0028310
1356 Ga0496105_0041939
1357 Ga0496106_0053723
1358 Ga0496106_0076790
1359 Ga0496106_0092637
1360 Ga0496107_0001584
1361 Ga0496107_0008008
1362 Ga0496108_0000673
1363 Ga0496108_0004508
1364 Ga0496109_0005202
1365 Ga0496109_0022324
1366 Ga0496110_0001683
1367 Ga0496110_0026844
1368 Ga0496111_0000420
1369 Ga0496111_0034917
1370 Ga0496112_0061448
1371 Ga0496112_0349300
1372 Ga0496112_0417348
1373 Ga0496113_0000242
1374 Ga0496114_0000016
1375 Ga0496114_0032733
1376 Ga0496114_0170287
1377 Ga0496115_0069416
1378 Ga0501068_0149480
1379 Ga0501070_0105959
1380 Ga0501074_0186257
1381 Ga0501209_118276
1382 nmdc:mga0n895_1016_c1
1383 nmdc:mga0rr50_906_c2
1384 nmdc:mga08x19_114437_c1
1385 Ga0500643_000004
1386 Ga0466962_0164313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.3863 47 231
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.3673 48 225
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.367 47 231
4das-assembly1.cif.gz_H crystal structure of bullfrog m ferritin 0.3389 33 149
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3299 3 230
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8891 49 231 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.841 49 231 1.20.120.1630
af_Q6MG14_62_250_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7468 50 214 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7415 51 201 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6707 51 201 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A3D4GWQ9-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9613 156 231 GO:0016020
AF-A0A7V4P7Q0-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9382 3 232 GO:0008168
GO:0016020
GO:0032259
AF-A0A838QU31-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9341 1 234 GO:0008168
GO:0016020
GO:0032259
AF-A0A838QU31-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9303 1 234 GO:0008168
GO:0016020
GO:0032259
AF-A0A7W6PUJ7-F1-model_v4 Methanethiol S-methyltransferase 0.9302 49 231 GO:0016020

Map