F475680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 289 | 1386 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0029266|Ga0501075_0029266_1441_2739 |
| Length | 432 |
| Sequence | MSNPRLAIGLDSPEQVGRRASGVNDRGGDIDQDEIAEIDTSRVRAPRRDVRTLHGGLCMSVRGRILITGGAGFIGSHLADELLEHGYAVRALDNLSEQVHGLGAQRPSYLHPDVELVRGDVRDRAAVRAALADVDAVFHFAAMVGVGQSMYEIARYTDVNNLGTAVLLEALAERPVGRLVVASSMSIYGEGLYRDRRGDLAAGVERDREQLKARDWEVRDSDGEPLTPVPTPESKTPTLSSVYALSKYDQERMCLMVGKAYNIPTVALRFFNVYGTRQALSNPYTGVLAIFASRLLNGRPPLIFEDGRQMRDFVHVSDIARACRLALTVPEAAGQVFNIGSGRQATVREIADALADVLDRKDLEPEITGKYRVGDIRHCFADITLARRVLGYEPQMPLARGLLELSSWLADQVADDRVAQGHAELTARGLTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 100 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 160 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 247 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 252 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 263 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 267 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 268 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 284 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 285 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 286 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 287 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 288 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 289 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.22 |
| Metatranscriptomes | 5.92 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 1.15 |
| Rhizosphere | 95.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501075_0029266 | 3300049591 | Bacteria | 4072 |
| 2 | JGI24743J22301_10007917 | 3300001991 | Bacteria | 1854 |
| 3 | Ga0007416J51690_1041533 | 3300003577 | Bacteria | 1467 |
| 4 | Ga0032354_1020727 | 3300003693 | Bacteria | 1443 |
| 5 | Ga0032354_1021065 | 3300003693 | Bacteria | 3577 |
| 6 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 7 | Ga0058863_11748332 | 3300004799 | Bacteria | 3099 |
| 8 | Ga0058862_12292174 | 3300004803 | Bacteria | 4690 |
| 9 | Ga0058862_12842061 | 3300004803 | Bacteria | 2324 |
| 10 | Ga0065714_10073034 | 3300005288 | Bacteria | 3256 |
| 11 | Ga0065712_10003968 | 3300005290 | Bacteria | 8902 |
| 12 | Ga0065715_10001568 | 3300005293 | Bacteria | 9435 |
| 13 | Ga0070658_10000345 | 3300005327 | Bacteria | 40226 |
| 14 | Ga0070658_10000650 | 3300005327 | Bacteria | 30049 |
| 15 | Ga0070658_10002428 | 3300005327 | Bacteria | 15598 |
| 16 | Ga0070658_10010486 | 3300005327 | Bacteria | 7432 |
| 17 | Ga0070658_10045618 | 3300005327 | Bacteria | 3544 |
| 18 | Ga0070658_10046302 | 3300005327 | Bacteria | 3520 |
| 19 | Ga0070658_10145001 | 3300005327 | Bacteria | 1985 |
| 20 | Ga0070658_10150341 | 3300005327 | Bacteria | 1949 |
| 21 | Ga0070658_10348271 | 3300005327 | Unclassified | 1268 |
| 22 | Ga0070676_10048169 | 3300005328 | Bacteria | 2491 |
| 23 | Ga0070683_100003153 | 3300005329 | Bacteria | 13286 |
| 24 | Ga0070683_100039535 | 3300005329 | Bacteria | 4331 |
| 25 | Ga0070683_100070223 | 3300005329 | Bacteria | 3267 |
| 26 | Ga0070683_100083384 | 3300005329 | Bacteria | 2994 |
| 27 | Ga0070683_100204148 | 3300005329 | Bacteria | 1877 |
| 28 | Ga0070690_100046425 | 3300005330 | Bacteria | 2761 |
| 29 | Ga0070670_100001140 | 3300005331 | Bacteria | 21113 |
| 30 | Ga0068869_100003119 | 3300005334 | Bacteria | 10109 |
| 31 | Ga0070666_10017705 | 3300005335 | Bacteria | 4571 |
| 32 | Ga0070666_10052546 | 3300005335 | Bacteria | 2746 |
| 33 | Ga0070666_10071574 | 3300005335 | Bacteria | 2360 |
| 34 | Ga0070680_100000072 | 3300005336 | Bacteria | 53846 |
| 35 | Ga0070680_100006987 | 3300005336 | Bacteria | 8603 |
| 36 | Ga0070680_100007450 | 3300005336 | Bacteria | 8349 |
| 37 | Ga0070680_100300850 | 3300005336 | Bacteria | 1360 |
| 38 | Ga0068868_100000110 | 3300005338 | Bacteria | 51175 |
| 39 | Ga0068868_100122053 | 3300005338 | Bacteria | 2126 |
| 40 | Ga0070660_100014526 | 3300005339 | Bacteria | 5676 |
| 41 | Ga0070660_100032650 | 3300005339 | Bacteria | 3919 |
| 42 | Ga0070660_100033615 | 3300005339 | Bacteria | 3867 |
| 43 | Ga0070660_100174821 | 3300005339 | Unclassified | 1736 |
| 44 | Ga0070689_100016114 | 3300005340 | Bacteria | 5467 |
| 45 | Ga0070689_100016821 | 3300005340 | Bacteria | 5360 |
| 46 | Ga0070661_100003285 | 3300005344 | Bacteria | 11166 |
| 47 | Ga0070661_100013818 | 3300005344 | Bacteria | 5674 |
| 48 | Ga0070661_100035295 | 3300005344 | Bacteria | 3630 |
| 49 | Ga0070661_100042894 | 3300005344 | Bacteria | 3303 |
| 50 | Ga0070661_100050703 | 3300005344 | Bacteria | 3037 |
| 51 | Ga0070661_100061373 | 3300005344 | Bacteria | 2759 |
| 52 | Ga0070661_100186822 | 3300005344 | Bacteria | 1579 |
| 53 | Ga0070668_100067406 | 3300005347 | Bacteria | 2780 |
| 54 | Ga0070675_100008863 | 3300005354 | Bacteria | 7822 |
| 55 | Ga0070671_100001247 | 3300005355 | Bacteria | 19073 |
| 56 | Ga0070671_100012945 | 3300005355 | Bacteria | 6721 |
| 57 | Ga0070671_100017289 | 3300005355 | Bacteria | 5840 |
| 58 | Ga0070671_100094714 | 3300005355 | Bacteria | 2503 |
| 59 | Ga0070673_100004217 | 3300005364 | Bacteria | 9071 |
| 60 | Ga0070688_100001831 | 3300005365 | Bacteria | 10678 |
| 61 | Ga0070659_100037292 | 3300005366 | Bacteria | 3789 |
| 62 | Ga0070659_100093424 | 3300005366 | Bacteria | 2414 |
| 63 | Ga0070659_100145440 | 3300005366 | Bacteria | 1931 |
| 64 | Ga0070667_100000289 | 3300005367 | Bacteria | 56919 |
| 65 | Ga0070667_100035813 | 3300005367 | Bacteria | 4159 |
| 66 | Ga0070667_100201079 | 3300005367 | Bacteria | 1768 |
| 67 | Ga0070714_100085991 | 3300005435 | Bacteria | 2747 |
| 68 | Ga0070714_100134707 | 3300005435 | Bacteria | 2211 |
| 69 | Ga0070713_100096966 | 3300005436 | Bacteria | 2547 |
| 70 | Ga0070710_10028098 | 3300005437 | Bacteria | 3006 |
| 71 | Ga0070710_10066564 | 3300005437 | Bacteria | 2066 |
| 72 | Ga0070701_10153135 | 3300005438 | Bacteria | 1329 |
| 73 | Ga0070711_100074515 | 3300005439 | Bacteria | 2400 |
| 74 | Ga0070711_100227387 | 3300005439 | Bacteria | 1453 |
| 75 | Ga0070700_100154870 | 3300005441 | Bacteria | 1571 |
| 76 | Ga0070663_100185036 | 3300005455 | Bacteria | 1618 |
| 77 | Ga0070678_100094099 | 3300005456 | Bacteria | 2306 |
| 78 | Ga0070662_100163584 | 3300005457 | Unclassified | 1742 |
| 79 | Ga0070681_10001597 | 3300005458 | Bacteria | 20162 |
| 80 | Ga0070681_10048941 | 3300005458 | Bacteria | 4222 |
| 81 | Ga0070681_10090672 | 3300005458 | Bacteria | 3007 |
| 82 | Ga0070681_10090714 | 3300005458 | Bacteria | 3006 |
| 83 | Ga0070681_10109455 | 3300005458 | Bacteria | 2703 |
| 84 | Ga0070685_10003418 | 3300005466 | Bacteria | 8076 |
| 85 | Ga0070679_100000854 | 3300005530 | Bacteria | 26529 |
| 86 | Ga0070679_100002644 | 3300005530 | Bacteria | 16299 |
| 87 | Ga0070679_100104512 | 3300005530 | Bacteria | 2819 |
| 88 | Ga0070679_100139692 | 3300005530 | Bacteria | 2403 |
| 89 | Ga0070679_100204288 | 3300005530 | Bacteria | 1940 |
| 90 | Ga0070684_100000822 | 3300005535 | Bacteria | 21733 |
| 91 | Ga0070684_100063457 | 3300005535 | Bacteria | 3238 |
| 92 | Ga0070684_100077072 | 3300005535 | Bacteria | 2944 |
| 93 | Ga0068853_100000645 | 3300005539 | Bacteria | 23916 |
| 94 | Ga0068853_100021631 | 3300005539 | Bacteria | 5365 |
| 95 | Ga0068853_100049991 | 3300005539 | Bacteria | 3595 |
| 96 | Ga0068853_100054589 | 3300005539 | Bacteria | 3443 |
| 97 | Ga0068853_100080059 | 3300005539 | Bacteria | 2858 |
| 98 | Ga0068853_100342974 | 3300005539 | Bacteria | 1388 |
| 99 | Ga0070672_100133354 | 3300005543 | Unclassified | 2043 |
| 100 | Ga0070672_100176438 | 3300005543 | Bacteria | 1779 |
| 101 | Ga0070686_100025434 | 3300005544 | Bacteria | 3563 |
| 102 | Ga0070665_100000134 | 3300005548 | Bacteria | 139586 |
| 103 | Ga0070665_100024237 | 3300005548 | Bacteria | 6110 |
| 104 | Ga0070665_100108672 | 3300005548 | Bacteria | 2776 |
| 105 | Ga0068855_100003388 | 3300005563 | Bacteria | 19510 |
| 106 | Ga0068855_100003472 | 3300005563 | Bacteria | 19296 |
| 107 | Ga0068855_100004985 | 3300005563 | Bacteria | 16204 |
| 108 | Ga0068855_100005586 | 3300005563 | Bacteria | 15344 |
| 109 | Ga0068855_100017874 | 3300005563 | Bacteria | 8521 |
| 110 | Ga0068855_100022663 | 3300005563 | Bacteria | 7524 |
| 111 | Ga0068855_100026188 | 3300005563 | Bacteria | 6977 |
| 112 | Ga0068855_100032978 | 3300005563 | Bacteria | 6183 |
| 113 | Ga0068855_100037620 | 3300005563 | Bacteria | 5753 |
| 114 | Ga0068855_100045621 | 3300005563 | Bacteria | 5183 |
| 115 | Ga0068855_100058558 | 3300005563 | Bacteria | 4511 |
| 116 | Ga0068855_100072754 | 3300005563 | Bacteria | 3995 |
| 117 | Ga0068855_100175664 | 3300005563 | Bacteria | 2424 |
| 118 | Ga0068855_100291181 | 3300005563 | Bacteria | 1810 |
| 119 | Ga0068857_100002939 | 3300005577 | Bacteria | 14044 |
| 120 | Ga0068857_100003860 | 3300005577 | Bacteria | 12613 |
| 121 | Ga0068857_100007995 | 3300005577 | Bacteria | 9127 |
| 122 | Ga0068854_100007202 | 3300005578 | Bacteria | 7101 |
| 123 | Ga0068854_100027922 | 3300005578 | Bacteria | 3894 |
| 124 | Ga0068856_100002433 | 3300005614 | Bacteria | 19150 |
| 125 | Ga0068856_100011197 | 3300005614 | Bacteria | 8705 |
| 126 | Ga0068856_100023721 | 3300005614 | Bacteria | 5966 |
| 127 | Ga0068856_100049532 | 3300005614 | Bacteria | 4140 |
| 128 | Ga0068856_100059555 | 3300005614 | Bacteria | 3772 |
| 129 | Ga0068856_100115561 | 3300005614 | Bacteria | 2683 |
| 130 | Ga0068856_100150059 | 3300005614 | Bacteria | 2340 |
| 131 | Ga0068852_100000027 | 3300005616 | Bacteria | 113819 |
| 132 | Ga0068852_100001442 | 3300005616 | Bacteria | 16042 |
| 133 | Ga0068852_100029057 | 3300005616 | Unclassified | 4535 |
| 134 | Ga0068852_100060214 | 3300005616 | Bacteria | 3296 |
| 135 | Ga0068859_100003668 | 3300005617 | Bacteria | 15638 |
| 136 | Ga0068864_100001232 | 3300005618 | Bacteria | 21282 |
| 137 | Ga0068851_10006679 | 3300005834 | Bacteria | 5278 |
| 138 | Ga0068851_10017700 | 3300005834 | Bacteria | 3426 |
| 139 | Ga0068851_10024026 | 3300005834 | Bacteria | 2982 |
| 140 | Ga0068851_10043919 | 3300005834 | Bacteria | 2254 |
| 141 | Ga0068863_100002128 | 3300005841 | Bacteria | 19652 |
| 142 | Ga0068863_100054324 | 3300005841 | Bacteria | 3795 |
| 143 | Ga0068858_100015131 | 3300005842 | Bacteria | 7256 |
| 144 | Ga0068860_100083152 | 3300005843 | Bacteria | 3044 |
| 145 | Ga0068862_100240410 | 3300005844 | Bacteria | 1646 |
| 146 | Ga0081455_10026466 | 3300005937 | Bacteria | 5333 |
| 147 | Ga0081455_10028271 | 3300005937 | Bacteria | 5125 |
| 148 | Ga0081538_10017318 | 3300005981 | Bacteria | 5475 |
| 149 | Ga0081539_10000639 | 3300005985 | Bacteria | 70847 |
| 150 | Ga0070717_10003134 | 3300006028 | Bacteria | 11812 |
| 151 | Ga0070717_10020816 | 3300006028 | Bacteria | 5163 |
| 152 | Ga0070716_100024703 | 3300006173 | Bacteria | 3201 |
| 153 | Ga0070712_100157935 | 3300006175 | Bacteria | 1748 |
| 154 | Ga0097621_100005059 | 3300006237 | Bacteria | 9265 |
| 155 | Ga0068871_100000321 | 3300006358 | Bacteria | 33368 |
| 156 | Ga0075433_10039695 | 3300006852 | Bacteria | 4072 |
| 157 | Ga0075434_100000641 | 3300006871 | Bacteria | 27050 |
| 158 | Ga0075436_100000256 | 3300006914 | Bacteria | 33232 |
| 159 | Ga0075436_100049922 | 3300006914 | Bacteria | 2887 |
| 160 | Ga0097620_100003668 | 3300006931 | Bacteria | 15638 |
| 161 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 162 | Ga0105240_10000130 | 3300009093 | Bacteria | 154390 |
| 163 | Ga0105240_10000222 | 3300009093 | Bacteria | 113825 |
| 164 | Ga0105240_10005666 | 3300009093 | Bacteria | 18538 |
| 165 | Ga0105240_10006104 | 3300009093 | Bacteria | 17778 |
| 166 | Ga0105240_10012189 | 3300009093 | Bacteria | 11895 |
| 167 | Ga0105240_10015500 | 3300009093 | Bacteria | 10361 |
| 168 | Ga0105240_10027417 | 3300009093 | Bacteria | 7456 |
| 169 | Ga0105240_10080777 | 3300009093 | Bacteria | 3997 |
| 170 | Ga0105240_10086151 | 3300009093 | Bacteria | 3847 |
| 171 | Ga0105240_10172550 | 3300009093 | Unclassified | 2559 |
| 172 | Ga0111539_10043418 | 3300009094 | Bacteria | 5389 |
| 173 | Ga0105245_10000169 | 3300009098 | Bacteria | 61835 |
| 174 | Ga0105245_10067425 | 3300009098 | Bacteria | 3241 |
| 175 | Ga0105247_10035139 | 3300009101 | Bacteria | 3054 |
| 176 | Ga0114129_10432061 | 3300009147 | Bacteria | 1730 |
| 177 | Ga0105241_10000074 | 3300009174 | Bacteria | 75523 |
| 178 | Ga0105241_10002755 | 3300009174 | Bacteria | 13168 |
| 179 | Ga0105241_10004865 | 3300009174 | Bacteria | 9907 |
| 180 | Ga0105241_10096571 | 3300009174 | Bacteria | 2341 |
| 181 | Ga0105241_10115283 | 3300009174 | Bacteria | 2156 |
| 182 | Ga0105248_10006190 | 3300009177 | Bacteria | 13115 |
| 183 | Ga0105237_10004817 | 3300009545 | Bacteria | 15502 |
| 184 | Ga0105237_10015269 | 3300009545 | Bacteria | 8000 |
| 185 | Ga0105237_10083831 | 3300009545 | Bacteria | 3178 |
| 186 | Ga0105237_10107264 | 3300009545 | Bacteria | 2785 |
| 187 | Ga0105237_10134046 | 3300009545 | Bacteria | 2472 |
| 188 | Ga0105238_10000516 | 3300009551 | Bacteria | 40563 |
| 189 | Ga0105238_10001890 | 3300009551 | Bacteria | 21028 |
| 190 | Ga0105238_10003327 | 3300009551 | Bacteria | 16042 |
| 191 | Ga0105238_10010605 | 3300009551 | Bacteria | 9252 |
| 192 | Ga0105238_10028496 | 3300009551 | Bacteria | 5690 |
| 193 | Ga0105238_10032609 | 3300009551 | Bacteria | 5300 |
| 194 | Ga0105238_10044053 | 3300009551 | Bacteria | 4513 |
| 195 | Ga0105238_10075818 | 3300009551 | Bacteria | 3355 |
| 196 | Ga0105249_10019112 | 3300009553 | Bacteria | 6111 |
| 197 | Ga0105239_10003064 | 3300010375 | Bacteria | 20772 |
| 198 | Ga0105239_10026650 | 3300010375 | Bacteria | 6362 |
| 199 | Ga0105239_10036104 | 3300010375 | Bacteria | 5427 |
| 200 | Ga0105239_10092589 | 3300010375 | Bacteria | 3337 |
| 201 | Ga0105239_10114770 | 3300010375 | Bacteria | 2987 |
| 202 | Ga0105239_10179478 | 3300010375 | Unclassified | 2369 |
| 203 | Ga0105246_10004915 | 3300011119 | Bacteria | 8145 |
| 204 | Ga0157371_10009561 | 3300013102 | Bacteria | 7625 |
| 205 | Ga0157371_10027541 | 3300013102 | Bacteria | 4122 |
| 206 | Ga0157371_10131433 | 3300013102 | Bacteria | 1781 |
| 207 | Ga0157370_10001610 | 3300013104 | Bacteria | 27915 |
| 208 | Ga0157370_10003900 | 3300013104 | Bacteria | 17380 |
| 209 | Ga0157370_10030259 | 3300013104 | Bacteria | 5305 |
| 210 | Ga0157370_10067695 | 3300013104 | Bacteria | 3375 |
| 211 | Ga0157370_10190990 | 3300013104 | Bacteria | 1901 |
| 212 | Ga0157370_10284123 | 3300013104 | Unclassified | 1529 |
| 213 | Ga0157370_10368755 | 3300013104 | Bacteria | 1323 |
| 214 | Ga0157369_10000112 | 3300013105 | Bacteria | 114309 |
| 215 | Ga0157369_10005663 | 3300013105 | Bacteria | 14513 |
| 216 | Ga0157369_10006503 | 3300013105 | Bacteria | 13544 |
| 217 | Ga0157369_10011061 | 3300013105 | Bacteria | 10267 |
| 218 | Ga0157369_10019713 | 3300013105 | Bacteria | 7547 |
| 219 | Ga0157369_10021141 | 3300013105 | Bacteria | 7276 |
| 220 | Ga0157369_10028434 | 3300013105 | Bacteria | 6187 |
| 221 | Ga0157369_10034889 | 3300013105 | Bacteria | 5518 |
| 222 | Ga0157369_10041174 | 3300013105 | Bacteria | 5043 |
| 223 | Ga0157369_10053709 | 3300013105 | Bacteria | 4353 |
| 224 | Ga0157369_10103974 | 3300013105 | Bacteria | 3025 |
| 225 | Ga0157369_10109224 | 3300013105 | Bacteria | 2941 |
| 226 | Ga0157369_10123221 | 3300013105 | Bacteria | 2750 |
| 227 | Ga0157369_10201586 | 3300013105 | Bacteria | 2088 |
| 228 | Ga0157369_10317042 | 3300013105 | Unclassified | 1621 |
| 229 | Ga0157374_10003684 | 3300013296 | Bacteria | 12877 |
| 230 | Ga0157374_10040228 | 3300013296 | Bacteria | 4304 |
| 231 | Ga0157374_10212079 | 3300013296 | Bacteria | 1899 |
| 232 | Ga0157378_10013535 | 3300013297 | Bacteria | 7136 |
| 233 | Ga0157378_10068696 | 3300013297 | Bacteria | 3178 |
| 234 | Ga0163162_10007637 | 3300013306 | Bacteria | 10534 |
| 235 | Ga0157372_10000422 | 3300013307 | Bacteria | 46497 |
| 236 | Ga0157372_10001211 | 3300013307 | Bacteria | 27915 |
| 237 | Ga0157372_10001505 | 3300013307 | Bacteria | 25337 |
| 238 | Ga0157372_10002780 | 3300013307 | Bacteria | 18917 |
| 239 | Ga0157372_10005419 | 3300013307 | Bacteria | 13559 |
| 240 | Ga0157372_10010205 | 3300013307 | Bacteria | 9974 |
| 241 | Ga0157372_10014537 | 3300013307 | Bacteria | 8423 |
| 242 | Ga0157372_10029940 | 3300013307 | Bacteria | 5949 |
| 243 | Ga0157372_10077669 | 3300013307 | Bacteria | 3751 |
| 244 | Ga0157372_10114709 | 3300013307 | Bacteria | 3088 |
| 245 | Ga0157372_10118093 | 3300013307 | Bacteria | 3043 |
| 246 | Ga0157372_10159313 | 3300013307 | Bacteria | 2608 |
| 247 | Ga0157372_10188412 | 3300013307 | Bacteria | 2389 |
| 248 | Ga0157372_10489690 | 3300013307 | Bacteria | 1434 |
| 249 | Ga0157372_10540176 | 3300013307 | Unclassified | 1359 |
| 250 | Ga0157375_10009640 | 3300013308 | Bacteria | 8486 |
| 251 | Ga0157375_10013056 | 3300013308 | Bacteria | 7381 |
| 252 | Ga0163163_10000679 | 3300014325 | Bacteria | 29109 |
| 253 | Ga0182008_10092460 | 3300014497 | Bacteria | 1492 |
| 254 | Ga0182008_10112226 | 3300014497 | Bacteria | 1351 |
| 255 | Ga0157379_10000499 | 3300014968 | Bacteria | 31901 |
| 256 | Ga0157376_10006836 | 3300014969 | Bacteria | 8078 |
| 257 | Ga0157376_10049393 | 3300014969 | Bacteria | 3484 |
| 258 | Ga0182006_1013694 | 3300015261 | Bacteria | 3510 |
| 259 | Ga0197907_10413395 | 3300020069 | Bacteria | 2942 |
| 260 | Ga0206356_11119816 | 3300020070 | Bacteria | 5138 |
| 261 | Ga0206356_11224057 | 3300020070 | Bacteria | 4947 |
| 262 | Ga0206356_11259921 | 3300020070 | Bacteria | 3450 |
| 263 | Ga0206349_1887837 | 3300020075 | Bacteria | 2680 |
| 264 | Ga0206355_1317415 | 3300020076 | Unclassified | 3094 |
| 265 | Ga0206351_10173209 | 3300020077 | Bacteria | 2527 |
| 266 | Ga0206351_10279165 | 3300020077 | Unclassified | 1310 |
| 267 | Ga0206351_10397847 | 3300020077 | Bacteria | 4136 |
| 268 | Ga0206351_10501227 | 3300020077 | Bacteria | 1756 |
| 269 | Ga0206350_10152871 | 3300020080 | Bacteria | 2367 |
| 270 | Ga0206350_10326591 | 3300020080 | Bacteria | 3374 |
| 271 | Ga0206350_10331461 | 3300020080 | Bacteria | 6054 |
| 272 | Ga0206350_10856568 | 3300020080 | Bacteria | 5702 |
| 273 | Ga0206350_11147263 | 3300020080 | Bacteria | 5416 |
| 274 | Ga0206353_10373932 | 3300020082 | Bacteria | 2776 |
| 275 | Ga0206353_11873519 | 3300020082 | Bacteria | 1592 |
| 276 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 277 | Ga0213872_10021296 | 3300021361 | Bacteria | 2986 |
| 278 | Ga0213872_10038149 | 3300021361 | Bacteria | 2193 |
| 279 | Ga0213872_10074906 | 3300021361 | Bacteria | 1523 |
| 280 | Ga0213876_10000002 | 3300021384 | Bacteria | 1168769 |
| 281 | Ga0213875_10000022 | 3300021388 | Bacteria | 215075 |
| 282 | Ga0213875_10000098 | 3300021388 | Bacteria | 98684 |
| 283 | Ga0213875_10001132 | 3300021388 | Bacteria | 18346 |
| 284 | Ga0213875_10001220 | 3300021388 | Bacteria | 17409 |
| 285 | Ga0213875_10012047 | 3300021388 | Bacteria | 4283 |
| 286 | Ga0224712_10000481 | 3300022467 | Bacteria | 8011 |
| 287 | Ga0224712_10000924 | 3300022467 | Bacteria | 6318 |
| 288 | Ga0224712_10003449 | 3300022467 | Bacteria | 4109 |
| 289 | Ga0224712_10042673 | 3300022467 | Bacteria | 1720 |
| 290 | Ga0207666_1000203 | 3300025271 | Bacteria | 8848 |
| 291 | Ga0207697_10001245 | 3300025315 | Bacteria | 13958 |
| 292 | Ga0207697_10002753 | 3300025315 | Bacteria | 8971 |
| 293 | Ga0207656_10012886 | 3300025321 | Bacteria | 3185 |
| 294 | Ga0207656_10016389 | 3300025321 | Bacteria | 2884 |
| 295 | Ga0207656_10022804 | 3300025321 | Bacteria | 2515 |
| 296 | Ga0207692_10068186 | 3300025898 | Bacteria | 1864 |
| 297 | Ga0207692_10098504 | 3300025898 | Bacteria | 1600 |
| 298 | Ga0207710_10018498 | 3300025900 | Bacteria | 2964 |
| 299 | Ga0207705_10003383 | 3300025909 | Bacteria | 12130 |
| 300 | Ga0207705_10009770 | 3300025909 | Bacteria | 6983 |
| 301 | Ga0207705_10013790 | 3300025909 | Bacteria | 5827 |
| 302 | Ga0207705_10021455 | 3300025909 | Bacteria | 4609 |
| 303 | Ga0207705_10224550 | 3300025909 | Bacteria | 1427 |
| 304 | Ga0207654_10000380 | 3300025911 | Bacteria | 25850 |
| 305 | Ga0207654_10001262 | 3300025911 | Bacteria | 13476 |
| 306 | Ga0207654_10075093 | 3300025911 | Bacteria | 2019 |
| 307 | Ga0207707_10000481 | 3300025912 | Bacteria | 41355 |
| 308 | Ga0207707_10001382 | 3300025912 | Bacteria | 22527 |
| 309 | Ga0207707_10040309 | 3300025912 | Bacteria | 4079 |
| 310 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 311 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 312 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 313 | Ga0207695_10000177 | 3300025913 | Bacteria | 185955 |
| 314 | Ga0207695_10000292 | 3300025913 | Bacteria | 123721 |
| 315 | Ga0207695_10003411 | 3300025913 | Bacteria | 22444 |
| 316 | Ga0207695_10013379 | 3300025913 | Bacteria | 9790 |
| 317 | Ga0207695_10018270 | 3300025913 | Bacteria | 8114 |
| 318 | Ga0207695_10029477 | 3300025913 | Bacteria | 6062 |
| 319 | Ga0207695_10031688 | 3300025913 | Bacteria | 5794 |
| 320 | Ga0207671_10000487 | 3300025914 | Bacteria | 53821 |
| 321 | Ga0207671_10003647 | 3300025914 | Bacteria | 15208 |
| 322 | Ga0207693_10040100 | 3300025915 | Bacteria | 3687 |
| 323 | Ga0207663_10124525 | 3300025916 | Unclassified | 1771 |
| 324 | Ga0207660_10000419 | 3300025917 | Bacteria | 28025 |
| 325 | Ga0207660_10006095 | 3300025917 | Bacteria | 7826 |
| 326 | Ga0207660_10023320 | 3300025917 | Bacteria | 4178 |
| 327 | Ga0207660_10120254 | 3300025917 | Bacteria | 1988 |
| 328 | Ga0207657_10002127 | 3300025919 | Bacteria | 21449 |
| 329 | Ga0207657_10041017 | 3300025919 | Bacteria | 4096 |
| 330 | Ga0207657_10060529 | 3300025919 | Bacteria | 3249 |
| 331 | Ga0207657_10128475 | 3300025919 | Bacteria | 2079 |
| 332 | Ga0207657_10176205 | 3300025919 | Unclassified | 1730 |
| 333 | Ga0207657_10234294 | 3300025919 | Bacteria | 1467 |
| 334 | Ga0207649_10001021 | 3300025920 | Bacteria | 17258 |
| 335 | Ga0207649_10036626 | 3300025920 | Bacteria | 2957 |
| 336 | Ga0207649_10047500 | 3300025920 | Bacteria | 2642 |
| 337 | Ga0207652_10000148 | 3300025921 | Bacteria | 75801 |
| 338 | Ga0207652_10002522 | 3300025921 | Bacteria | 15385 |
| 339 | Ga0207652_10054285 | 3300025921 | Bacteria | 3444 |
| 340 | Ga0207652_10171045 | 3300025921 | Bacteria | 1949 |
| 341 | Ga0207694_10000160 | 3300025924 | Bacteria | 68770 |
| 342 | Ga0207694_10001418 | 3300025924 | Bacteria | 20539 |
| 343 | Ga0207694_10003078 | 3300025924 | Bacteria | 13349 |
| 344 | Ga0207694_10016365 | 3300025924 | Bacteria | 5599 |
| 345 | Ga0207694_10034558 | 3300025924 | Bacteria | 3877 |
| 346 | Ga0207694_10073706 | 3300025924 | Bacteria | 2671 |
| 347 | Ga0207694_10195322 | 3300025924 | Unclassified | 1645 |
| 348 | Ga0207650_10006218 | 3300025925 | Bacteria | 8135 |
| 349 | Ga0207687_10000471 | 3300025927 | Bacteria | 27489 |
| 350 | Ga0207700_10013750 | 3300025928 | Bacteria | 5280 |
| 351 | Ga0207700_10085582 | 3300025928 | Bacteria | 2475 |
| 352 | Ga0207664_10058997 | 3300025929 | Bacteria | 3055 |
| 353 | Ga0207664_10385871 | 3300025929 | Bacteria | 1244 |
| 354 | Ga0207644_10018310 | 3300025931 | Bacteria | 4736 |
| 355 | Ga0207644_10027025 | 3300025931 | Bacteria | 3962 |
| 356 | Ga0207644_10029497 | 3300025931 | Bacteria | 3807 |
| 357 | Ga0207644_10073260 | 3300025931 | Bacteria | 2511 |
| 358 | Ga0207690_10095942 | 3300025932 | Bacteria | 2107 |
| 359 | Ga0207690_10101045 | 3300025932 | Bacteria | 2059 |
| 360 | Ga0207670_10010318 | 3300025936 | Bacteria | 5373 |
| 361 | Ga0207670_10055887 | 3300025936 | Bacteria | 2669 |
| 362 | Ga0207665_10023774 | 3300025939 | Bacteria | 4036 |
| 363 | Ga0207691_10104014 | 3300025940 | Bacteria | 2531 |
| 364 | Ga0207711_10024254 | 3300025941 | Bacteria | 5078 |
| 365 | Ga0207689_10006228 | 3300025942 | Bacteria | 10567 |
| 366 | Ga0207661_10020713 | 3300025944 | Bacteria | 4920 |
| 367 | Ga0207661_10026617 | 3300025944 | Bacteria | 4410 |
| 368 | Ga0207661_10041851 | 3300025944 | Bacteria | 3609 |
| 369 | Ga0207661_10089413 | 3300025944 | Bacteria | 2562 |
| 370 | Ga0207661_10163589 | 3300025944 | Bacteria | 1932 |
| 371 | Ga0207661_10215437 | 3300025944 | Bacteria | 1695 |
| 372 | Ga0207679_10052719 | 3300025945 | Bacteria | 2985 |
| 373 | Ga0207667_10000056 | 3300025949 | Bacteria | 206107 |
| 374 | Ga0207667_10002192 | 3300025949 | Bacteria | 24516 |
| 375 | Ga0207667_10003095 | 3300025949 | Bacteria | 20587 |
| 376 | Ga0207667_10014779 | 3300025949 | Bacteria | 8882 |
| 377 | Ga0207667_10014961 | 3300025949 | Bacteria | 8824 |
| 378 | Ga0207667_10044718 | 3300025949 | Bacteria | 4691 |
| 379 | Ga0207667_10060830 | 3300025949 | Bacteria | 3953 |
| 380 | Ga0207667_10156868 | 3300025949 | Bacteria | 2341 |
| 381 | Ga0207667_10188096 | 3300025949 | Bacteria | 2119 |
| 382 | Ga0207667_10206587 | 3300025949 | Bacteria | 2013 |
| 383 | Ga0207667_10242541 | 3300025949 | Bacteria | 1844 |
| 384 | Ga0207668_10074567 | 3300025972 | Bacteria | 2436 |
| 385 | Ga0207640_10004197 | 3300025981 | Bacteria | 7793 |
| 386 | Ga0207640_10070567 | 3300025981 | Bacteria | 2350 |
| 387 | Ga0207658_10000549 | 3300025986 | Bacteria | 34004 |
| 388 | Ga0207658_10041337 | 3300025986 | Bacteria | 3338 |
| 389 | Ga0207677_10000055 | 3300026023 | Bacteria | 98214 |
| 390 | Ga0207677_10099141 | 3300026023 | Bacteria | 2139 |
| 391 | Ga0207703_10072517 | 3300026035 | Bacteria | 2847 |
| 392 | Ga0207639_10000145 | 3300026041 | Bacteria | 53212 |
| 393 | Ga0207639_10000460 | 3300026041 | Bacteria | 28135 |
| 394 | Ga0207639_10016832 | 3300026041 | Bacteria | 5179 |
| 395 | Ga0207639_10027069 | 3300026041 | Bacteria | 4173 |
| 396 | Ga0207639_10154624 | 3300026041 | Bacteria | 1925 |
| 397 | Ga0207678_10011955 | 3300026067 | Bacteria | 7622 |
| 398 | Ga0207678_10045845 | 3300026067 | Bacteria | 3780 |
| 399 | Ga0207708_10195103 | 3300026075 | Bacteria | 1613 |
| 400 | Ga0207702_10001122 | 3300026078 | Bacteria | 27348 |
| 401 | Ga0207702_10035114 | 3300026078 | Bacteria | 4192 |
| 402 | Ga0207702_10067512 | 3300026078 | Bacteria | 3069 |
| 403 | Ga0207702_10224718 | 3300026078 | Bacteria | 1751 |
| 404 | Ga0207702_10259265 | 3300026078 | Bacteria | 1636 |
| 405 | Ga0207641_10000596 | 3300026088 | Bacteria | 39785 |
| 406 | Ga0207641_10203712 | 3300026088 | Bacteria | 1826 |
| 407 | Ga0207676_10002442 | 3300026095 | Bacteria | 13241 |
| 408 | Ga0207674_10001250 | 3300026116 | Bacteria | 33196 |
| 409 | Ga0207674_10002359 | 3300026116 | Bacteria | 23871 |
| 410 | Ga0207674_10020466 | 3300026116 | Bacteria | 7147 |
| 411 | Ga0207698_10000021 | 3300026142 | Bacteria | 133280 |
| 412 | Ga0207698_10061251 | 3300026142 | Bacteria | 2932 |
| 413 | Ga0207698_10066020 | 3300026142 | Bacteria | 2846 |
| 414 | Ga0207698_10191627 | 3300026142 | Unclassified | 1822 |
| 415 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 416 | Ga0268266_10000637 | 3300028379 | Bacteria | 47708 |
| 417 | Ga0268266_10148142 | 3300028379 | Bacteria | 2112 |
| 418 | Ga0268265_10075316 | 3300028380 | Bacteria | 2643 |
| 419 | Ga0268264_10000433 | 3300028381 | Bacteria | 57744 |
| 420 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 421 | Ga0265327_10027096 | 3300031251 | Bacteria | 3304 |
| 422 | Ga0307408_100019720 | 3300031548 | Bacteria | 4543 |
| 423 | Ga0307408_100085860 | 3300031548 | Bacteria | 2364 |
| 424 | Ga0307408_100119750 | 3300031548 | Bacteria | 2037 |
| 425 | Ga0307408_100157716 | 3300031548 | Bacteria | 1799 |
| 426 | Ga0316576_10007137 | 3300031727 | Bacteria | 7005 |
| 427 | Ga0316578_10000808 | 3300031728 | Bacteria | 11611 |
| 428 | Ga0307516_10007406 | 3300031730 | Bacteria | 12625 |
| 429 | Ga0307405_10026664 | 3300031731 | Bacteria | 3337 |
| 430 | Ga0307405_10051826 | 3300031731 | Bacteria | 2548 |
| 431 | Ga0307405_10056826 | 3300031731 | Bacteria | 2455 |
| 432 | Ga0307405_10163311 | 3300031731 | Bacteria | 1580 |
| 433 | Ga0307413_10004354 | 3300031824 | Bacteria | 6149 |
| 434 | Ga0307413_10035950 | 3300031824 | Bacteria | 2847 |
| 435 | Ga0307413_10063501 | 3300031824 | Bacteria | 2290 |
| 436 | Ga0307410_10000012 | 3300031852 | Bacteria | 79112 |
| 437 | Ga0307410_10073607 | 3300031852 | Bacteria | 2376 |
| 438 | Ga0307406_10000429 | 3300031901 | Bacteria | 24463 |
| 439 | Ga0307406_10128122 | 3300031901 | Bacteria | 1777 |
| 440 | Ga0307407_10000809 | 3300031903 | Bacteria | 10369 |
| 441 | Ga0307407_10003796 | 3300031903 | Bacteria | 6287 |
| 442 | Ga0307407_10004745 | 3300031903 | Bacteria | 5813 |
| 443 | Ga0307407_10038198 | 3300031903 | Bacteria | 2659 |
| 444 | Ga0307407_10057291 | 3300031903 | Bacteria | 2260 |
| 445 | Ga0307407_10057996 | 3300031903 | Bacteria | 2249 |
| 446 | Ga0307407_10094190 | 3300031903 | Bacteria | 1843 |
| 447 | Ga0307412_10020065 | 3300031911 | Bacteria | 4061 |
| 448 | Ga0307412_10027125 | 3300031911 | Bacteria | 3568 |
| 449 | Ga0307412_10078647 | 3300031911 | Bacteria | 2273 |
| 450 | Ga0307412_10081163 | 3300031911 | Bacteria | 2242 |
| 451 | Ga0307412_10091642 | 3300031911 | Bacteria | 2128 |
| 452 | Ga0307412_10095834 | 3300031911 | Bacteria | 2087 |
| 453 | Ga0307412_10192740 | 3300031911 | Bacteria | 1542 |
| 454 | Ga0307412_10205765 | 3300031911 | Bacteria | 1498 |
| 455 | Ga0307409_100000202 | 3300031995 | Bacteria | 23457 |
| 456 | Ga0307409_100000776 | 3300031995 | Bacteria | 14462 |
| 457 | Ga0307409_100008829 | 3300031995 | Bacteria | 6147 |
| 458 | Ga0307409_100016125 | 3300031995 | Bacteria | 4933 |
| 459 | Ga0307409_100019725 | 3300031995 | Bacteria | 4574 |
| 460 | Ga0307409_100028392 | 3300031995 | Bacteria | 3985 |
| 461 | Ga0307416_100002055 | 3300032002 | Bacteria | 11334 |
| 462 | Ga0307416_100004513 | 3300032002 | Bacteria | 8405 |
| 463 | Ga0307416_100004568 | 3300032002 | Bacteria | 8366 |
| 464 | Ga0307416_100008103 | 3300032002 | Bacteria | 6744 |
| 465 | Ga0307416_100012459 | 3300032002 | Bacteria | 5730 |
| 466 | Ga0307416_100104559 | 3300032002 | Bacteria | 2476 |
| 467 | Ga0307416_100141337 | 3300032002 | Bacteria | 2188 |
| 468 | Ga0307416_100216193 | 3300032002 | Bacteria | 1834 |
| 469 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 470 | Ga0307414_10000187 | 3300032004 | Bacteria | 42062 |
| 471 | Ga0307414_10028651 | 3300032004 | Bacteria | 3615 |
| 472 | Ga0307414_10032764 | 3300032004 | Bacteria | 3426 |
| 473 | Ga0307414_10035984 | 3300032004 | Bacteria | 3300 |
| 474 | Ga0307414_10054596 | 3300032004 | Bacteria | 2793 |
| 475 | Ga0307411_10000001 | 3300032005 | Bacteria | 931810 |
| 476 | Ga0307411_10010072 | 3300032005 | Bacteria | 5017 |
| 477 | Ga0307411_10025703 | 3300032005 | Bacteria | 3533 |
| 478 | Ga0307411_10149928 | 3300032005 | Bacteria | 1731 |
| 479 | Ga0307411_10151253 | 3300032005 | Bacteria | 1725 |
| 480 | Ga0307415_100006483 | 3300032126 | Bacteria | 6320 |
| 481 | Ga0307415_100091304 | 3300032126 | Bacteria | 2205 |
| 482 | Ga0307415_100153009 | 3300032126 | Bacteria | 1778 |
| 483 | Ga0307415_100167392 | 3300032126 | Bacteria | 1710 |
| 484 | Ga0307415_100284513 | 3300032126 | Bacteria | 1361 |
| 485 | Ga0316580_10003585 | 3300032139 | Bacteria | 4420 |
| 486 | Ga0373926_0009750 | 3300035083 | Bacteria | 3209 |
| 487 | Ga0373953_0007522 | 3300035117 | Bacteria | 3653 |
| 488 | Ga0373954_0022354 | 3300035118 | Bacteria | 2868 |
| 489 | Ga0373956_0037041 | 3300035119 | Bacteria | 2155 |
| 490 | Ga0373933_0005010 | 3300035724 | Bacteria | 7225 |
| 491 | Ga0373937_0008999 | 3300036401 | Bacteria | 8668 |
| 492 | Ga0316584_0004516 | 3300036712 | Bacteria | 9213 |
| 493 | Ga0316584_0037359 | 3300036712 | Bacteria | 3608 |
| 494 | Ga0373925_0282298 | 3300037068 | Bacteria | 1337 |
| 495 | Ga0395900_0108357 | 3300037418 | Bacteria | 2854 |
| 496 | Ga0395898_0019877 | 3300037466 | Bacteria | 6830 |
| 497 | Ga0395898_0223176 | 3300037466 | Bacteria | 1797 |
| 498 | Ga0395905_0046822 | 3300037471 | Bacteria | 4055 |
| 499 | Ga0395905_0407569 | 3300037471 | Bacteria | 1255 |
| 500 | Ga0436364_0530951 | 3300037853 | Bacteria | 215117 |
| 501 | Ga0436364_0558108 | 3300037853 | Bacteria | 39499 |
| 502 | Ga0436364_0566500 | 3300037853 | Bacteria | 56428 |
| 503 | Ga0436364_0927813 | 3300037853 | Unclassified | 2114 |
| 504 | Ga0436364_1325276 | 3300037853 | Bacteria | 58128 |
| 505 | Ga0436364_1390920 | 3300037853 | Bacteria | 113944 |
| 506 | Ga0436365_0190860 | 3300039437 | Bacteria | 42582 |
| 507 | Ga0436365_0281631 | 3300039437 | Bacteria | 1899 |
| 508 | Ga0436365_0813146 | 3300039437 | Unclassified | 1253 |
| 509 | Ga0436365_1528146 | 3300039437 | Bacteria | 1868 |
| 510 | Ga0436360_0034025 | 3300039438 | Unclassified | 2176 |
| 511 | Ga0436360_0129245 | 3300039438 | Bacteria | 1989 |
| 512 | Ga0436360_0247545 | 3300039438 | Bacteria | 8033 |
| 513 | Ga0436360_0257927 | 3300039438 | Bacteria | 6020 |
| 514 | Ga0436360_0373346 | 3300039438 | Bacteria | 2525 |
| 515 | Ga0436361_0221137 | 3300039447 | Bacteria | 5102 |
| 516 | Ga0436361_0323325 | 3300039447 | Bacteria | 1831 |
| 517 | Ga0436361_0523980 | 3300039447 | Unclassified | 4960 |
| 518 | Ga0436361_0765221 | 3300039447 | Bacteria | 9171 |
| 519 | Ga0436361_0941399 | 3300039447 | Bacteria | 1217 |
| 520 | Ga0436361_0997213 | 3300039447 | Bacteria | 24500 |
| 521 | Ga0436363_0834601 | 3300039450 | Bacteria | 6944 |
| 522 | Ga0436362_0429742 | 3300039453 | Bacteria | 1569 |
| 523 | Ga0436362_0649416 | 3300039453 | Bacteria | 210038 |
| 524 | Ga0439445_0035105 | 3300042004 | Bacteria | 1316 |
| 525 | Ga0439448_0017508 | 3300042005 | Bacteria | 2189 |
| 526 | Ga0451577_0301872 | 3300042876 | Bacteria | 1451 |
| 527 | Ga0453683_0000194 | 3300044673 | Bacteria | 83328 |
| 528 | Ga0453683_0000655 | 3300044673 | Bacteria | 37122 |
| 529 | Ga0453683_0009023 | 3300044673 | Bacteria | 6660 |
| 530 | Ga0466966_0146274 | 3300044684 | Bacteria | 1442 |
| 531 | Ga0466961_0099692 | 3300044693 | Bacteria | 1831 |
| 532 | Ga0466963_0022152 | 3300044694 | Bacteria | 4021 |
| 533 | Ga0466963_0097910 | 3300044694 | Bacteria | 2005 |
| 534 | Ga0453684_0001086 | 3300044712 | Bacteria | 86208 |
| 535 | Ga0453684_0001215 | 3300044712 | Bacteria | 79022 |
| 536 | Ga0453684_0001854 | 3300044712 | Bacteria | 55179 |
| 537 | Ga0453684_0045814 | 3300044712 | Bacteria | 5828 |
| 538 | Ga0453684_0095925 | 3300044712 | Bacteria | 3644 |
| 539 | Ga0453684_0124438 | 3300044712 | Bacteria | 3106 |
| 540 | Ga0453684_0283778 | 3300044712 | Bacteria | 1887 |
| 541 | Ga0466971_0000020 | 3300044719 | Bacteria | 78865 |
| 542 | Ga0466970_0002918 | 3300044765 | Bacteria | 8287 |
| 543 | Ga0466957_0009810 | 3300044842 | Bacteria | 5474 |
| 544 | Ga0466957_0041836 | 3300044842 | Bacteria | 2771 |
| 545 | Ga0466957_0080447 | 3300044842 | Bacteria | 2028 |
| 546 | Ga0466959_0071712 | 3300045049 | Bacteria | 2508 |
| 547 | Ga0466959_0222703 | 3300045049 | Bacteria | 1308 |
| 548 | Ga0451576_0000135 | 3300045051 | Bacteria | 186763 |
| 549 | Ga0451576_0005678 | 3300045051 | Bacteria | 15571 |
| 550 | Ga0466958_0038998 | 3300045836 | Bacteria | 2852 |
| 551 | Ga0466958_0084694 | 3300045836 | Bacteria | 1955 |
| 552 | Ga0466967_0002127 | 3300045976 | Bacteria | 12138 |
| 553 | Ga0466967_0019542 | 3300045976 | Bacteria | 5450 |
| 554 | Ga0466967_0024454 | 3300045976 | Unclassified | 4966 |
| 555 | Ga0466967_0034868 | 3300045976 | Bacteria | 4276 |
| 556 | Ga0466967_0044823 | 3300045976 | Bacteria | 3839 |
| 557 | Ga0466967_0062381 | 3300045976 | Bacteria | 3308 |
| 558 | Ga0495580_0044422 | 3300046472 | Bacteria | 3160 |
| 559 | Ga0495610_0000741 | 3300046512 | Bacteria | 30987 |
| 560 | Ga0495620_0001937 | 3300046515 | Bacteria | 12117 |
| 561 | Ga0495620_0026522 | 3300046515 | Bacteria | 2724 |
| 562 | Ga0495632_0019430 | 3300046519 | Bacteria | 3702 |
| 563 | Ga0495642_0055178 | 3300046528 | Bacteria | 1640 |
| 564 | Ga0495645_0023850 | 3300046543 | Bacteria | 4435 |
| 565 | Ga0495625_0012365 | 3300046660 | Bacteria | 6918 |
| 566 | Ga0495686_0007303 | 3300047472 | Bacteria | 8303 |
| 567 | Ga0495686_0011196 | 3300047472 | Bacteria | 6328 |
| 568 | Ga0496102_0153433 | 3300048905 | Bacteria | 2165 |
| 569 | Ga0496104_0014966 | 3300048907 | Bacteria | 7017 |
| 570 | Ga0496108_0308875 | 3300048911 | Bacteria | 1378 |
| 571 | Ga0496109_0109004 | 3300048912 | Bacteria | 2574 |
| 572 | Ga0496112_0003611 | 3300048915 | Bacteria | 12880 |
| 573 | Ga0496112_0038502 | 3300048915 | Unclassified | 4669 |
| 574 | Ga0496112_0284605 | 3300048915 | Bacteria | 1600 |
| 575 | Ga0496113_0017282 | 3300048916 | Bacteria | 5003 |
| 576 | Ga0501323_004310 | 3300049539 | Unclassified | 1499 |
| 577 | Ga0501031_0014975 | 3300049568 | Bacteria | 5037 |
| 578 | Ga0501031_0039359 | 3300049568 | Bacteria | 3085 |
| 579 | Ga0501033_0019236 | 3300049570 | Bacteria | 5162 |
| 580 | Ga0501034_0142646 | 3300049571 | Bacteria | 2374 |
| 581 | Ga0501034_0239515 | 3300049571 | Bacteria | 1761 |
| 582 | Ga0501036_0024337 | 3300049572 | Bacteria | 5104 |
| 583 | Ga0501036_0030940 | 3300049572 | Bacteria | 4523 |
| 584 | Ga0501037_0000240 | 3300049573 | Bacteria | 47068 |
| 585 | Ga0501038_0030585 | 3300049574 | Bacteria | 4762 |
| 586 | Ga0501038_0036575 | 3300049574 | Bacteria | 4308 |
| 587 | Ga0501039_0049676 | 3300049575 | Bacteria | 3243 |
| 588 | Ga0501039_0145499 | 3300049575 | Bacteria | 1862 |
| 589 | Ga0501040_0001682 | 3300049576 | Bacteria | 14164 |
| 590 | Ga0501040_0069168 | 3300049576 | Bacteria | 2435 |
| 591 | Ga0501041_0003044 | 3300049577 | Bacteria | 9618 |
| 592 | Ga0501042_0000935 | 3300049578 | Bacteria | 16467 |
| 593 | Ga0501042_0005151 | 3300049578 | Bacteria | 8391 |
| 594 | Ga0501043_0049989 | 3300049579 | Bacteria | 3287 |
| 595 | Ga0501046_0007013 | 3300049580 | Bacteria | 9926 |
| 596 | Ga0501046_0087707 | 3300049580 | Bacteria | 2397 |
| 597 | Ga0501047_0235683 | 3300049581 | Bacteria | 1682 |
| 598 | Ga0501048_0034730 | 3300049582 | Bacteria | 3635 |
| 599 | Ga0501048_0039381 | 3300049582 | Bacteria | 3391 |
| 600 | Ga0501067_0000849 | 3300049583 | Bacteria | 16474 |
| 601 | Ga0501067_0049823 | 3300049583 | Bacteria | 2321 |
| 602 | Ga0501067_0064111 | 3300049583 | Bacteria | 2035 |
| 603 | Ga0501068_0009520 | 3300049584 | Bacteria | 5440 |
| 604 | Ga0501069_0081649 | 3300049585 | Bacteria | 1821 |
| 605 | Ga0501070_0019217 | 3300049586 | Bacteria | 5730 |
| 606 | Ga0501070_0040158 | 3300049586 | Bacteria | 3902 |
| 607 | Ga0501071_0005144 | 3300049587 | Bacteria | 8380 |
| 608 | Ga0501071_0014009 | 3300049587 | Bacteria | 5479 |
| 609 | Ga0501071_0103433 | 3300049587 | Bacteria | 2101 |
| 610 | Ga0501072_0026890 | 3300049588 | Bacteria | 4489 |
| 611 | Ga0501072_0183338 | 3300049588 | Bacteria | 1670 |
| 612 | Ga0501073_0005253 | 3300049589 | Bacteria | 9709 |
| 613 | Ga0501073_0135221 | 3300049589 | Bacteria | 1709 |
| 614 | Ga0501073_0228257 | 3300049589 | Bacteria | 1286 |
| 615 | Ga0501074_0051307 | 3300049590 | Bacteria | 2977 |
| 616 | Ga0501075_0058535 | 3300049591 | Bacteria | 2902 |
| 617 | Ga0501075_0238847 | 3300049591 | Bacteria | 1385 |
| 618 | Ga0501076_0005738 | 3300049592 | Bacteria | 8945 |
| 619 | Ga0501076_0011665 | 3300049592 | Bacteria | 6558 |
| 620 | Ga0501076_0013165 | 3300049592 | Bacteria | 6196 |
| 621 | Ga0501076_0175046 | 3300049592 | Bacteria | 1749 |
| 622 | Ga0501076_0198657 | 3300049592 | Bacteria | 1637 |
| 623 | Ga0501077_0000046 | 3300049593 | Bacteria | 62239 |
| 624 | Ga0501077_0049491 | 3300049593 | Bacteria | 2671 |
| 625 | Ga0501224_009848 | 3300049664 | Unclassified | 1399 |
| 626 | Ga0501238_000091 | 3300049671 | Bacteria | 14462 |
| 627 | Ga0501249_000011 | 3300049679 | Bacteria | 168084 |
| 628 | Ga0501249_000854 | 3300049679 | Bacteria | 6757 |
| 629 | Ga0501249_024946 | 3300049679 | Bacteria | 1318 |
| 630 | Ga0501079_0017878 | 3300049741 | Bacteria | 5415 |
| 631 | Ga0501080_0004063 | 3300049742 | Bacteria | 12958 |
| 632 | Ga0501080_0047224 | 3300049742 | Bacteria | 4008 |
| 633 | Ga0501080_0081093 | 3300049742 | Bacteria | 3015 |
| 634 | Ga0501080_0258375 | 3300049742 | Bacteria | 1587 |
| 635 | Ga0501083_0001353 | 3300049744 | Bacteria | 16651 |
| 636 | Ga0501266_000016 | 3300049763 | Bacteria | 164181 |
| 637 | Ga0501280_000271 | 3300049776 | Bacteria | 13166 |
| 638 | Ga0501035_0006113 | 3300049822 | Bacteria | 11333 |
| 639 | Ga0501035_0057940 | 3300049822 | Bacteria | 3453 |
| 640 | Ga0501035_0318909 | 3300049822 | Bacteria | 1306 |
| 641 | Ga0501044_0000957 | 3300049823 | Bacteria | 34681 |
| 642 | Ga0501044_0249872 | 3300049823 | Bacteria | 1715 |
| 643 | Ga0501045_0043791 | 3300049824 | Bacteria | 3260 |
| 644 | Ga0501045_0201832 | 3300049824 | Bacteria | 1481 |
| 645 | nmdc:mga06z11_74688_c1 | 3300050494 | Bacteria | 1803 |
| 646 | nmdc:mga0n895_2275_c1 | 3300050512 | Bacteria | 14895 |
| 647 | nmdc:mga0rr50_29956_c1 | 3300050513 | Bacteria | 3846 |
| 648 | nmdc:mga08x19_20979_c1 | 3300050514 | Bacteria | 4029 |
| 649 | nmdc:mga08x19_4578_c1 | 3300050514 | Bacteria | 8208 |
| 650 | nmdc:mga0a205_6325_c1 | 3300050515 | Bacteria | 10690 |
| 651 | Ga0495655_0031599 | 3300053083 | Bacteria | 1289 |
| 652 | Ga0500633_0000311 | 3300053160 | Bacteria | 7182 |
| 653 | Ga0501084_0085793 | 3300054114 | Bacteria | 2643 |
| 654 | Ga0501084_0168728 | 3300054114 | Bacteria | 1847 |
| 655 | Ga0590071_000585 | 3300059421 | Bacteria | 10495 |
| 656 | Ga0590071_000919 | 3300059421 | Bacteria | 8163 |
| 657 | Ga0590071_000953 | 3300059421 | Bacteria | 8000 |
| 658 | Ga0590071_007895 | 3300059421 | Bacteria | 2516 |
| 659 | Ga0590071_017868 | 3300059421 | Bacteria | 1667 |
| 660 | Ga0590071_019247 | 3300059421 | Bacteria | 1606 |
| 661 | Ga0590071_025947 | 3300059421 | Bacteria | 1390 |
| 662 | Ga0590074_001496 | 3300059423 | Bacteria | 3773 |
| 663 | Ga0590074_002612 | 3300059423 | Bacteria | 2956 |
| 664 | Ga0590074_007523 | 3300059423 | Bacteria | 1810 |
| 665 | Ga0590075_001890 | 3300059424 | Bacteria | 5082 |
| 666 | Ga0590077_000022 | 3300059426 | Bacteria | 35588 |
| 667 | Ga0590077_000232 | 3300059426 | Bacteria | 15988 |
| 668 | Ga0587084_002340 | 3300059477 | Unclassified | 1950 |
| 669 | Ga0587093_004122 | 3300059478 | Bacteria | 1465 |
| 670 | Ga0587066_000022 | 3300059490 | Bacteria | 7063 |
| 671 | Ga0587077_000609 | 3300059493 | Unclassified | 3232 |
| 672 | Ga0587080_000484 | 3300059503 | Unclassified | 3414 |
| 673 | Ga0587082_000015 | 3300059504 | Bacteria | 8062 |
| 674 | Ga0587085_000330 | 3300059506 | Unclassified | 3276 |
| 675 | Ga0587088_000816 | 3300059508 | Unclassified | 2902 |
| 676 | Ga0587091_000091 | 3300059511 | Bacteria | 5068 |
| 677 | Ga0587094_000263 | 3300059513 | Unclassified | 3602 |
| 678 | Ga0587099_000992 | 3300059622 | Unclassified | 1895 |
| 679 | Ga0587072_000992 | 3300059643 | Unclassified | 3304 |
| 680 | Ga0587075_000008 | 3300059644 | Bacteria | 9548 |
| 681 | Ga0501082_0000072 | 3300060353 | Bacteria | 73322 |
| 682 | Ga0501082_0002039 | 3300060353 | Bacteria | 17754 |
| 683 | Ga0501082_0232812 | 3300060353 | Bacteria | 1603 |
| 684 | Ga0466962_0000017 | 3300061719 | Bacteria | 97361 |
| 685 | Ga0466962_0025790 | 3300061719 | Bacteria | 2821 |
| 686 | Ga0530510_0047805 | 3300061734 | Bacteria | 3092 |
| 687 | Ga0530510_0113535 | 3300061734 | Bacteria | 1985 |
| 688 | 2857614856 | 2857613821 | Bacteria | 4917088 |
| 689 | 2910248541 | 2910245624 | Bacteria | 6935613 |
| 690 | 8003014749 | 8003014200 | Bacteria | 4059994 |
| 691 | 8021623051 | 8021622325 | Bacteria | 4844743 |
| 692 | 8021629959 | 8021626552 | Bacteria | 4665214 |
| 693 | 8021650385 | 8021648035 | Bacteria | 4772378 |
| 694 | Ga0501075_0029266 | |||
| 695 | JGI24743J22301_10007917 | |||
| 696 | Ga0007416J51690_1041533 | |||
| 697 | Ga0032354_1020727 | |||
| 698 | Ga0032354_1021065 | |||
| 699 | Ga0058692_1000006 | |||
| 700 | Ga0058863_11748332 | |||
| 701 | Ga0058862_12292174 | |||
| 702 | Ga0058862_12842061 | |||
| 703 | Ga0065714_10073034 | |||
| 704 | Ga0065712_10003968 | |||
| 705 | Ga0065715_10001568 | |||
| 706 | Ga0070658_10000345 | |||
| 707 | Ga0070658_10000650 | |||
| 708 | Ga0070658_10002428 | |||
| 709 | Ga0070658_10010486 | |||
| 710 | Ga0070658_10045618 | |||
| 711 | Ga0070658_10046302 | |||
| 712 | Ga0070658_10145001 | |||
| 713 | Ga0070658_10150341 | |||
| 714 | Ga0070658_10348271 | |||
| 715 | Ga0070676_10048169 | |||
| 716 | Ga0070683_100003153 | |||
| 717 | Ga0070683_100039535 | |||
| 718 | Ga0070683_100070223 | |||
| 719 | Ga0070683_100083384 | |||
| 720 | Ga0070683_100204148 | |||
| 721 | Ga0070690_100046425 | |||
| 722 | Ga0070670_100001140 | |||
| 723 | Ga0068869_100003119 | |||
| 724 | Ga0070666_10017705 | |||
| 725 | Ga0070666_10052546 | |||
| 726 | Ga0070666_10071574 | |||
| 727 | Ga0070680_100000072 | |||
| 728 | Ga0070680_100006987 | |||
| 729 | Ga0070680_100007450 | |||
| 730 | Ga0070680_100300850 | |||
| 731 | Ga0068868_100000110 | |||
| 732 | Ga0068868_100122053 | |||
| 733 | Ga0070660_100014526 | |||
| 734 | Ga0070660_100032650 | |||
| 735 | Ga0070660_100033615 | |||
| 736 | Ga0070660_100174821 | |||
| 737 | Ga0070689_100016114 | |||
| 738 | Ga0070689_100016821 | |||
| 739 | Ga0070661_100003285 | |||
| 740 | Ga0070661_100013818 | |||
| 741 | Ga0070661_100035295 | |||
| 742 | Ga0070661_100042894 | |||
| 743 | Ga0070661_100050703 | |||
| 744 | Ga0070661_100061373 | |||
| 745 | Ga0070661_100186822 | |||
| 746 | Ga0070668_100067406 | |||
| 747 | Ga0070675_100008863 | |||
| 748 | Ga0070671_100001247 | |||
| 749 | Ga0070671_100012945 | |||
| 750 | Ga0070671_100017289 | |||
| 751 | Ga0070671_100094714 | |||
| 752 | Ga0070673_100004217 | |||
| 753 | Ga0070688_100001831 | |||
| 754 | Ga0070659_100037292 | |||
| 755 | Ga0070659_100093424 | |||
| 756 | Ga0070659_100145440 | |||
| 757 | Ga0070667_100000289 | |||
| 758 | Ga0070667_100035813 | |||
| 759 | Ga0070667_100201079 | |||
| 760 | Ga0070714_100085991 | |||
| 761 | Ga0070714_100134707 | |||
| 762 | Ga0070713_100096966 | |||
| 763 | Ga0070710_10028098 | |||
| 764 | Ga0070710_10066564 | |||
| 765 | Ga0070701_10153135 | |||
| 766 | Ga0070711_100074515 | |||
| 767 | Ga0070711_100227387 | |||
| 768 | Ga0070700_100154870 | |||
| 769 | Ga0070663_100185036 | |||
| 770 | Ga0070678_100094099 | |||
| 771 | Ga0070662_100163584 | |||
| 772 | Ga0070681_10001597 | |||
| 773 | Ga0070681_10048941 | |||
| 774 | Ga0070681_10090672 | |||
| 775 | Ga0070681_10090714 | |||
| 776 | Ga0070681_10109455 | |||
| 777 | Ga0070685_10003418 | |||
| 778 | Ga0070679_100000854 | |||
| 779 | Ga0070679_100002644 | |||
| 780 | Ga0070679_100104512 | |||
| 781 | Ga0070679_100139692 | |||
| 782 | Ga0070679_100204288 | |||
| 783 | Ga0070684_100000822 | |||
| 784 | Ga0070684_100063457 | |||
| 785 | Ga0070684_100077072 | |||
| 786 | Ga0068853_100000645 | |||
| 787 | Ga0068853_100021631 | |||
| 788 | Ga0068853_100049991 | |||
| 789 | Ga0068853_100054589 | |||
| 790 | Ga0068853_100080059 | |||
| 791 | Ga0068853_100342974 | |||
| 792 | Ga0070672_100133354 | |||
| 793 | Ga0070672_100176438 | |||
| 794 | Ga0070686_100025434 | |||
| 795 | Ga0070665_100000134 | |||
| 796 | Ga0070665_100024237 | |||
| 797 | Ga0070665_100108672 | |||
| 798 | Ga0068855_100003388 | |||
| 799 | Ga0068855_100003472 | |||
| 800 | Ga0068855_100004985 | |||
| 801 | Ga0068855_100005586 | |||
| 802 | Ga0068855_100017874 | |||
| 803 | Ga0068855_100022663 | |||
| 804 | Ga0068855_100026188 | |||
| 805 | Ga0068855_100032978 | |||
| 806 | Ga0068855_100037620 | |||
| 807 | Ga0068855_100045621 | |||
| 808 | Ga0068855_100058558 | |||
| 809 | Ga0068855_100072754 | |||
| 810 | Ga0068855_100175664 | |||
| 811 | Ga0068855_100291181 | |||
| 812 | Ga0068857_100002939 | |||
| 813 | Ga0068857_100003860 | |||
| 814 | Ga0068857_100007995 | |||
| 815 | Ga0068854_100007202 | |||
| 816 | Ga0068854_100027922 | |||
| 817 | Ga0068856_100002433 | |||
| 818 | Ga0068856_100011197 | |||
| 819 | Ga0068856_100023721 | |||
| 820 | Ga0068856_100049532 | |||
| 821 | Ga0068856_100059555 | |||
| 822 | Ga0068856_100115561 | |||
| 823 | Ga0068856_100150059 | |||
| 824 | Ga0068852_100000027 | |||
| 825 | Ga0068852_100001442 | |||
| 826 | Ga0068852_100029057 | |||
| 827 | Ga0068852_100060214 | |||
| 828 | Ga0068859_100003668 | |||
| 829 | Ga0068864_100001232 | |||
| 830 | Ga0068851_10006679 | |||
| 831 | Ga0068851_10017700 | |||
| 832 | Ga0068851_10024026 | |||
| 833 | Ga0068851_10043919 | |||
| 834 | Ga0068863_100002128 | |||
| 835 | Ga0068863_100054324 | |||
| 836 | Ga0068858_100015131 | |||
| 837 | Ga0068860_100083152 | |||
| 838 | Ga0068862_100240410 | |||
| 839 | Ga0081455_10026466 | |||
| 840 | Ga0081455_10028271 | |||
| 841 | Ga0081538_10017318 | |||
| 842 | Ga0081539_10000639 | |||
| 843 | Ga0070717_10003134 | |||
| 844 | Ga0070717_10020816 | |||
| 845 | Ga0070716_100024703 | |||
| 846 | Ga0070712_100157935 | |||
| 847 | Ga0097621_100005059 | |||
| 848 | Ga0068871_100000321 | |||
| 849 | Ga0075433_10039695 | |||
| 850 | Ga0075434_100000641 | |||
| 851 | Ga0075436_100000256 | |||
| 852 | Ga0075436_100049922 | |||
| 853 | Ga0097620_100003668 | |||
| 854 | Ga0105240_10000002 | |||
| 855 | Ga0105240_10000130 | |||
| 856 | Ga0105240_10000222 | |||
| 857 | Ga0105240_10005666 | |||
| 858 | Ga0105240_10006104 | |||
| 859 | Ga0105240_10012189 | |||
| 860 | Ga0105240_10015500 | |||
| 861 | Ga0105240_10027417 | |||
| 862 | Ga0105240_10080777 | |||
| 863 | Ga0105240_10086151 | |||
| 864 | Ga0105240_10172550 | |||
| 865 | Ga0111539_10043418 | |||
| 866 | Ga0105245_10000169 | |||
| 867 | Ga0105245_10067425 | |||
| 868 | Ga0105247_10035139 | |||
| 869 | Ga0114129_10432061 | |||
| 870 | Ga0105241_10000074 | |||
| 871 | Ga0105241_10002755 | |||
| 872 | Ga0105241_10004865 | |||
| 873 | Ga0105241_10096571 | |||
| 874 | Ga0105241_10115283 | |||
| 875 | Ga0105248_10006190 | |||
| 876 | Ga0105237_10004817 | |||
| 877 | Ga0105237_10015269 | |||
| 878 | Ga0105237_10083831 | |||
| 879 | Ga0105237_10107264 | |||
| 880 | Ga0105237_10134046 | |||
| 881 | Ga0105238_10000516 | |||
| 882 | Ga0105238_10001890 | |||
| 883 | Ga0105238_10003327 | |||
| 884 | Ga0105238_10010605 | |||
| 885 | Ga0105238_10028496 | |||
| 886 | Ga0105238_10032609 | |||
| 887 | Ga0105238_10044053 | |||
| 888 | Ga0105238_10075818 | |||
| 889 | Ga0105249_10019112 | |||
| 890 | Ga0105239_10003064 | |||
| 891 | Ga0105239_10026650 | |||
| 892 | Ga0105239_10036104 | |||
| 893 | Ga0105239_10092589 | |||
| 894 | Ga0105239_10114770 | |||
| 895 | Ga0105239_10179478 | |||
| 896 | Ga0105246_10004915 | |||
| 897 | Ga0157371_10009561 | |||
| 898 | Ga0157371_10027541 | |||
| 899 | Ga0157371_10131433 | |||
| 900 | Ga0157370_10001610 | |||
| 901 | Ga0157370_10003900 | |||
| 902 | Ga0157370_10030259 | |||
| 903 | Ga0157370_10067695 | |||
| 904 | Ga0157370_10190990 | |||
| 905 | Ga0157370_10284123 | |||
| 906 | Ga0157370_10368755 | |||
| 907 | Ga0157369_10000112 | |||
| 908 | Ga0157369_10005663 | |||
| 909 | Ga0157369_10006503 | |||
| 910 | Ga0157369_10011061 | |||
| 911 | Ga0157369_10019713 | |||
| 912 | Ga0157369_10021141 | |||
| 913 | Ga0157369_10028434 | |||
| 914 | Ga0157369_10034889 | |||
| 915 | Ga0157369_10041174 | |||
| 916 | Ga0157369_10053709 | |||
| 917 | Ga0157369_10103974 | |||
| 918 | Ga0157369_10109224 | |||
| 919 | Ga0157369_10123221 | |||
| 920 | Ga0157369_10201586 | |||
| 921 | Ga0157369_10317042 | |||
| 922 | Ga0157374_10003684 | |||
| 923 | Ga0157374_10040228 | |||
| 924 | Ga0157374_10212079 | |||
| 925 | Ga0157378_10013535 | |||
| 926 | Ga0157378_10068696 | |||
| 927 | Ga0163162_10007637 | |||
| 928 | Ga0157372_10000422 | |||
| 929 | Ga0157372_10001211 | |||
| 930 | Ga0157372_10001505 | |||
| 931 | Ga0157372_10002780 | |||
| 932 | Ga0157372_10005419 | |||
| 933 | Ga0157372_10010205 | |||
| 934 | Ga0157372_10014537 | |||
| 935 | Ga0157372_10029940 | |||
| 936 | Ga0157372_10077669 | |||
| 937 | Ga0157372_10114709 | |||
| 938 | Ga0157372_10118093 | |||
| 939 | Ga0157372_10159313 | |||
| 940 | Ga0157372_10188412 | |||
| 941 | Ga0157372_10489690 | |||
| 942 | Ga0157372_10540176 | |||
| 943 | Ga0157375_10009640 | |||
| 944 | Ga0157375_10013056 | |||
| 945 | Ga0163163_10000679 | |||
| 946 | Ga0182008_10092460 | |||
| 947 | Ga0182008_10112226 | |||
| 948 | Ga0157379_10000499 | |||
| 949 | Ga0157376_10006836 | |||
| 950 | Ga0157376_10049393 | |||
| 951 | Ga0182006_1013694 | |||
| 952 | Ga0197907_10413395 | |||
| 953 | Ga0206356_11119816 | |||
| 954 | Ga0206356_11224057 | |||
| 955 | Ga0206356_11259921 | |||
| 956 | Ga0206349_1887837 | |||
| 957 | Ga0206355_1317415 | |||
| 958 | Ga0206351_10173209 | |||
| 959 | Ga0206351_10279165 | |||
| 960 | Ga0206351_10397847 | |||
| 961 | Ga0206351_10501227 | |||
| 962 | Ga0206350_10152871 | |||
| 963 | Ga0206350_10326591 | |||
| 964 | Ga0206350_10331461 | |||
| 965 | Ga0206350_10856568 | |||
| 966 | Ga0206350_11147263 | |||
| 967 | Ga0206353_10373932 | |||
| 968 | Ga0206353_11873519 | |||
| 969 | Ga0213873_10000001 | |||
| 970 | Ga0213872_10021296 | |||
| 971 | Ga0213872_10038149 | |||
| 972 | Ga0213872_10074906 | |||
| 973 | Ga0213876_10000002 | |||
| 974 | Ga0213875_10000022 | |||
| 975 | Ga0213875_10000098 | |||
| 976 | Ga0213875_10001132 | |||
| 977 | Ga0213875_10001220 | |||
| 978 | Ga0213875_10012047 | |||
| 979 | Ga0224712_10000481 | |||
| 980 | Ga0224712_10000924 | |||
| 981 | Ga0224712_10003449 | |||
| 982 | Ga0224712_10042673 | |||
| 983 | Ga0207666_1000203 | |||
| 984 | Ga0207697_10001245 | |||
| 985 | Ga0207697_10002753 | |||
| 986 | Ga0207656_10012886 | |||
| 987 | Ga0207656_10016389 | |||
| 988 | Ga0207656_10022804 | |||
| 989 | Ga0207692_10068186 | |||
| 990 | Ga0207692_10098504 | |||
| 991 | Ga0207710_10018498 | |||
| 992 | Ga0207705_10003383 | |||
| 993 | Ga0207705_10009770 | |||
| 994 | Ga0207705_10013790 | |||
| 995 | Ga0207705_10021455 | |||
| 996 | Ga0207705_10224550 | |||
| 997 | Ga0207654_10000380 | |||
| 998 | Ga0207654_10001262 | |||
| 999 | Ga0207654_10075093 | |||
| 1000 | Ga0207707_10000481 | |||
| 1001 | Ga0207707_10001382 | |||
| 1002 | Ga0207707_10040309 | |||
| 1003 | Ga0207695_10000002 | |||
| 1004 | Ga0207695_10000028 | |||
| 1005 | Ga0207695_10000094 | |||
| 1006 | Ga0207695_10000177 | |||
| 1007 | Ga0207695_10000292 | |||
| 1008 | Ga0207695_10003411 | |||
| 1009 | Ga0207695_10013379 | |||
| 1010 | Ga0207695_10018270 | |||
| 1011 | Ga0207695_10029477 | |||
| 1012 | Ga0207695_10031688 | |||
| 1013 | Ga0207671_10000487 | |||
| 1014 | Ga0207671_10003647 | |||
| 1015 | Ga0207693_10040100 | |||
| 1016 | Ga0207663_10124525 | |||
| 1017 | Ga0207660_10000419 | |||
| 1018 | Ga0207660_10006095 | |||
| 1019 | Ga0207660_10023320 | |||
| 1020 | Ga0207660_10120254 | |||
| 1021 | Ga0207657_10002127 | |||
| 1022 | Ga0207657_10041017 | |||
| 1023 | Ga0207657_10060529 | |||
| 1024 | Ga0207657_10128475 | |||
| 1025 | Ga0207657_10176205 | |||
| 1026 | Ga0207657_10234294 | |||
| 1027 | Ga0207649_10001021 | |||
| 1028 | Ga0207649_10036626 | |||
| 1029 | Ga0207649_10047500 | |||
| 1030 | Ga0207652_10000148 | |||
| 1031 | Ga0207652_10002522 | |||
| 1032 | Ga0207652_10054285 | |||
| 1033 | Ga0207652_10171045 | |||
| 1034 | Ga0207694_10000160 | |||
| 1035 | Ga0207694_10001418 | |||
| 1036 | Ga0207694_10003078 | |||
| 1037 | Ga0207694_10016365 | |||
| 1038 | Ga0207694_10034558 | |||
| 1039 | Ga0207694_10073706 | |||
| 1040 | Ga0207694_10195322 | |||
| 1041 | Ga0207650_10006218 | |||
| 1042 | Ga0207687_10000471 | |||
| 1043 | Ga0207700_10013750 | |||
| 1044 | Ga0207700_10085582 | |||
| 1045 | Ga0207664_10058997 | |||
| 1046 | Ga0207664_10385871 | |||
| 1047 | Ga0207644_10018310 | |||
| 1048 | Ga0207644_10027025 | |||
| 1049 | Ga0207644_10029497 | |||
| 1050 | Ga0207644_10073260 | |||
| 1051 | Ga0207690_10095942 | |||
| 1052 | Ga0207690_10101045 | |||
| 1053 | Ga0207670_10010318 | |||
| 1054 | Ga0207670_10055887 | |||
| 1055 | Ga0207665_10023774 | |||
| 1056 | Ga0207691_10104014 | |||
| 1057 | Ga0207711_10024254 | |||
| 1058 | Ga0207689_10006228 | |||
| 1059 | Ga0207661_10020713 | |||
| 1060 | Ga0207661_10026617 | |||
| 1061 | Ga0207661_10041851 | |||
| 1062 | Ga0207661_10089413 | |||
| 1063 | Ga0207661_10163589 | |||
| 1064 | Ga0207661_10215437 | |||
| 1065 | Ga0207679_10052719 | |||
| 1066 | Ga0207667_10000056 | |||
| 1067 | Ga0207667_10002192 | |||
| 1068 | Ga0207667_10003095 | |||
| 1069 | Ga0207667_10014779 | |||
| 1070 | Ga0207667_10014961 | |||
| 1071 | Ga0207667_10044718 | |||
| 1072 | Ga0207667_10060830 | |||
| 1073 | Ga0207667_10156868 | |||
| 1074 | Ga0207667_10188096 | |||
| 1075 | Ga0207667_10206587 | |||
| 1076 | Ga0207667_10242541 | |||
| 1077 | Ga0207668_10074567 | |||
| 1078 | Ga0207640_10004197 | |||
| 1079 | Ga0207640_10070567 | |||
| 1080 | Ga0207658_10000549 | |||
| 1081 | Ga0207658_10041337 | |||
| 1082 | Ga0207677_10000055 | |||
| 1083 | Ga0207677_10099141 | |||
| 1084 | Ga0207703_10072517 | |||
| 1085 | Ga0207639_10000145 | |||
| 1086 | Ga0207639_10000460 | |||
| 1087 | Ga0207639_10016832 | |||
| 1088 | Ga0207639_10027069 | |||
| 1089 | Ga0207639_10154624 | |||
| 1090 | Ga0207678_10011955 | |||
| 1091 | Ga0207678_10045845 | |||
| 1092 | Ga0207708_10195103 | |||
| 1093 | Ga0207702_10001122 | |||
| 1094 | Ga0207702_10035114 | |||
| 1095 | Ga0207702_10067512 | |||
| 1096 | Ga0207702_10224718 | |||
| 1097 | Ga0207702_10259265 | |||
| 1098 | Ga0207641_10000596 | |||
| 1099 | Ga0207641_10203712 | |||
| 1100 | Ga0207676_10002442 | |||
| 1101 | Ga0207674_10001250 | |||
| 1102 | Ga0207674_10002359 | |||
| 1103 | Ga0207674_10020466 | |||
| 1104 | Ga0207698_10000021 | |||
| 1105 | Ga0207698_10061251 | |||
| 1106 | Ga0207698_10066020 | |||
| 1107 | Ga0207698_10191627 | |||
| 1108 | Ga0209371_1000016 | |||
| 1109 | Ga0268266_10000637 | |||
| 1110 | Ga0268266_10148142 | |||
| 1111 | Ga0268265_10075316 | |||
| 1112 | Ga0268264_10000433 | |||
| 1113 | Ga0268256_1000015 | |||
| 1114 | Ga0265327_10027096 | |||
| 1115 | Ga0307408_100019720 | |||
| 1116 | Ga0307408_100085860 | |||
| 1117 | Ga0307408_100119750 | |||
| 1118 | Ga0307408_100157716 | |||
| 1119 | Ga0316576_10007137 | |||
| 1120 | Ga0316578_10000808 | |||
| 1121 | Ga0307516_10007406 | |||
| 1122 | Ga0307405_10026664 | |||
| 1123 | Ga0307405_10051826 | |||
| 1124 | Ga0307405_10056826 | |||
| 1125 | Ga0307405_10163311 | |||
| 1126 | Ga0307413_10004354 | |||
| 1127 | Ga0307413_10035950 | |||
| 1128 | Ga0307413_10063501 | |||
| 1129 | Ga0307410_10000012 | |||
| 1130 | Ga0307410_10073607 | |||
| 1131 | Ga0307406_10000429 | |||
| 1132 | Ga0307406_10128122 | |||
| 1133 | Ga0307407_10000809 | |||
| 1134 | Ga0307407_10003796 | |||
| 1135 | Ga0307407_10004745 | |||
| 1136 | Ga0307407_10038198 | |||
| 1137 | Ga0307407_10057291 | |||
| 1138 | Ga0307407_10057996 | |||
| 1139 | Ga0307407_10094190 | |||
| 1140 | Ga0307412_10020065 | |||
| 1141 | Ga0307412_10027125 | |||
| 1142 | Ga0307412_10078647 | |||
| 1143 | Ga0307412_10081163 | |||
| 1144 | Ga0307412_10091642 | |||
| 1145 | Ga0307412_10095834 | |||
| 1146 | Ga0307412_10192740 | |||
| 1147 | Ga0307412_10205765 | |||
| 1148 | Ga0307409_100000202 | |||
| 1149 | Ga0307409_100000776 | |||
| 1150 | Ga0307409_100008829 | |||
| 1151 | Ga0307409_100016125 | |||
| 1152 | Ga0307409_100019725 | |||
| 1153 | Ga0307409_100028392 | |||
| 1154 | Ga0307416_100002055 | |||
| 1155 | Ga0307416_100004513 | |||
| 1156 | Ga0307416_100004568 | |||
| 1157 | Ga0307416_100008103 | |||
| 1158 | Ga0307416_100012459 | |||
| 1159 | Ga0307416_100104559 | |||
| 1160 | Ga0307416_100141337 | |||
| 1161 | Ga0307416_100216193 | |||
| 1162 | Ga0307414_10000001 | |||
| 1163 | Ga0307414_10000187 | |||
| 1164 | Ga0307414_10028651 | |||
| 1165 | Ga0307414_10032764 | |||
| 1166 | Ga0307414_10035984 | |||
| 1167 | Ga0307414_10054596 | |||
| 1168 | Ga0307411_10000001 | |||
| 1169 | Ga0307411_10010072 | |||
| 1170 | Ga0307411_10025703 | |||
| 1171 | Ga0307411_10149928 | |||
| 1172 | Ga0307411_10151253 | |||
| 1173 | Ga0307415_100006483 | |||
| 1174 | Ga0307415_100091304 | |||
| 1175 | Ga0307415_100153009 | |||
| 1176 | Ga0307415_100167392 | |||
| 1177 | Ga0307415_100284513 | |||
| 1178 | Ga0316580_10003585 | |||
| 1179 | Ga0373926_0009750 | |||
| 1180 | Ga0373953_0007522 | |||
| 1181 | Ga0373954_0022354 | |||
| 1182 | Ga0373956_0037041 | |||
| 1183 | Ga0373933_0005010 | |||
| 1184 | Ga0373937_0008999 | |||
| 1185 | Ga0316584_0004516 | |||
| 1186 | Ga0316584_0037359 | |||
| 1187 | Ga0373925_0282298 | |||
| 1188 | Ga0395900_0108357 | |||
| 1189 | Ga0395898_0019877 | |||
| 1190 | Ga0395898_0223176 | |||
| 1191 | Ga0395905_0046822 | |||
| 1192 | Ga0395905_0407569 | |||
| 1193 | Ga0436364_0530951 | |||
| 1194 | Ga0436364_0558108 | |||
| 1195 | Ga0436364_0566500 | |||
| 1196 | Ga0436364_0927813 | |||
| 1197 | Ga0436364_1325276 | |||
| 1198 | Ga0436364_1390920 | |||
| 1199 | Ga0436365_0190860 | |||
| 1200 | Ga0436365_0281631 | |||
| 1201 | Ga0436365_0813146 | |||
| 1202 | Ga0436365_1528146 | |||
| 1203 | Ga0436360_0034025 | |||
| 1204 | Ga0436360_0129245 | |||
| 1205 | Ga0436360_0247545 | |||
| 1206 | Ga0436360_0257927 | |||
| 1207 | Ga0436360_0373346 | |||
| 1208 | Ga0436361_0221137 | |||
| 1209 | Ga0436361_0323325 | |||
| 1210 | Ga0436361_0523980 | |||
| 1211 | Ga0436361_0765221 | |||
| 1212 | Ga0436361_0941399 | |||
| 1213 | Ga0436361_0997213 | |||
| 1214 | Ga0436363_0834601 | |||
| 1215 | Ga0436362_0429742 | |||
| 1216 | Ga0436362_0649416 | |||
| 1217 | Ga0439445_0035105 | |||
| 1218 | Ga0439448_0017508 | |||
| 1219 | Ga0451577_0301872 | |||
| 1220 | Ga0453683_0000194 | |||
| 1221 | Ga0453683_0000655 | |||
| 1222 | Ga0453683_0009023 | |||
| 1223 | Ga0466966_0146274 | |||
| 1224 | Ga0466961_0099692 | |||
| 1225 | Ga0466963_0022152 | |||
| 1226 | Ga0466963_0097910 | |||
| 1227 | Ga0453684_0001086 | |||
| 1228 | Ga0453684_0001215 | |||
| 1229 | Ga0453684_0001854 | |||
| 1230 | Ga0453684_0045814 | |||
| 1231 | Ga0453684_0095925 | |||
| 1232 | Ga0453684_0124438 | |||
| 1233 | Ga0453684_0283778 | |||
| 1234 | Ga0466971_0000020 | |||
| 1235 | Ga0466970_0002918 | |||
| 1236 | Ga0466957_0009810 | |||
| 1237 | Ga0466957_0041836 | |||
| 1238 | Ga0466957_0080447 | |||
| 1239 | Ga0466959_0071712 | |||
| 1240 | Ga0466959_0222703 | |||
| 1241 | Ga0451576_0000135 | |||
| 1242 | Ga0451576_0005678 | |||
| 1243 | Ga0466958_0038998 | |||
| 1244 | Ga0466958_0084694 | |||
| 1245 | Ga0466967_0002127 | |||
| 1246 | Ga0466967_0019542 | |||
| 1247 | Ga0466967_0024454 | |||
| 1248 | Ga0466967_0034868 | |||
| 1249 | Ga0466967_0044823 | |||
| 1250 | Ga0466967_0062381 | |||
| 1251 | Ga0495580_0044422 | |||
| 1252 | Ga0495610_0000741 | |||
| 1253 | Ga0495620_0001937 | |||
| 1254 | Ga0495620_0026522 | |||
| 1255 | Ga0495632_0019430 | |||
| 1256 | Ga0495642_0055178 | |||
| 1257 | Ga0495645_0023850 | |||
| 1258 | Ga0495625_0012365 | |||
| 1259 | Ga0495686_0007303 | |||
| 1260 | Ga0495686_0011196 | |||
| 1261 | Ga0496102_0153433 | |||
| 1262 | Ga0496104_0014966 | |||
| 1263 | Ga0496108_0308875 | |||
| 1264 | Ga0496109_0109004 | |||
| 1265 | Ga0496112_0003611 | |||
| 1266 | Ga0496112_0038502 | |||
| 1267 | Ga0496112_0284605 | |||
| 1268 | Ga0496113_0017282 | |||
| 1269 | Ga0501323_004310 | |||
| 1270 | Ga0501031_0014975 | |||
| 1271 | Ga0501031_0039359 | |||
| 1272 | Ga0501033_0019236 | |||
| 1273 | Ga0501034_0142646 | |||
| 1274 | Ga0501034_0239515 | |||
| 1275 | Ga0501036_0024337 | |||
| 1276 | Ga0501036_0030940 | |||
| 1277 | Ga0501037_0000240 | |||
| 1278 | Ga0501038_0030585 | |||
| 1279 | Ga0501038_0036575 | |||
| 1280 | Ga0501039_0049676 | |||
| 1281 | Ga0501039_0145499 | |||
| 1282 | Ga0501040_0001682 | |||
| 1283 | Ga0501040_0069168 | |||
| 1284 | Ga0501041_0003044 | |||
| 1285 | Ga0501042_0000935 | |||
| 1286 | Ga0501042_0005151 | |||
| 1287 | Ga0501043_0049989 | |||
| 1288 | Ga0501046_0007013 | |||
| 1289 | Ga0501046_0087707 | |||
| 1290 | Ga0501047_0235683 | |||
| 1291 | Ga0501048_0034730 | |||
| 1292 | Ga0501048_0039381 | |||
| 1293 | Ga0501067_0000849 | |||
| 1294 | Ga0501067_0049823 | |||
| 1295 | Ga0501067_0064111 | |||
| 1296 | Ga0501068_0009520 | |||
| 1297 | Ga0501069_0081649 | |||
| 1298 | Ga0501070_0019217 | |||
| 1299 | Ga0501070_0040158 | |||
| 1300 | Ga0501071_0005144 | |||
| 1301 | Ga0501071_0014009 | |||
| 1302 | Ga0501071_0103433 | |||
| 1303 | Ga0501072_0026890 | |||
| 1304 | Ga0501072_0183338 | |||
| 1305 | Ga0501073_0005253 | |||
| 1306 | Ga0501073_0135221 | |||
| 1307 | Ga0501073_0228257 | |||
| 1308 | Ga0501074_0051307 | |||
| 1309 | Ga0501075_0058535 | |||
| 1310 | Ga0501075_0238847 | |||
| 1311 | Ga0501076_0005738 | |||
| 1312 | Ga0501076_0011665 | |||
| 1313 | Ga0501076_0013165 | |||
| 1314 | Ga0501076_0175046 | |||
| 1315 | Ga0501076_0198657 | |||
| 1316 | Ga0501077_0000046 | |||
| 1317 | Ga0501077_0049491 | |||
| 1318 | Ga0501224_009848 | |||
| 1319 | Ga0501238_000091 | |||
| 1320 | Ga0501249_000011 | |||
| 1321 | Ga0501249_000854 | |||
| 1322 | Ga0501249_024946 | |||
| 1323 | Ga0501079_0017878 | |||
| 1324 | Ga0501080_0004063 | |||
| 1325 | Ga0501080_0047224 | |||
| 1326 | Ga0501080_0081093 | |||
| 1327 | Ga0501080_0258375 | |||
| 1328 | Ga0501083_0001353 | |||
| 1329 | Ga0501266_000016 | |||
| 1330 | Ga0501280_000271 | |||
| 1331 | Ga0501035_0006113 | |||
| 1332 | Ga0501035_0057940 | |||
| 1333 | Ga0501035_0318909 | |||
| 1334 | Ga0501044_0000957 | |||
| 1335 | Ga0501044_0249872 | |||
| 1336 | Ga0501045_0043791 | |||
| 1337 | Ga0501045_0201832 | |||
| 1338 | nmdc:mga06z11_74688_c1 | |||
| 1339 | nmdc:mga0n895_2275_c1 | |||
| 1340 | nmdc:mga0rr50_29956_c1 | |||
| 1341 | nmdc:mga08x19_20979_c1 | |||
| 1342 | nmdc:mga08x19_4578_c1 | |||
| 1343 | nmdc:mga0a205_6325_c1 | |||
| 1344 | Ga0495655_0031599 | |||
| 1345 | Ga0500633_0000311 | |||
| 1346 | Ga0501084_0085793 | |||
| 1347 | Ga0501084_0168728 | |||
| 1348 | Ga0590071_000585 | |||
| 1349 | Ga0590071_000919 | |||
| 1350 | Ga0590071_000953 | |||
| 1351 | Ga0590071_007895 | |||
| 1352 | Ga0590071_017868 | |||
| 1353 | Ga0590071_019247 | |||
| 1354 | Ga0590071_025947 | |||
| 1355 | Ga0590074_001496 | |||
| 1356 | Ga0590074_002612 | |||
| 1357 | Ga0590074_007523 | |||
| 1358 | Ga0590075_001890 | |||
| 1359 | Ga0590077_000022 | |||
| 1360 | Ga0590077_000232 | |||
| 1361 | Ga0587084_002340 | |||
| 1362 | Ga0587093_004122 | |||
| 1363 | Ga0587066_000022 | |||
| 1364 | Ga0587077_000609 | |||
| 1365 | Ga0587080_000484 | |||
| 1366 | Ga0587082_000015 | |||
| 1367 | Ga0587085_000330 | |||
| 1368 | Ga0587088_000816 | |||
| 1369 | Ga0587091_000091 | |||
| 1370 | Ga0587094_000263 | |||
| 1371 | Ga0587099_000992 | |||
| 1372 | Ga0587072_000992 | |||
| 1373 | Ga0587075_000008 | |||
| 1374 | Ga0501082_0000072 | |||
| 1375 | Ga0501082_0002039 | |||
| 1376 | Ga0501082_0232812 | |||
| 1377 | Ga0466962_0000017 | |||
| 1378 | Ga0466962_0025790 | |||
| 1379 | Ga0530510_0047805 | |||
| 1380 | Ga0530510_0113535 | |||
| 1381 | 2857614856 | |||
| 1382 | 2910248541 | |||
| 1383 | 8003014749 | |||
| 1384 | 8021623051 | |||
| 1385 | 8021629959 | |||
| 1386 | 8021650385 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kv9-assembly1.cif.gz_A-2 | moee5 in complex with udp-glucuronic acid and nad | 0.9205 | 1 | 345 |
| 6kvc-assembly1.cif.gz_A-2 | moee5 in complex with udp-glucose and nad | 0.9146 | 1 | 345 |
| 6dnt-assembly1.cif.gz_A-2 | udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid | 0.911 | 2 | 345 |
| 4zrn-assembly1.cif.gz_B | crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima | 0.9103 | 1 | 345 |
| 6kv9-assembly1.cif.gz_A-2 | moee5 in complex with udp-glucuronic acid and nad | 0.9057 | 1 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N670_2_342_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.933 | 3 | 342 | 3.40.50.720 |
| af_L7N670_2_342_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9251 | 3 | 342 | 3.40.50.720 |
| 4zrnB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9103 | 1 | 277 | 3.40.50.720 |
| af_P72050_1_314_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9079 | 1 | 350 | 3.40.50.720 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9061 | 175 | 355 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S4Y9C3-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9933 | 2 | 367 |
|
| AF-A0A250KYI1-F1-model_v4 | UDP-galactose 4-epimerase | 0.9899 | 2 | 367 |
|
| AF-S4Y9C3-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9879 | 2 | 367 |
|
| AF-A0A537M5A6-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9868 | 184 | 367 |
|
| AF-A0A538M237-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9864 | 2 | 367 |
|