F475683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 347 | 689 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_6642_c1|nmdc:mga08x19_6642_c1_4071_4556 |
| Length | 161 |
| Sequence | MLQLSDGDLSMKRTYSPKLAEIEHRWFVVDAAVVPLGRLSTLVAHLLMGKHKPTWAPHIDVGDFVIVVNAEKAVLTGRKEDQKMYHRHSGYPGGLKSVTAGQMRQRRPTKLVEEAVRGMLPKSKLGRQLARKLKVYAGPEHPHQAQQPTPLNPADAAQASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 2 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 3 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 4 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 115 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 194 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 224 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 228 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 334 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 337 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 338 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 339 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.5 |
| Metatranscriptomes | 6.93 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.87 |
| Nodule | 0.14 |
| Rhizoplane | 3.03 |
| Rhizosphere | 94.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10081659 | 3300002239 | Bacteria | 591 |
| 2 | rootH2_10021145 | 3300003320 | Bacteria | 6684 |
| 3 | rootH2_10080382 | 3300003320 | Bacteria | 1106 |
| 4 | rootL2_10015203 | 3300003322 | Bacteria | 2099 |
| 5 | Ga0058858_1410928 | 3300004785 | Bacteria | 760 |
| 6 | Ga0058859_11553821 | 3300004798 | Bacteria | 868 |
| 7 | Ga0058863_11594059 | 3300004799 | Bacteria | 792 |
| 8 | Ga0058861_11268347 | 3300004800 | Bacteria | 754 |
| 9 | Ga0058862_12433139 | 3300004803 | Bacteria | 881 |
| 10 | Ga0058862_12851463 | 3300004803 | Bacteria | 1474 |
| 11 | Ga0065714_10138911 | 3300005288 | Bacteria | 1187 |
| 12 | Ga0065704_10308306 | 3300005289 | Unclassified | 873 |
| 13 | Ga0065707_10215047 | 3300005295 | Bacteria | 1248 |
| 14 | Ga0070658_10000006 | 3300005327 | Bacteria | 374835 |
| 15 | Ga0070658_10007225 | 3300005327 | Bacteria | 8964 |
| 16 | Ga0070658_10038379 | 3300005327 | Bacteria | 3862 |
| 17 | Ga0070658_10039592 | 3300005327 | Bacteria | 3802 |
| 18 | Ga0070658_10134911 | 3300005327 | Bacteria | 2058 |
| 19 | Ga0070658_10137527 | 3300005327 | Bacteria | 2039 |
| 20 | Ga0070658_10232851 | 3300005327 | Bacteria | 1560 |
| 21 | Ga0070658_10398281 | 3300005327 | Bacteria | 1182 |
| 22 | Ga0070683_100009432 | 3300005329 | Bacteria | 8347 |
| 23 | Ga0070683_100288005 | 3300005329 | Bacteria | 1562 |
| 24 | Ga0070690_100365598 | 3300005330 | Bacteria | 1051 |
| 25 | Ga0070670_100334747 | 3300005331 | Bacteria | 1328 |
| 26 | Ga0070666_10030165 | 3300005335 | Bacteria | 3571 |
| 27 | Ga0070666_10127318 | 3300005335 | Bacteria | 1768 |
| 28 | Ga0070680_100108365 | 3300005336 | Bacteria | 2311 |
| 29 | Ga0070680_100651889 | 3300005336 | Bacteria | 905 |
| 30 | Ga0070682_100373030 | 3300005337 | Bacteria | 1071 |
| 31 | Ga0068868_100825760 | 3300005338 | Bacteria | 838 |
| 32 | Ga0070660_100002152 | 3300005339 | Bacteria | 13591 |
| 33 | Ga0070660_100013713 | 3300005339 | Bacteria | 5826 |
| 34 | Ga0070660_100028144 | 3300005339 | Bacteria | 4203 |
| 35 | Ga0070660_100087764 | 3300005339 | Bacteria | 2448 |
| 36 | Ga0070660_100134075 | 3300005339 | Bacteria | 1984 |
| 37 | Ga0070689_100144210 | 3300005340 | Bacteria | 1917 |
| 38 | Ga0070691_10170258 | 3300005341 | Bacteria | 1128 |
| 39 | Ga0070687_100555500 | 3300005343 | Bacteria | 782 |
| 40 | Ga0070661_100116121 | 3300005344 | Bacteria | 2002 |
| 41 | Ga0070661_100222700 | 3300005344 | Bacteria | 1448 |
| 42 | Ga0070669_100000164 | 3300005353 | Bacteria | 58203 |
| 43 | Ga0070675_100383110 | 3300005354 | Bacteria | 1252 |
| 44 | Ga0070675_100672476 | 3300005354 | Bacteria | 942 |
| 45 | Ga0070671_100001020 | 3300005355 | Bacteria | 20592 |
| 46 | Ga0070673_100020375 | 3300005364 | Bacteria | 4783 |
| 47 | Ga0070673_100223203 | 3300005364 | Bacteria | 1632 |
| 48 | Ga0070673_102027871 | 3300005364 | Bacteria | 546 |
| 49 | Ga0070688_100061220 | 3300005365 | Bacteria | 2379 |
| 50 | Ga0070688_100350705 | 3300005365 | Bacteria | 1080 |
| 51 | Ga0070659_100010337 | 3300005366 | Bacteria | 6864 |
| 52 | Ga0070659_100292248 | 3300005366 | Bacteria | 1357 |
| 53 | Ga0070659_101142249 | 3300005366 | Bacteria | 687 |
| 54 | Ga0070667_100874256 | 3300005367 | Bacteria | 836 |
| 55 | Ga0070709_10272640 | 3300005434 | Bacteria | 1227 |
| 56 | Ga0070709_10281533 | 3300005434 | Bacteria | 1209 |
| 57 | Ga0070714_100270392 | 3300005435 | Bacteria | 1576 |
| 58 | Ga0070713_101251718 | 3300005436 | Bacteria | 719 |
| 59 | Ga0070713_101268654 | 3300005436 | Bacteria | 714 |
| 60 | Ga0070710_10232429 | 3300005437 | Bacteria | 1178 |
| 61 | Ga0070701_10292922 | 3300005438 | Bacteria | 998 |
| 62 | Ga0070705_100252361 | 3300005440 | Bacteria | 1239 |
| 63 | Ga0070705_100793432 | 3300005440 | Bacteria | 753 |
| 64 | Ga0070700_100170164 | 3300005441 | Bacteria | 1508 |
| 65 | Ga0070694_100155421 | 3300005444 | Bacteria | 1674 |
| 66 | Ga0070663_100013088 | 3300005455 | Bacteria | 5272 |
| 67 | Ga0070663_100046729 | 3300005455 | Bacteria | 3064 |
| 68 | Ga0070663_100079185 | 3300005455 | Bacteria | 2410 |
| 69 | Ga0070663_100179349 | 3300005455 | Bacteria | 1642 |
| 70 | Ga0070663_100318968 | 3300005455 | Bacteria | 1249 |
| 71 | Ga0070681_10093860 | 3300005458 | Bacteria | 2950 |
| 72 | Ga0070681_10198698 | 3300005458 | Bacteria | 1924 |
| 73 | Ga0070681_10334243 | 3300005458 | Bacteria | 1424 |
| 74 | Ga0070681_10399810 | 3300005458 | Bacteria | 1285 |
| 75 | Ga0070681_10826020 | 3300005458 | Bacteria | 844 |
| 76 | Ga0068867_100791107 | 3300005459 | Bacteria | 845 |
| 77 | Ga0068867_101786507 | 3300005459 | Bacteria | 578 |
| 78 | Ga0070698_100551473 | 3300005471 | Bacteria | 1092 |
| 79 | Ga0070679_100000607 | 3300005530 | Bacteria | 30473 |
| 80 | Ga0070679_100006064 | 3300005530 | Bacteria | 11247 |
| 81 | Ga0070679_100024592 | 3300005530 | Bacteria | 5905 |
| 82 | Ga0070679_100059401 | 3300005530 | Bacteria | 3811 |
| 83 | Ga0070684_100005900 | 3300005535 | Bacteria | 9431 |
| 84 | Ga0070684_100110235 | 3300005535 | Bacteria | 2467 |
| 85 | Ga0070684_100591579 | 3300005535 | Bacteria | 1031 |
| 86 | Ga0068853_100000174 | 3300005539 | Bacteria | 44771 |
| 87 | Ga0068853_100044099 | 3300005539 | Bacteria | 3818 |
| 88 | Ga0068853_100058163 | 3300005539 | Bacteria | 3337 |
| 89 | Ga0068853_100841656 | 3300005539 | Bacteria | 880 |
| 90 | Ga0068853_102204399 | 3300005539 | Bacteria | 534 |
| 91 | Ga0070672_100240086 | 3300005543 | Bacteria | 1524 |
| 92 | Ga0070672_100727709 | 3300005543 | Bacteria | 870 |
| 93 | Ga0070686_100078006 | 3300005544 | Bacteria | 2186 |
| 94 | Ga0070686_100313514 | 3300005544 | Bacteria | 1167 |
| 95 | Ga0070665_100000280 | 3300005548 | Bacteria | 83526 |
| 96 | Ga0070665_100004995 | 3300005548 | Bacteria | 13757 |
| 97 | Ga0070704_100023634 | 3300005549 | Bacteria | 4020 |
| 98 | Ga0070704_100578349 | 3300005549 | Bacteria | 985 |
| 99 | Ga0068855_100007178 | 3300005563 | Bacteria | 13520 |
| 100 | Ga0068855_100154131 | 3300005563 | Bacteria | 2611 |
| 101 | Ga0068855_100174182 | 3300005563 | Bacteria | 2435 |
| 102 | Ga0068855_100291926 | 3300005563 | Bacteria | 1807 |
| 103 | Ga0068855_100301722 | 3300005563 | Bacteria | 1773 |
| 104 | Ga0070664_100057304 | 3300005564 | Bacteria | 3312 |
| 105 | Ga0070664_100299054 | 3300005564 | Bacteria | 1454 |
| 106 | Ga0070664_100748375 | 3300005564 | Bacteria | 912 |
| 107 | Ga0068857_100017675 | 3300005577 | Bacteria | 6254 |
| 108 | Ga0068857_100052519 | 3300005577 | Bacteria | 3616 |
| 109 | Ga0068854_100000186 | 3300005578 | Bacteria | 41742 |
| 110 | Ga0068854_100218723 | 3300005578 | Bacteria | 1506 |
| 111 | Ga0068854_100473915 | 3300005578 | Bacteria | 1050 |
| 112 | Ga0068854_101619604 | 3300005578 | Bacteria | 590 |
| 113 | Ga0068856_100013051 | 3300005614 | Bacteria | 8047 |
| 114 | Ga0068856_100850196 | 3300005614 | Bacteria | 932 |
| 115 | Ga0068852_100042793 | 3300005616 | Bacteria | 3836 |
| 116 | Ga0068852_100064951 | 3300005616 | Bacteria | 3183 |
| 117 | Ga0068852_100128851 | 3300005616 | Bacteria | 2327 |
| 118 | Ga0068859_100018092 | 3300005617 | Bacteria | 7082 |
| 119 | Ga0068864_100009360 | 3300005618 | Bacteria | 8083 |
| 120 | Ga0068864_100090822 | 3300005618 | Bacteria | 2693 |
| 121 | Ga0068861_100326568 | 3300005719 | Bacteria | 1338 |
| 122 | Ga0068870_10501858 | 3300005840 | Bacteria | 809 |
| 123 | Ga0068863_100004076 | 3300005841 | Bacteria | 14431 |
| 124 | Ga0068858_100570505 | 3300005842 | Bacteria | 1096 |
| 125 | Ga0068860_100481533 | 3300005843 | Bacteria | 1237 |
| 126 | Ga0068860_101084191 | 3300005843 | Bacteria | 820 |
| 127 | Ga0070717_10001558 | 3300006028 | Bacteria | 15887 |
| 128 | Ga0070717_10404308 | 3300006028 | Bacteria | 1227 |
| 129 | Ga0075368_10012903 | 3300006042 | Bacteria | 3061 |
| 130 | Ga0075364_10128675 | 3300006051 | Bacteria | 1699 |
| 131 | Ga0070715_10404038 | 3300006163 | Bacteria | 760 |
| 132 | Ga0070715_10432069 | 3300006163 | Bacteria | 739 |
| 133 | Ga0075367_10110568 | 3300006178 | Bacteria | 1686 |
| 134 | Ga0075369_10004944 | 3300006186 | Bacteria | 4958 |
| 135 | Ga0097621_100000066 | 3300006237 | Bacteria | 54619 |
| 136 | Ga0097621_100662576 | 3300006237 | Bacteria | 958 |
| 137 | Ga0068871_100000170 | 3300006358 | Bacteria | 43522 |
| 138 | Ga0068871_100346660 | 3300006358 | Bacteria | 1313 |
| 139 | Ga0075428_100025549 | 3300006844 | Bacteria | 6539 |
| 140 | Ga0075428_100188315 | 3300006844 | Bacteria | 2232 |
| 141 | Ga0075433_10006367 | 3300006852 | Bacteria | 9334 |
| 142 | Ga0075433_10076442 | 3300006852 | Bacteria | 2948 |
| 143 | Ga0075434_100000005 | 3300006871 | Bacteria | 104425 |
| 144 | Ga0075434_100051793 | 3300006871 | Bacteria | 4079 |
| 145 | Ga0075434_100110513 | 3300006871 | Bacteria | 2759 |
| 146 | Ga0075434_100134374 | 3300006871 | Bacteria | 2493 |
| 147 | Ga0075434_100287013 | 3300006871 | Bacteria | 1665 |
| 148 | Ga0075429_100013415 | 3300006880 | Bacteria | 7106 |
| 149 | Ga0068865_100316941 | 3300006881 | Bacteria | 1253 |
| 150 | Ga0075436_100007285 | 3300006914 | Bacteria | 7566 |
| 151 | Ga0075436_100019506 | 3300006914 | Bacteria | 4647 |
| 152 | Ga0097620_100018092 | 3300006931 | Bacteria | 7082 |
| 153 | Ga0075435_100024980 | 3300007076 | Bacteria | 4645 |
| 154 | Ga0075435_100032075 | 3300007076 | Bacteria | 4147 |
| 155 | Ga0075435_100286507 | 3300007076 | Bacteria | 1407 |
| 156 | Ga0105244_10053379 | 3300009036 | Bacteria | 2054 |
| 157 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 158 | Ga0105240_10018617 | 3300009093 | Bacteria | 9311 |
| 159 | Ga0105240_10094503 | 3300009093 | Bacteria | 3646 |
| 160 | Ga0105240_10108808 | 3300009093 | Bacteria | 3357 |
| 161 | Ga0105240_10152842 | 3300009093 | Bacteria | 2747 |
| 162 | Ga0105240_10411545 | 3300009093 | Bacteria | 1521 |
| 163 | Ga0105240_10483312 | 3300009093 | Bacteria | 1380 |
| 164 | Ga0105240_11213535 | 3300009093 | Bacteria | 798 |
| 165 | Ga0111539_10102893 | 3300009094 | Bacteria | 3352 |
| 166 | Ga0111539_10949297 | 3300009094 | Bacteria | 1000 |
| 167 | Ga0105245_10006935 | 3300009098 | Bacteria | 9931 |
| 168 | Ga0105247_10207684 | 3300009101 | Bacteria | 1319 |
| 169 | Ga0114129_10104725 | 3300009147 | Bacteria | 3910 |
| 170 | Ga0114129_10271377 | 3300009147 | Bacteria | 2269 |
| 171 | Ga0114129_10331348 | 3300009147 | Bacteria | 2021 |
| 172 | Ga0105241_10316100 | 3300009174 | Bacteria | 1345 |
| 173 | Ga0105248_10256222 | 3300009177 | Bacteria | 1970 |
| 174 | Ga0105248_10347645 | 3300009177 | Bacteria | 1669 |
| 175 | Ga0105248_10604239 | 3300009177 | Bacteria | 1238 |
| 176 | Ga0105237_10068357 | 3300009545 | Bacteria | 3546 |
| 177 | Ga0105237_10328505 | 3300009545 | Bacteria | 1533 |
| 178 | Ga0105237_11438114 | 3300009545 | Bacteria | 696 |
| 179 | Ga0105238_10005301 | 3300009551 | Bacteria | 12738 |
| 180 | Ga0105238_10122060 | 3300009551 | Bacteria | 2585 |
| 181 | Ga0105238_10320094 | 3300009551 | Bacteria | 1537 |
| 182 | Ga0105249_10100341 | 3300009553 | Bacteria | 2722 |
| 183 | Ga0105249_10163025 | 3300009553 | Bacteria | 2156 |
| 184 | Ga0105249_11136780 | 3300009553 | Bacteria | 851 |
| 185 | Ga0105239_10669784 | 3300010375 | Bacteria | 1185 |
| 186 | Ga0157373_10454492 | 3300013100 | Bacteria | 922 |
| 187 | Ga0157371_10007064 | 3300013102 | Bacteria | 9136 |
| 188 | Ga0157371_10135608 | 3300013102 | Bacteria | 1753 |
| 189 | Ga0157371_10174405 | 3300013102 | Bacteria | 1537 |
| 190 | Ga0157371_10301745 | 3300013102 | Bacteria | 1159 |
| 191 | Ga0157370_10012273 | 3300013104 | Bacteria | 8893 |
| 192 | Ga0157370_10051672 | 3300013104 | Bacteria | 3926 |
| 193 | Ga0157370_10103328 | 3300013104 | Bacteria | 2667 |
| 194 | Ga0157370_10113995 | 3300013104 | Bacteria | 2526 |
| 195 | Ga0157370_10188281 | 3300013104 | Bacteria | 1916 |
| 196 | Ga0157370_10391993 | 3300013104 | Bacteria | 1279 |
| 197 | Ga0157370_10758244 | 3300013104 | Bacteria | 884 |
| 198 | Ga0157370_11074699 | 3300013104 | Bacteria | 727 |
| 199 | Ga0157370_11457419 | 3300013104 | Bacteria | 616 |
| 200 | Ga0157369_10013690 | 3300013105 | Bacteria | 9170 |
| 201 | Ga0157369_10036291 | 3300013105 | Bacteria | 5402 |
| 202 | Ga0157369_10068261 | 3300013105 | Bacteria | 3819 |
| 203 | Ga0157369_10075191 | 3300013105 | Bacteria | 3622 |
| 204 | Ga0157369_10116262 | 3300013105 | Bacteria | 2840 |
| 205 | Ga0157369_10228469 | 3300013105 | Bacteria | 1946 |
| 206 | Ga0157369_10359774 | 3300013105 | Bacteria | 1511 |
| 207 | Ga0157369_10469038 | 3300013105 | Bacteria | 1303 |
| 208 | Ga0157369_10510624 | 3300013105 | Bacteria | 1243 |
| 209 | Ga0157369_10793528 | 3300013105 | Unclassified | 973 |
| 210 | Ga0157369_11710280 | 3300013105 | Bacteria | 639 |
| 211 | Ga0157374_10088179 | 3300013296 | Bacteria | 2955 |
| 212 | Ga0157374_10104913 | 3300013296 | Bacteria | 2714 |
| 213 | Ga0157374_10168865 | 3300013296 | Bacteria | 2133 |
| 214 | Ga0157374_10271103 | 3300013296 | Bacteria | 1673 |
| 215 | Ga0157374_11177568 | 3300013296 | Bacteria | 788 |
| 216 | Ga0157378_10358353 | 3300013297 | Bacteria | 1427 |
| 217 | Ga0157378_10961232 | 3300013297 | Bacteria | 887 |
| 218 | Ga0163162_10007900 | 3300013306 | Bacteria | 10367 |
| 219 | Ga0163162_10876899 | 3300013306 | Bacteria | 1011 |
| 220 | Ga0157372_10005308 | 3300013307 | Bacteria | 13687 |
| 221 | Ga0157372_10040606 | 3300013307 | Bacteria | 5139 |
| 222 | Ga0157372_10096540 | 3300013307 | Bacteria | 3369 |
| 223 | Ga0157372_10096633 | 3300013307 | Bacteria | 3367 |
| 224 | Ga0157372_10169742 | 3300013307 | Bacteria | 2524 |
| 225 | Ga0157372_10273045 | 3300013307 | Bacteria | 1965 |
| 226 | Ga0157372_10691043 | 3300013307 | Bacteria | 1187 |
| 227 | Ga0157372_11497160 | 3300013307 | Bacteria | 777 |
| 228 | Ga0157375_10059475 | 3300013308 | Bacteria | 3786 |
| 229 | Ga0157375_11577136 | 3300013308 | Bacteria | 776 |
| 230 | Ga0163163_10003334 | 3300014325 | Bacteria | 13627 |
| 231 | Ga0163163_10762424 | 3300014325 | Bacteria | 1031 |
| 232 | Ga0157380_10004468 | 3300014326 | Bacteria | 9690 |
| 233 | Ga0157380_10435330 | 3300014326 | Bacteria | 1255 |
| 234 | Ga0157377_10646896 | 3300014745 | Bacteria | 760 |
| 235 | Ga0157379_10094694 | 3300014968 | Bacteria | 2680 |
| 236 | Ga0157379_10182718 | 3300014968 | Bacteria | 1895 |
| 237 | Ga0157379_11921050 | 3300014968 | Bacteria | 584 |
| 238 | Ga0157376_10156139 | 3300014969 | Bacteria | 2063 |
| 239 | Ga0157376_10199452 | 3300014969 | Bacteria | 1840 |
| 240 | Ga0157376_10519561 | 3300014969 | Bacteria | 1173 |
| 241 | Ga0184595_107919 | 3300019166 | Bacteria | 769 |
| 242 | Ga0184595_123911 | 3300019166 | Bacteria | 533 |
| 243 | Ga0197907_10738779 | 3300020069 | Bacteria | 679 |
| 244 | Ga0197907_11223624 | 3300020069 | Bacteria | 1765 |
| 245 | Ga0206356_11110856 | 3300020070 | Bacteria | 2257 |
| 246 | Ga0206356_11659320 | 3300020070 | Bacteria | 815 |
| 247 | Ga0206349_1877071 | 3300020075 | Bacteria | 923 |
| 248 | Ga0206355_1388814 | 3300020076 | Bacteria | 2191 |
| 249 | Ga0206355_1537879 | 3300020076 | Bacteria | 647 |
| 250 | Ga0206355_1618829 | 3300020076 | Bacteria | 1504 |
| 251 | Ga0206351_10677131 | 3300020077 | Bacteria | 1293 |
| 252 | Ga0206352_10308703 | 3300020078 | Bacteria | 1181 |
| 253 | Ga0206352_10599768 | 3300020078 | Bacteria | 1047 |
| 254 | Ga0206352_11016995 | 3300020078 | Bacteria | 1759 |
| 255 | Ga0206350_11323274 | 3300020080 | Bacteria | 2180 |
| 256 | Ga0206354_11100117 | 3300020081 | Bacteria | 910 |
| 257 | Ga0206354_11456630 | 3300020081 | Bacteria | 1594 |
| 258 | Ga0206353_11159178 | 3300020082 | Bacteria | 1439 |
| 259 | Ga0154015_1134506 | 3300020610 | Bacteria | 1841 |
| 260 | Ga0224712_10029435 | 3300022467 | Bacteria | 1972 |
| 261 | Ga0224712_10172953 | 3300022467 | Unclassified | 969 |
| 262 | Ga0224712_10195201 | 3300022467 | Bacteria | 918 |
| 263 | Ga0247553_100730 | 3300023672 | Bacteria | 1267 |
| 264 | Ga0207692_10212724 | 3300025898 | Bacteria | 1142 |
| 265 | Ga0207680_10414009 | 3300025903 | Bacteria | 954 |
| 266 | Ga0207647_10032975 | 3300025904 | Bacteria | 3321 |
| 267 | Ga0207647_10177104 | 3300025904 | Bacteria | 1240 |
| 268 | Ga0207699_10228473 | 3300025906 | Bacteria | 1274 |
| 269 | Ga0207645_10013115 | 3300025907 | Bacteria | 5599 |
| 270 | Ga0207643_10285319 | 3300025908 | Bacteria | 1024 |
| 271 | Ga0207705_10000012 | 3300025909 | Bacteria | 472336 |
| 272 | Ga0207705_10001912 | 3300025909 | Bacteria | 16281 |
| 273 | Ga0207705_10002156 | 3300025909 | Bacteria | 15252 |
| 274 | Ga0207705_10010724 | 3300025909 | Bacteria | 6653 |
| 275 | Ga0207705_10019852 | 3300025909 | Bacteria | 4807 |
| 276 | Ga0207705_10076147 | 3300025909 | Bacteria | 2439 |
| 277 | Ga0207705_10146373 | 3300025909 | Bacteria | 1768 |
| 278 | Ga0207705_10151788 | 3300025909 | Bacteria | 1736 |
| 279 | Ga0207705_10186418 | 3300025909 | Bacteria | 1567 |
| 280 | Ga0207654_10273656 | 3300025911 | Bacteria | 1140 |
| 281 | Ga0207707_10023728 | 3300025912 | Bacteria | 5365 |
| 282 | Ga0207707_10065953 | 3300025912 | Bacteria | 3152 |
| 283 | Ga0207707_10068125 | 3300025912 | Bacteria | 3100 |
| 284 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 285 | Ga0207695_10008216 | 3300025913 | Bacteria | 13110 |
| 286 | Ga0207695_10084834 | 3300025913 | Bacteria | 3197 |
| 287 | Ga0207695_10129252 | 3300025913 | Bacteria | 2485 |
| 288 | Ga0207695_10192236 | 3300025913 | Bacteria | 1958 |
| 289 | Ga0207695_10234786 | 3300025913 | Bacteria | 1737 |
| 290 | Ga0207695_10542425 | 3300025913 | Bacteria | 1044 |
| 291 | Ga0207671_11494245 | 3300025914 | Bacteria | 522 |
| 292 | Ga0207693_10252561 | 3300025915 | Bacteria | 1383 |
| 293 | Ga0207660_10015830 | 3300025917 | Bacteria | 4984 |
| 294 | Ga0207662_10555980 | 3300025918 | Bacteria | 795 |
| 295 | Ga0207657_10001507 | 3300025919 | Bacteria | 24916 |
| 296 | Ga0207657_10008653 | 3300025919 | Bacteria | 10304 |
| 297 | Ga0207657_10017115 | 3300025919 | Bacteria | 6967 |
| 298 | Ga0207657_10026932 | 3300025919 | Bacteria | 5272 |
| 299 | Ga0207657_10194237 | 3300025919 | Bacteria | 1636 |
| 300 | Ga0207657_10394359 | 3300025919 | Bacteria | 1089 |
| 301 | Ga0207649_10037830 | 3300025920 | Bacteria | 2917 |
| 302 | Ga0207649_10112141 | 3300025920 | Bacteria | 1824 |
| 303 | Ga0207649_11410316 | 3300025920 | Bacteria | 551 |
| 304 | Ga0207652_10011368 | 3300025921 | Bacteria | 7173 |
| 305 | Ga0207652_10105438 | 3300025921 | Bacteria | 2494 |
| 306 | Ga0207652_10127248 | 3300025921 | Bacteria | 2270 |
| 307 | Ga0207681_10000056 | 3300025923 | Bacteria | 106145 |
| 308 | Ga0207681_10289314 | 3300025923 | Bacteria | 1293 |
| 309 | Ga0207694_10007162 | 3300025924 | Bacteria | 8474 |
| 310 | Ga0207694_10177219 | 3300025924 | Bacteria | 1727 |
| 311 | Ga0207694_10183553 | 3300025924 | Bacteria | 1697 |
| 312 | Ga0207650_10030159 | 3300025925 | Bacteria | 3904 |
| 313 | Ga0207687_10391695 | 3300025927 | Bacteria | 1141 |
| 314 | Ga0207700_10295694 | 3300025928 | Bacteria | 1397 |
| 315 | Ga0207700_10736688 | 3300025928 | Bacteria | 881 |
| 316 | Ga0207664_10256876 | 3300025929 | Bacteria | 1527 |
| 317 | Ga0207664_10260763 | 3300025929 | Bacteria | 1516 |
| 318 | Ga0207644_10030504 | 3300025931 | Bacteria | 3750 |
| 319 | Ga0207690_10002265 | 3300025932 | Bacteria | 11729 |
| 320 | Ga0207690_10030551 | 3300025932 | Bacteria | 3438 |
| 321 | Ga0207690_10119581 | 3300025932 | Bacteria | 1911 |
| 322 | Ga0207706_10064861 | 3300025933 | Bacteria | 3216 |
| 323 | Ga0207686_11015805 | 3300025934 | Bacteria | 673 |
| 324 | Ga0207670_10033206 | 3300025936 | Bacteria | 3324 |
| 325 | Ga0207704_11529824 | 3300025938 | Bacteria | 573 |
| 326 | Ga0207711_10062364 | 3300025941 | Bacteria | 3216 |
| 327 | Ga0207711_10077219 | 3300025941 | Bacteria | 2902 |
| 328 | Ga0207711_10165572 | 3300025941 | Bacteria | 2004 |
| 329 | Ga0207711_10290489 | 3300025941 | Bacteria | 1507 |
| 330 | Ga0207689_10061204 | 3300025942 | Bacteria | 3095 |
| 331 | Ga0207661_10207245 | 3300025944 | Bacteria | 1726 |
| 332 | Ga0207679_10015483 | 3300025945 | Bacteria | 5041 |
| 333 | Ga0207679_10683648 | 3300025945 | Bacteria | 930 |
| 334 | Ga0207667_10009317 | 3300025949 | Bacteria | 11579 |
| 335 | Ga0207667_10016157 | 3300025949 | Bacteria | 8440 |
| 336 | Ga0207667_10032870 | 3300025949 | Bacteria | 5584 |
| 337 | Ga0207667_10050332 | 3300025949 | Bacteria | 4396 |
| 338 | Ga0207667_10088266 | 3300025949 | Bacteria | 3207 |
| 339 | Ga0207667_10281503 | 3300025949 | Bacteria | 1699 |
| 340 | Ga0207667_10579575 | 3300025949 | Bacteria | 1133 |
| 341 | Ga0207667_11381590 | 3300025949 | Bacteria | 678 |
| 342 | Ga0207651_10006568 | 3300025960 | Bacteria | 6109 |
| 343 | Ga0207651_10191582 | 3300025960 | Bacteria | 1631 |
| 344 | Ga0207712_10146032 | 3300025961 | Bacteria | 1821 |
| 345 | Ga0207640_10000034 | 3300025981 | Bacteria | 112705 |
| 346 | Ga0207658_10388602 | 3300025986 | Bacteria | 1224 |
| 347 | Ga0207703_10291778 | 3300026035 | Bacteria | 1485 |
| 348 | Ga0207703_10494871 | 3300026035 | Bacteria | 1147 |
| 349 | Ga0207639_10000115 | 3300026041 | Bacteria | 62079 |
| 350 | Ga0207639_10148947 | 3300026041 | Bacteria | 1958 |
| 351 | Ga0207639_10203754 | 3300026041 | Bacteria | 1699 |
| 352 | Ga0207639_11272835 | 3300026041 | Bacteria | 690 |
| 353 | Ga0207678_10003556 | 3300026067 | Bacteria | 14017 |
| 354 | Ga0207678_10014956 | 3300026067 | Bacteria | 6828 |
| 355 | Ga0207678_10021612 | 3300026067 | Bacteria | 5642 |
| 356 | Ga0207678_10324846 | 3300026067 | Bacteria | 1324 |
| 357 | Ga0207678_11091962 | 3300026067 | Bacteria | 706 |
| 358 | Ga0207708_10176959 | 3300026075 | Bacteria | 1692 |
| 359 | Ga0207708_10676469 | 3300026075 | Bacteria | 880 |
| 360 | Ga0207702_11261545 | 3300026078 | Bacteria | 733 |
| 361 | Ga0207641_10175274 | 3300026088 | Bacteria | 1960 |
| 362 | Ga0207648_11406470 | 3300026089 | Bacteria | 656 |
| 363 | Ga0207676_10154705 | 3300026095 | Bacteria | 1979 |
| 364 | Ga0207676_10160989 | 3300026095 | Bacteria | 1944 |
| 365 | Ga0207674_10005050 | 3300026116 | Bacteria | 15749 |
| 366 | Ga0207674_10352580 | 3300026116 | Bacteria | 1422 |
| 367 | Ga0207674_10398592 | 3300026116 | Bacteria | 1330 |
| 368 | Ga0207674_10398721 | 3300026116 | Bacteria | 1330 |
| 369 | Ga0207675_100095349 | 3300026118 | Bacteria | 2799 |
| 370 | Ga0207675_100640564 | 3300026118 | Bacteria | 1068 |
| 371 | Ga0207683_10375192 | 3300026121 | Bacteria | 1307 |
| 372 | Ga0207698_10114764 | 3300026142 | Bacteria | 2266 |
| 373 | Ga0207698_10128602 | 3300026142 | Bacteria | 2160 |
| 374 | Ga0207698_10961420 | 3300026142 | Bacteria | 863 |
| 375 | Ga0207428_10022079 | 3300027907 | Bacteria | 5375 |
| 376 | Ga0268266_10001178 | 3300028379 | Bacteria | 32300 |
| 377 | Ga0265334_10236899 | 3300028573 | Bacteria | 630 |
| 378 | Ga0265318_10182820 | 3300028577 | Bacteria | 768 |
| 379 | Ga0265338_10001506 | 3300028800 | Bacteria | 37692 |
| 380 | Ga0265338_10114840 | 3300028800 | Bacteria | 2160 |
| 381 | Ga0265338_10176577 | 3300028800 | Bacteria | 1632 |
| 382 | Ga0265338_10364403 | 3300028800 | Bacteria | 1036 |
| 383 | Ga0265338_10763906 | 3300028800 | Bacteria | 664 |
| 384 | Ga0265766_1009802 | 3300030863 | Bacteria | 675 |
| 385 | Ga0265770_1029075 | 3300030878 | Bacteria | 916 |
| 386 | Ga0265776_113917 | 3300030880 | Bacteria | 503 |
| 387 | Ga0265761_103554 | 3300030889 | Bacteria | 769 |
| 388 | Ga0265773_1015382 | 3300031018 | Bacteria | 704 |
| 389 | Ga0265760_10048872 | 3300031090 | Bacteria | 1271 |
| 390 | Ga0265330_10000495 | 3300031235 | Bacteria | 26302 |
| 391 | Ga0265330_10018712 | 3300031235 | Bacteria | 3178 |
| 392 | Ga0265330_10043868 | 3300031235 | Bacteria | 1977 |
| 393 | Ga0265330_10060824 | 3300031235 | Bacteria | 1643 |
| 394 | Ga0265332_10015779 | 3300031238 | Bacteria | 3335 |
| 395 | Ga0265328_10029018 | 3300031239 | Bacteria | 2068 |
| 396 | Ga0265328_10127024 | 3300031239 | Bacteria | 953 |
| 397 | Ga0265325_10000217 | 3300031241 | Bacteria | 40450 |
| 398 | Ga0265325_10056567 | 3300031241 | Bacteria | 2003 |
| 399 | Ga0265340_10084518 | 3300031247 | Bacteria | 1490 |
| 400 | Ga0265340_10355290 | 3300031247 | Bacteria | 647 |
| 401 | Ga0265339_10000162 | 3300031249 | Bacteria | 55877 |
| 402 | Ga0265339_10025263 | 3300031249 | Bacteria | 3411 |
| 403 | Ga0265339_10036580 | 3300031249 | Bacteria | 2747 |
| 404 | Ga0265339_10048735 | 3300031249 | Bacteria | 2322 |
| 405 | Ga0265316_10000473 | 3300031344 | Bacteria | 45865 |
| 406 | Ga0265316_10006109 | 3300031344 | Bacteria | 11553 |
| 407 | Ga0265316_10013958 | 3300031344 | Bacteria | 7104 |
| 408 | Ga0265316_10019813 | 3300031344 | Bacteria | 5745 |
| 409 | Ga0265316_10192589 | 3300031344 | Bacteria | 1514 |
| 410 | Ga0265316_10206774 | 3300031344 | Bacteria | 1453 |
| 411 | Ga0265316_10279296 | 3300031344 | Bacteria | 1220 |
| 412 | Ga0265313_10006715 | 3300031595 | Bacteria | 8055 |
| 413 | Ga0265313_10133138 | 3300031595 | Bacteria | 1075 |
| 414 | Ga0307508_10057810 | 3300031616 | Bacteria | 3432 |
| 415 | Ga0316575_10172676 | 3300031665 | Unclassified | 896 |
| 416 | Ga0316579_10142788 | 3300031691 | Bacteria | 1154 |
| 417 | Ga0265314_10008015 | 3300031711 | Bacteria | 9109 |
| 418 | Ga0265314_10081677 | 3300031711 | Bacteria | 2129 |
| 419 | Ga0265314_10310105 | 3300031711 | Bacteria | 882 |
| 420 | Ga0265342_10001956 | 3300031712 | Bacteria | 18426 |
| 421 | Ga0265342_10006040 | 3300031712 | Bacteria | 9091 |
| 422 | Ga0265342_10013479 | 3300031712 | Bacteria | 5480 |
| 423 | Ga0265342_10041032 | 3300031712 | Bacteria | 2804 |
| 424 | Ga0316577_10003396 | 3300031733 | Bacteria | 8034 |
| 425 | Ga0307413_10124163 | 3300031824 | Bacteria | 1754 |
| 426 | Ga0307413_10963183 | 3300031824 | Unclassified | 729 |
| 427 | Ga0307410_10007104 | 3300031852 | Bacteria | 6107 |
| 428 | Ga0307412_10004388 | 3300031911 | Bacteria | 7864 |
| 429 | Ga0307409_100284493 | 3300031995 | Bacteria | 1530 |
| 430 | Ga0307416_101899730 | 3300032002 | Bacteria | 699 |
| 431 | Ga0307411_10378352 | 3300032005 | Bacteria | 1164 |
| 432 | Ga0307411_11637534 | 3300032005 | Bacteria | 594 |
| 433 | Ga0316053_100943 | 3300032120 | Bacteria | 1447 |
| 434 | Ga0316053_103404 | 3300032120 | Bacteria | 942 |
| 435 | Ga0307415_100010404 | 3300032126 | Bacteria | 5269 |
| 436 | Ga0316593_10219597 | 3300032168 | Unclassified | 706 |
| 437 | Ga0373932_0350526 | 3300035112 | Unclassified | 561 |
| 438 | Ga0373939_0206732 | 3300035114 | Unclassified | 745 |
| 439 | Ga0373953_0208508 | 3300035117 | Unclassified | 846 |
| 440 | Ga0373957_0147103 | 3300035120 | Bacteria | 966 |
| 441 | Ga0373961_0000560 | 3300035241 | Bacteria | 14051 |
| 442 | Ga0316574_0001659 | 3300035398 | Bacteria | 10721 |
| 443 | Ga0373935_0002837 | 3300035692 | Bacteria | 9969 |
| 444 | Ga0373933_0813238 | 3300035724 | Bacteria | 615 |
| 445 | Ga0373937_0296828 | 3300036401 | Bacteria | 1527 |
| 446 | Ga0373937_1041203 | 3300036401 | Bacteria | 767 |
| 447 | Ga0265778_001154 | 3300036457 | Bacteria | 2333 |
| 448 | Ga0265778_043637 | 3300036457 | Bacteria | 602 |
| 449 | Ga0316582_0125491 | 3300036647 | Bacteria | 1720 |
| 450 | Ga0316584_0030324 | 3300036712 | Bacteria | 3995 |
| 451 | Ga0395900_0158442 | 3300037418 | Bacteria | 2311 |
| 452 | Ga0316581_0253637 | 3300037588 | Bacteria | 540 |
| 453 | Ga0436364_0422759 | 3300037853 | Bacteria | 1306 |
| 454 | Ga0436363_0738180 | 3300039450 | Bacteria | 1152 |
| 455 | Ga0451790_48433 | 3300041444 | Bacteria | 561 |
| 456 | Ga0451798_0883000 | 3300041458 | Bacteria | 818 |
| 457 | Ga0451804_0024815 | 3300041463 | Bacteria | 633 |
| 458 | Ga0451804_1096986 | 3300041463 | Bacteria | 808 |
| 459 | Ga0451807_0879487 | 3300041486 | Bacteria | 909 |
| 460 | Ga0451839_1488214 | 3300041496 | Bacteria | 911 |
| 461 | Ga0451843_1648800 | 3300041509 | Bacteria | 1202 |
| 462 | Ga0439448_0013651 | 3300042005 | Bacteria | 2443 |
| 463 | Ga0439449_0158714 | 3300042007 | Bacteria | 844 |
| 464 | Ga0439435_0007548 | 3300042436 | Bacteria | 2493 |
| 465 | Ga0439435_0044540 | 3300042436 | Unclassified | 1251 |
| 466 | Ga0439460_0059828 | 3300042461 | Bacteria | 1161 |
| 467 | Ga0451577_0056839 | 3300042876 | Bacteria | 3490 |
| 468 | Ga0466972_0304243 | 3300044658 | Bacteria | 745 |
| 469 | Ga0466961_0262955 | 3300044693 | Bacteria | 1058 |
| 470 | Ga0466963_0305858 | 3300044694 | Bacteria | 1118 |
| 471 | Ga0466963_0555421 | 3300044694 | Bacteria | 811 |
| 472 | Ga0453684_0029003 | 3300044712 | Bacteria | 7874 |
| 473 | Ga0453684_0101505 | 3300044712 | Bacteria | 3520 |
| 474 | Ga0453684_0236687 | 3300044712 | Bacteria | 2105 |
| 475 | Ga0453684_0319714 | 3300044712 | Bacteria | 1758 |
| 476 | Ga0453684_0531820 | 3300044712 | Bacteria | 1297 |
| 477 | Ga0466970_0209447 | 3300044765 | Bacteria | 1086 |
| 478 | Ga0466959_0077224 | 3300045049 | Bacteria | 2404 |
| 479 | Ga0451576_0721965 | 3300045051 | Unclassified | 1047 |
| 480 | Ga0466958_0084898 | 3300045836 | Bacteria | 1953 |
| 481 | Ga0466967_0359443 | 3300045976 | Unclassified | 1411 |
| 482 | Ga0495617_016219 | 3300046452 | Bacteria | 2519 |
| 483 | Ga0495592_0097621 | 3300046454 | Bacteria | 2098 |
| 484 | Ga0495603_0137902 | 3300046455 | Bacteria | 1419 |
| 485 | Ga0495629_0426401 | 3300046459 | Bacteria | 900 |
| 486 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 487 | Ga0495580_0036966 | 3300046472 | Bacteria | 3505 |
| 488 | Ga0495580_0169549 | 3300046472 | Bacteria | 1509 |
| 489 | Ga0495584_0123430 | 3300046491 | Bacteria | 1312 |
| 490 | Ga0495585_0050871 | 3300046492 | Bacteria | 2297 |
| 491 | Ga0495594_0007770 | 3300046499 | Bacteria | 5515 |
| 492 | Ga0495596_0058708 | 3300046500 | Bacteria | 1500 |
| 493 | Ga0495583_0022127 | 3300046506 | Bacteria | 3252 |
| 494 | Ga0495606_0021082 | 3300046507 | Bacteria | 4781 |
| 495 | Ga0495608_0433230 | 3300046511 | Bacteria | 801 |
| 496 | Ga0495644_0000044 | 3300046523 | Bacteria | 60246 |
| 497 | Ga0495663_0084669 | 3300046525 | Bacteria | 1026 |
| 498 | Ga0495654_0014677 | 3300046530 | Bacteria | 4166 |
| 499 | Ga0495586_0220041 | 3300046535 | Bacteria | 1079 |
| 500 | Ga0495609_0002185 | 3300046538 | Bacteria | 12297 |
| 501 | Ga0495668_0015530 | 3300046616 | Bacteria | 4443 |
| 502 | Ga0495611_0016130 | 3300046648 | Bacteria | 3194 |
| 503 | Ga0495625_0000580 | 3300046660 | Bacteria | 53177 |
| 504 | Ga0495625_0020612 | 3300046660 | Bacteria | 5086 |
| 505 | Ga0495625_0538152 | 3300046660 | Bacteria | 709 |
| 506 | Ga0495659_0137665 | 3300046664 | Bacteria | 972 |
| 507 | Ga0495588_0096100 | 3300046674 | Bacteria | 1554 |
| 508 | Ga0495623_0203974 | 3300046679 | Bacteria | 1135 |
| 509 | Ga0495658_0201900 | 3300046683 | Bacteria | 1239 |
| 510 | Ga0495658_0349385 | 3300046683 | Bacteria | 940 |
| 511 | Ga0495669_0003780 | 3300046684 | Bacteria | 6222 |
| 512 | Ga0495670_0027481 | 3300046691 | Bacteria | 2819 |
| 513 | Ga0495649_0208212 | 3300046694 | Bacteria | 1014 |
| 514 | Ga0495604_0016650 | 3300047317 | Bacteria | 5879 |
| 515 | Ga0495636_0105372 | 3300047318 | Bacteria | 1236 |
| 516 | Ga0495672_0001831 | 3300047320 | Bacteria | 20338 |
| 517 | Ga0495672_0451019 | 3300047320 | Bacteria | 580 |
| 518 | Ga0495683_0089671 | 3300047323 | Bacteria | 1491 |
| 519 | Ga0495677_0088244 | 3300047445 | Bacteria | 1167 |
| 520 | Ga0495685_043165 | 3300047447 | Bacteria | 1539 |
| 521 | Ga0495684_0620968 | 3300047471 | Bacteria | 727 |
| 522 | Ga0495686_0038629 | 3300047472 | Bacteria | 3052 |
| 523 | Ga0495686_0068800 | 3300047472 | Bacteria | 2184 |
| 524 | Ga0495686_0314621 | 3300047472 | Bacteria | 860 |
| 525 | Ga0495686_0351057 | 3300047472 | Bacteria | 802 |
| 526 | Ga0495615_0041972 | 3300048090 | Bacteria | 1145 |
| 527 | Ga0496100_1342214 | 3300048903 | Bacteria | 564 |
| 528 | Ga0496100_1610996 | 3300048903 | Bacteria | 513 |
| 529 | Ga0496102_0382754 | 3300048905 | Bacteria | 1324 |
| 530 | Ga0496102_1448066 | 3300048905 | Bacteria | 606 |
| 531 | Ga0496104_0247612 | 3300048907 | Bacteria | 1695 |
| 532 | Ga0496104_0445350 | 3300048907 | Bacteria | 1207 |
| 533 | Ga0496104_0607879 | 3300048907 | Bacteria | 1003 |
| 534 | Ga0496104_1286548 | 3300048907 | Bacteria | 634 |
| 535 | Ga0496105_0377580 | 3300048908 | Bacteria | 1128 |
| 536 | Ga0496105_0541996 | 3300048908 | Bacteria | 909 |
| 537 | Ga0496105_1370255 | 3300048908 | Bacteria | 513 |
| 538 | Ga0496107_0466959 | 3300048910 | Bacteria | 937 |
| 539 | Ga0496112_1215692 | 3300048915 | Bacteria | 670 |
| 540 | Ga0496113_1309957 | 3300048916 | Bacteria | 563 |
| 541 | Ga0496114_0000036 | 3300048917 | Bacteria | 155622 |
| 542 | Ga0496114_0032760 | 3300048917 | Bacteria | 4280 |
| 543 | Ga0496118_0311920 | 3300048921 | Bacteria | 858 |
| 544 | Ga0495682_0031856 | 3300049460 | Bacteria | 1948 |
| 545 | Ga0495682_0061520 | 3300049460 | Bacteria | 1355 |
| 546 | Ga0501031_0019586 | 3300049568 | Bacteria | 4408 |
| 547 | Ga0501031_0019878 | 3300049568 | Bacteria | 4377 |
| 548 | Ga0501031_0115005 | 3300049568 | Bacteria | 1757 |
| 549 | Ga0501032_0002284 | 3300049569 | Bacteria | 15059 |
| 550 | Ga0501032_0004677 | 3300049569 | Bacteria | 10272 |
| 551 | Ga0501032_0104806 | 3300049569 | Bacteria | 1873 |
| 552 | Ga0501033_0000659 | 3300049570 | Bacteria | 31942 |
| 553 | Ga0501033_0068252 | 3300049570 | Bacteria | 2614 |
| 554 | Ga0501033_0250407 | 3300049570 | Bacteria | 1255 |
| 555 | Ga0501034_0001806 | 3300049571 | Bacteria | 27246 |
| 556 | Ga0501034_0007673 | 3300049571 | Bacteria | 11480 |
| 557 | Ga0501034_0040371 | 3300049571 | Bacteria | 4723 |
| 558 | Ga0501034_0109776 | 3300049571 | Bacteria | 2749 |
| 559 | Ga0501036_0004803 | 3300049572 | Bacteria | 10922 |
| 560 | Ga0501036_0010731 | 3300049572 | Bacteria | 7573 |
| 561 | Ga0501036_0013962 | 3300049572 | Bacteria | 6678 |
| 562 | Ga0501036_0057492 | 3300049572 | Bacteria | 3294 |
| 563 | Ga0501037_0003317 | 3300049573 | Bacteria | 11700 |
| 564 | Ga0501037_0012094 | 3300049573 | Bacteria | 6356 |
| 565 | Ga0501037_0020889 | 3300049573 | Bacteria | 4834 |
| 566 | Ga0501037_0050021 | 3300049573 | Bacteria | 3060 |
| 567 | Ga0501037_0248386 | 3300049573 | Bacteria | 1245 |
| 568 | Ga0501038_0011623 | 3300049574 | Bacteria | 8031 |
| 569 | Ga0501038_0018000 | 3300049574 | Bacteria | 6382 |
| 570 | Ga0501038_0052727 | 3300049574 | Bacteria | 3505 |
| 571 | Ga0501038_0725129 | 3300049574 | Bacteria | 743 |
| 572 | Ga0501039_0005483 | 3300049575 | Bacteria | 9599 |
| 573 | Ga0501039_0017020 | 3300049575 | Bacteria | 5573 |
| 574 | Ga0501039_0108274 | 3300049575 | Bacteria | 2172 |
| 575 | Ga0501040_0092565 | 3300049576 | Bacteria | 2102 |
| 576 | Ga0501042_0004587 | 3300049578 | Bacteria | 8819 |
| 577 | Ga0501042_0054879 | 3300049578 | Bacteria | 2842 |
| 578 | Ga0501042_0103572 | 3300049578 | Bacteria | 2048 |
| 579 | Ga0501043_0002589 | 3300049579 | Bacteria | 15289 |
| 580 | Ga0501043_0006527 | 3300049579 | Bacteria | 9357 |
| 581 | Ga0501043_0044248 | 3300049579 | Bacteria | 3500 |
| 582 | Ga0501046_0000056 | 3300049580 | Bacteria | 129342 |
| 583 | Ga0501046_0000732 | 3300049580 | Bacteria | 31713 |
| 584 | Ga0501046_0010248 | 3300049580 | Bacteria | 8065 |
| 585 | Ga0501046_0108015 | 3300049580 | Bacteria | 2128 |
| 586 | Ga0501047_0007941 | 3300049581 | Bacteria | 10007 |
| 587 | Ga0501047_0051099 | 3300049581 | Bacteria | 3992 |
| 588 | Ga0501047_0061918 | 3300049581 | Bacteria | 3610 |
| 589 | Ga0501047_0107267 | 3300049581 | Bacteria | 2674 |
| 590 | Ga0501047_0484092 | 3300049581 | Bacteria | 1065 |
| 591 | Ga0501048_0001491 | 3300049582 | Bacteria | 17769 |
| 592 | Ga0501048_0001532 | 3300049582 | Bacteria | 17526 |
| 593 | Ga0501067_0000553 | 3300049583 | Bacteria | 20247 |
| 594 | Ga0501067_0002308 | 3300049583 | Bacteria | 10547 |
| 595 | Ga0501067_0024525 | 3300049583 | Bacteria | 3345 |
| 596 | Ga0501068_0001954 | 3300049584 | Bacteria | 10960 |
| 597 | Ga0501068_0038437 | 3300049584 | Bacteria | 2867 |
| 598 | Ga0501068_0065117 | 3300049584 | Bacteria | 2218 |
| 599 | Ga0501068_0488041 | 3300049584 | Bacteria | 798 |
| 600 | Ga0501069_0000625 | 3300049585 | Bacteria | 16324 |
| 601 | Ga0501069_0006050 | 3300049585 | Bacteria | 6318 |
| 602 | Ga0501069_0103712 | 3300049585 | Bacteria | 1616 |
| 603 | Ga0501070_0005371 | 3300049586 | Bacteria | 10926 |
| 604 | Ga0501070_0112578 | 3300049586 | Bacteria | 2249 |
| 605 | Ga0501070_0195892 | 3300049586 | Bacteria | 1659 |
| 606 | Ga0501070_1005278 | 3300049586 | Bacteria | 646 |
| 607 | Ga0501071_0005838 | 3300049587 | Bacteria | 7953 |
| 608 | Ga0501071_0128080 | 3300049587 | Bacteria | 1885 |
| 609 | Ga0501072_0127765 | 3300049588 | Bacteria | 2025 |
| 610 | Ga0501073_0010311 | 3300049589 | Bacteria | 6859 |
| 611 | Ga0501073_0019909 | 3300049589 | Bacteria | 4841 |
| 612 | Ga0501073_0022416 | 3300049589 | Bacteria | 4547 |
| 613 | Ga0501073_0112914 | 3300049589 | Bacteria | 1884 |
| 614 | Ga0501073_0175163 | 3300049589 | Bacteria | 1484 |
| 615 | Ga0501074_0001905 | 3300049590 | Bacteria | 14330 |
| 616 | Ga0501074_0028739 | 3300049590 | Bacteria | 4028 |
| 617 | Ga0501074_0112224 | 3300049590 | Bacteria | 1950 |
| 618 | Ga0501074_0245205 | 3300049590 | Bacteria | 1274 |
| 619 | Ga0501075_0000962 | 3300049591 | Bacteria | 18337 |
| 620 | Ga0501076_0219371 | 3300049592 | Bacteria | 1554 |
| 621 | Ga0501076_1475592 | 3300049592 | Bacteria | 558 |
| 622 | Ga0501077_0002393 | 3300049593 | Bacteria | 11251 |
| 623 | Ga0501079_0004720 | 3300049741 | Bacteria | 10088 |
| 624 | Ga0501079_0202748 | 3300049741 | Bacteria | 1549 |
| 625 | Ga0501079_0785596 | 3300049741 | Bacteria | 749 |
| 626 | Ga0501079_1253839 | 3300049741 | Unclassified | 584 |
| 627 | Ga0501080_0008888 | 3300049742 | Bacteria | 9136 |
| 628 | Ga0501080_0027279 | 3300049742 | Bacteria | 5311 |
| 629 | Ga0501080_0033309 | 3300049742 | Bacteria | 4808 |
| 630 | Ga0501080_0096169 | 3300049742 | Bacteria | 2749 |
| 631 | Ga0501080_0566707 | 3300049742 | Bacteria | 1010 |
| 632 | Ga0501080_0635639 | 3300049742 | Bacteria | 945 |
| 633 | Ga0501081_0304195 | 3300049743 | Bacteria | 1170 |
| 634 | Ga0501083_0002132 | 3300049744 | Bacteria | 13574 |
| 635 | Ga0501083_0027266 | 3300049744 | Bacteria | 3942 |
| 636 | Ga0501035_0001253 | 3300049822 | Bacteria | 26374 |
| 637 | Ga0501035_0010497 | 3300049822 | Bacteria | 8583 |
| 638 | Ga0501035_0490204 | 3300049822 | Bacteria | 1012 |
| 639 | Ga0501044_0007868 | 3300049823 | Bacteria | 11719 |
| 640 | Ga0501044_0008765 | 3300049823 | Bacteria | 11062 |
| 641 | Ga0501044_0054308 | 3300049823 | Bacteria | 4118 |
| 642 | Ga0501044_0520600 | 3300049823 | Bacteria | 1089 |
| 643 | Ga0501044_1098714 | 3300049823 | Bacteria | 664 |
| 644 | Ga0501045_0058325 | 3300049824 | Bacteria | 2826 |
| 645 | nmdc:mga05p37_553621_c1 | 3300050507 | Bacteria | 1309 |
| 646 | nmdc:mga05p37_58091_c1 | 3300050507 | Bacteria | 4764 |
| 647 | nmdc:mga05p37_85593_c1 | 3300050507 | Bacteria | 3885 |
| 648 | nmdc:mga09592_14369_c1 | 3300050508 | Bacteria | 6463 |
| 649 | nmdc:mga0qj67_1398_c1 | 3300050509 | Bacteria | 16934 |
| 650 | nmdc:mga0qj67_8727_c1 | 3300050509 | Bacteria | 7529 |
| 651 | nmdc:mga06r32_196081_c1 | 3300050510 | Bacteria | 2007 |
| 652 | nmdc:mga08y16_587749_c1 | 3300050511 | Bacteria | 1123 |
| 653 | nmdc:mga08y16_93645_c1 | 3300050511 | Bacteria | 3130 |
| 654 | nmdc:mga0n895_1245337_c1 | 3300050512 | Bacteria | 717 |
| 655 | nmdc:mga0n895_246885_c1 | 3300050512 | Bacteria | 1812 |
| 656 | nmdc:mga0n895_31_c1 | 3300050512 | Bacteria | 81579 |
| 657 | nmdc:mga0n895_5693_c1 | 3300050512 | Bacteria | 10448 |
| 658 | nmdc:mga0rr50_1416_c1 | 3300050513 | Bacteria | 13144 |
| 659 | nmdc:mga0rr50_1489417_c1 | 3300050513 | Bacteria | 572 |
| 660 | nmdc:mga0rr50_43944_c1 | 3300050513 | Bacteria | 3273 |
| 661 | nmdc:mga0rr50_62289_c1 | 3300050513 | Bacteria | 2813 |
| 662 | nmdc:mga08x19_243258_c1 | 3300050514 | Bacteria | 1241 |
| 663 | nmdc:mga08x19_5358_c1 | 3300050514 | Bacteria | 7584 |
| 664 | nmdc:mga08x19_6642_c1 | 3300050514 | Bacteria | 6862 |
| 665 | nmdc:mga0a205_174267_c1 | 3300050515 | Bacteria | 2047 |
| 666 | nmdc:mga0a205_259_c1 | 3300050515 | Bacteria | 38100 |
| 667 | nmdc:mga0a205_562_c1 | 3300050515 | Bacteria | 29493 |
| 668 | Ga0495655_0063826 | 3300053083 | Bacteria | 1012 |
| 669 | Ga0495619_0352274 | 3300053085 | Bacteria | 1018 |
| 670 | Ga0500643_053056 | 3300053087 | Bacteria | 1154 |
| 671 | Ga0500595_045224 | 3300053119 | Bacteria | 1391 |
| 672 | Ga0501084_0022457 | 3300054114 | Bacteria | 5264 |
| 673 | Ga0501084_0046984 | 3300054114 | Bacteria | 3615 |
| 674 | Ga0590071_000580 | 3300059421 | Bacteria | 10531 |
| 675 | Ga0590075_000837 | 3300059424 | Bacteria | 8088 |
| 676 | Ga0590077_000903 | 3300059426 | Bacteria | 7581 |
| 677 | Ga0587090_034126 | 3300059510 | Bacteria | 866 |
| 678 | Ga0587091_059626 | 3300059511 | Bacteria | 807 |
| 679 | Ga0587125_009220 | 3300059607 | Bacteria | 995 |
| 680 | Ga0587101_013343 | 3300059623 | Bacteria | 1081 |
| 681 | Ga0587124_009761 | 3300059660 | Bacteria | 846 |
| 682 | Ga0587071_040397 | 3300060344 | Bacteria | 933 |
| 683 | Ga0587111_0112654 | 3300060346 | Bacteria | 691 |
| 684 | Ga0501082_0000072 | 3300060353 | Bacteria | 73322 |
| 685 | Ga0501082_0005002 | 3300060353 | Bacteria | 11568 |
| 686 | Ga0501082_0061915 | 3300060353 | Bacteria | 3221 |
| 687 | Ga0501082_0133648 | 3300060353 | Bacteria | 2152 |
| 688 | Ga0501082_0626769 | 3300060353 | Bacteria | 941 |
| 689 | Ga0530510_1484692 | 3300061734 | Bacteria | 520 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041458 | Ga0451798_0883000 | Ga0451798_0883000_208_654 | 122 |
| 2 | 3300041463 | Ga0451804_1096986 | Ga0451804_1096986_229_675 | 122 |
| 3 | 3300046530 | Ga0495654_0014677 | Ga0495654_0014677_108_554 | 124 |
| 4 | 3300005288 | Ga0065714_10138911 | Ga0065714_101389112 | 125 |
| 5 | 3300005331 | Ga0070670_100334747 | Ga0070670_1003347472 | 125 |
| 6 | 3300005354 | Ga0070675_100672476 | Ga0070675_1006724762 | 125 |
| 7 | 3300005367 | Ga0070667_100874256 | Ga0070667_1008742562 | 125 |
| 8 | 3300006042 | Ga0075368_10012903 | Ga0075368_100129034 | 125 |
| 9 | 3300006051 | Ga0075364_10128675 | Ga0075364_101286753 | 125 |
| 10 | 3300006178 | Ga0075367_10110568 | Ga0075367_101105683 | 125 |
| 11 | 3300006186 | Ga0075369_10004944 | Ga0075369_100049443 | 125 |
| 12 | 3300014325 | Ga0163163_10762424 | Ga0163163_107624242 | 125 |
| 13 | 3300014326 | Ga0157380_10435330 | Ga0157380_104353301 | 125 |
| 14 | 3300004798 | Ga0058859_11553821 | Ga0058859_115538211 | 128 |
| 15 | 3300005353 | Ga0070669_100000164 | Ga0070669_10000016441 | 128 |
| 16 | 3300005548 | Ga0070665_100000280 | Ga0070665_10000028059 | 128 |
| 17 | 3300025923 | Ga0207681_10000056 | Ga0207681_1000005680 | 128 |
| 18 | 3300026075 | Ga0207708_10676469 | Ga0207708_106764692 | 128 |
| 19 | 3300028379 | Ga0268266_10001178 | Ga0268266_1000117828 | 128 |
| 20 | 3300041463 | Ga0451804_0024815 | Ga0451804_0024815_69_515 | 128 |
| 21 | 3300041486 | Ga0451807_0879487 | Ga0451807_0879487_17_418 | 133 |
| 22 | 3300047320 | Ga0495672_0451019 | Ga0495672_0451019_11_418 | 135 |
| 23 | 3300048907 | Ga0496104_0445350 | Ga0496104_0445350_28_474 | 136 |
| 24 | 3300048921 | Ga0496118_0311920 | Ga0496118_0311920_34_480 | 136 |
| 25 | 3300042876 | Ga0451577_0056839 | Ga0451577_0056839_2562_3005 | 138 |
| 26 | 3300044712 | Ga0453684_0101505 | Ga0453684_0101505_997_1440 | 138 |
| 27 | 3300009147 | Ga0114129_10271377 | Ga0114129_102713771 | 139 |
| 28 | 3300028800 | Ga0265338_10114840 | Ga0265338_101148403 | 139 |
| 29 | 3300044712 | Ga0453684_0236687 | Ga0453684_0236687_1653_2072 | 139 |
| 30 | 3300046683 | Ga0495658_0201900 | Ga0495658_0201900_263_688 | 139 |
| 31 | 3300053085 | Ga0495619_0352274 | Ga0495619_0352274_315_740 | 139 |
| 32 | 3300005458 | Ga0070681_10198698 | Ga0070681_101986982 | 140 |
| 33 | 3300031235 | Ga0265330_10000495 | Ga0265330_1000049514 | 140 |
| 34 | 3300031241 | Ga0265325_10000217 | Ga0265325_100002175 | 140 |
| 35 | 3300031247 | Ga0265340_10084518 | Ga0265340_100845183 | 140 |
| 36 | 3300031249 | Ga0265339_10036580 | Ga0265339_100365803 | 140 |
| 37 | 3300031344 | Ga0265316_10006109 | Ga0265316_100061098 | 140 |
| 38 | 3300031344 | Ga0265316_10013958 | Ga0265316_100139586 | 140 |
| 39 | 3300031595 | Ga0265313_10006715 | Ga0265313_100067152 | 140 |
| 40 | 3300031711 | Ga0265314_10310105 | Ga0265314_103101051 | 140 |
| 41 | 3300031712 | Ga0265342_10001956 | Ga0265342_100019565 | 140 |
| 42 | 3300031712 | Ga0265342_10041032 | Ga0265342_100410324 | 140 |
| 43 | iso_pu_bacteria | 2773857933 | 2774902874 | 140 |
| 44 | 3300013296 | Ga0157374_11177568 | Ga0157374_111775681 | 141 |
| 45 | 3300013307 | Ga0157372_10273045 | Ga0157372_102730452 | 141 |
| 46 | 3300022467 | Ga0224712_10172953 | Ga0224712_101729531 | 141 |
| 47 | 3300025934 | Ga0207686_11015805 | Ga0207686_110158052 | 141 |
| 48 | 3300044712 | Ga0453684_0029003 | Ga0453684_0029003_1743_2168 | 141 |
| 49 | 3300044712 | Ga0453684_0319714 | Ga0453684_0319714_483_908 | 141 |
| 50 | 3300046472 | Ga0495580_0036966 | Ga0495580_0036966_1088_1528 | 141 |
| 51 | 3300047472 | Ga0495686_0068800 | Ga0495686_0068800_441_905 | 141 |
| 52 | 3300048907 | Ga0496104_0607879 | Ga0496104_0607879_348_785 | 141 |
| 53 | iso_pu_bacteria | 2643221553 | 2643783564 | 141 |
| 54 | iso_pu_bacteria | 2643221724 | 2644679191 | 141 |
| 55 | iso_pu_bacteria | 2728369380 | 2730228694 | 141 |
| 56 | 3300005289 | Ga0065704_10308306 | Ga0065704_103083062 | 142 |
| 57 | 3300005295 | Ga0065707_10215047 | Ga0065707_102150472 | 142 |
| 58 | 3300005339 | Ga0070660_100002152 | Ga0070660_1000021529 | 142 |
| 59 | 3300005341 | Ga0070691_10170258 | Ga0070691_101702582 | 142 |
| 60 | 3300005344 | Ga0070661_100116121 | Ga0070661_1001161212 | 142 |
| 61 | 3300005366 | Ga0070659_100292248 | Ga0070659_1002922482 | 142 |
| 62 | 3300005438 | Ga0070701_10292922 | Ga0070701_102929221 | 142 |
| 63 | 3300005440 | Ga0070705_100252361 | Ga0070705_1002523613 | 142 |
| 64 | 3300005441 | Ga0070700_100170164 | Ga0070700_1001701642 | 142 |
| 65 | 3300005444 | Ga0070694_100155421 | Ga0070694_1001554212 | 142 |
| 66 | 3300005459 | Ga0068867_101786507 | Ga0068867_1017865071 | 142 |
| 67 | 3300005530 | Ga0070679_100024592 | Ga0070679_1000245929 | 142 |
| 68 | 3300005535 | Ga0070684_100591579 | Ga0070684_1005915791 | 142 |
| 69 | 3300005539 | Ga0068853_100044099 | Ga0068853_1000440992 | 142 |
| 70 | 3300005549 | Ga0070704_100023634 | Ga0070704_1000236343 | 142 |
| 71 | 3300005563 | Ga0068855_100301722 | Ga0068855_1003017222 | 142 |
| 72 | 3300005564 | Ga0070664_100748375 | Ga0070664_1007483752 | 142 |
| 73 | 3300005616 | Ga0068852_100128851 | Ga0068852_1001288512 | 142 |
| 74 | 3300006844 | Ga0075428_100188315 | Ga0075428_1001883153 | 142 |
| 75 | 3300009094 | Ga0111539_10102893 | Ga0111539_101028932 | 142 |
| 76 | 3300009147 | Ga0114129_10331348 | Ga0114129_103313482 | 142 |
| 77 | 3300009551 | Ga0105238_10122060 | Ga0105238_101220603 | 142 |
| 78 | 3300009553 | Ga0105249_11136780 | Ga0105249_111367802 | 142 |
| 79 | 3300010375 | Ga0105239_10669784 | Ga0105239_106697841 | 142 |
| 80 | 3300013102 | Ga0157371_10135608 | Ga0157371_101356082 | 142 |
| 81 | 3300013105 | Ga0157369_10036291 | Ga0157369_100362912 | 142 |
| 82 | 3300013105 | Ga0157369_10793528 | Ga0157369_107935281 | 142 |
| 83 | 3300013297 | Ga0157378_10961232 | Ga0157378_109612321 | 142 |
| 84 | 3300013307 | Ga0157372_10096633 | Ga0157372_100966335 | 142 |
| 85 | 3300013307 | Ga0157372_11497160 | Ga0157372_114971601 | 142 |
| 86 | 3300014326 | Ga0157380_10004468 | Ga0157380_100044688 | 142 |
| 87 | 3300014969 | Ga0157376_10199452 | Ga0157376_101994522 | 142 |
| 88 | 3300020078 | Ga0206352_10599768 | Ga0206352_105997682 | 142 |
| 89 | 3300025908 | Ga0207643_10285319 | Ga0207643_102853191 | 142 |
| 90 | 3300025909 | Ga0207705_10002156 | Ga0207705_100021563 | 142 |
| 91 | 3300025909 | Ga0207705_10010724 | Ga0207705_100107244 | 142 |
| 92 | 3300025913 | Ga0207695_10542425 | Ga0207695_105424251 | 142 |
| 93 | 3300025919 | Ga0207657_10026932 | Ga0207657_100269325 | 142 |
| 94 | 3300025919 | Ga0207657_10394359 | Ga0207657_103943592 | 142 |
| 95 | 3300025920 | Ga0207649_10037830 | Ga0207649_100378302 | 142 |
| 96 | 3300025921 | Ga0207652_10127248 | Ga0207652_101272481 | 142 |
| 97 | 3300025924 | Ga0207694_10177219 | Ga0207694_101772192 | 142 |
| 98 | 3300025924 | Ga0207694_10183553 | Ga0207694_101835533 | 142 |
| 99 | 3300025932 | Ga0207690_10119581 | Ga0207690_101195812 | 142 |
| 100 | 3300025945 | Ga0207679_10683648 | Ga0207679_106836481 | 142 |
| 101 | 3300025949 | Ga0207667_10032870 | Ga0207667_100328705 | 142 |
| 102 | 3300025949 | Ga0207667_10579575 | Ga0207667_105795751 | 142 |
| 103 | 3300026041 | Ga0207639_10148947 | Ga0207639_101489472 | 142 |
| 104 | 3300026075 | Ga0207708_10176959 | Ga0207708_101769591 | 142 |
| 105 | 3300026089 | Ga0207648_11406470 | Ga0207648_114064702 | 142 |
| 106 | 3300026118 | Ga0207675_100640564 | Ga0207675_1006405642 | 142 |
| 107 | 3300026142 | Ga0207698_10128602 | Ga0207698_101286022 | 142 |
| 108 | 3300027907 | Ga0207428_10022079 | Ga0207428_100220792 | 142 |
| 109 | 3300031691 | Ga0316579_10142788 | Ga0316579_101427882 | 142 |
| 110 | 3300031733 | Ga0316577_10003396 | Ga0316577_100033963 | 142 |
| 111 | 3300032168 | Ga0316593_10219597 | Ga0316593_102195972 | 142 |
| 112 | 3300036647 | Ga0316582_0125491 | Ga0316582_0125491_836_1264 | 142 |
| 113 | 3300036712 | Ga0316584_0030324 | Ga0316584_0030324_829_1257 | 142 |
| 114 | 3300042005 | Ga0439448_0013651 | Ga0439448_0013651_108_539 | 142 |
| 115 | 3300044712 | Ga0453684_0531820 | Ga0453684_0531820_808_1272 | 142 |
| 116 | 3300045049 | Ga0466959_0077224 | Ga0466959_0077224_847_1278 | 142 |
| 117 | 3300045976 | Ga0466967_0359443 | Ga0466967_0359443_99_530 | 142 |
| 118 | 3300050511 | nmdc:mga08y16_93645_c1 | nmdc:mga08y16_93645_c1_919_1347 | 142 |
| 119 | 3300004803 | Ga0058862_12851463 | Ga0058862_128514633 | 143 |
| 120 | 3300005327 | Ga0070658_10007225 | Ga0070658_100072252 | 143 |
| 121 | 3300005329 | Ga0070683_100009432 | Ga0070683_1000094322 | 143 |
| 122 | 3300005339 | Ga0070660_100013713 | Ga0070660_1000137133 | 143 |
| 123 | 3300005436 | Ga0070713_101251718 | Ga0070713_1012517181 | 143 |
| 124 | 3300005436 | Ga0070713_101268654 | Ga0070713_1012686541 | 143 |
| 125 | 3300005458 | Ga0070681_10093860 | Ga0070681_100938601 | 143 |
| 126 | 3300005530 | Ga0070679_100059401 | Ga0070679_1000594012 | 143 |
| 127 | 3300005535 | Ga0070684_100005900 | Ga0070684_1000059004 | 143 |
| 128 | 3300005563 | Ga0068855_100154131 | Ga0068855_1001541314 | 143 |
| 129 | 3300005577 | Ga0068857_100017675 | Ga0068857_1000176755 | 143 |
| 130 | 3300005578 | Ga0068854_101619604 | Ga0068854_1016196041 | 143 |
| 131 | 3300005614 | Ga0068856_100013051 | Ga0068856_1000130513 | 143 |
| 132 | 3300005616 | Ga0068852_100042793 | Ga0068852_1000427934 | 143 |
| 133 | 3300006028 | Ga0070717_10001558 | Ga0070717_100015585 | 143 |
| 134 | 3300006028 | Ga0070717_10404308 | Ga0070717_104043081 | 143 |
| 135 | 3300006237 | Ga0097621_100000066 | Ga0097621_10000006639 | 143 |
| 136 | 3300006358 | Ga0068871_100000170 | Ga0068871_10000017026 | 143 |
| 137 | 3300006852 | Ga0075433_10006367 | Ga0075433_100063675 | 143 |
| 138 | 3300006871 | Ga0075434_100000005 | Ga0075434_10000000525 | 143 |
| 139 | 3300006914 | Ga0075436_100007285 | Ga0075436_1000072855 | 143 |
| 140 | 3300007076 | Ga0075435_100024980 | Ga0075435_1000249807 | 143 |
| 141 | 3300009093 | Ga0105240_10483312 | Ga0105240_104833122 | 143 |
| 142 | 3300009093 | Ga0105240_11213535 | Ga0105240_112135352 | 143 |
| 143 | 3300009177 | Ga0105248_10604239 | Ga0105248_106042392 | 143 |
| 144 | 3300009545 | Ga0105237_10328505 | Ga0105237_103285051 | 143 |
| 145 | 3300013102 | Ga0157371_10007064 | Ga0157371_100070644 | 143 |
| 146 | 3300013104 | Ga0157370_10391993 | Ga0157370_103919932 | 143 |
| 147 | 3300013105 | Ga0157369_10228469 | Ga0157369_102284692 | 143 |
| 148 | 3300013105 | Ga0157369_10359774 | Ga0157369_103597742 | 143 |
| 149 | 3300013307 | Ga0157372_10096540 | Ga0157372_100965404 | 143 |
| 150 | 3300014968 | Ga0157379_10182718 | Ga0157379_101827182 | 143 |
| 151 | 3300014969 | Ga0157376_10519561 | Ga0157376_105195612 | 143 |
| 152 | 3300019166 | Ga0184595_123911 | Ga0184595_1239111 | 143 |
| 153 | 3300020069 | Ga0197907_11223624 | Ga0197907_112236243 | 143 |
| 154 | 3300020070 | Ga0206356_11110856 | Ga0206356_111108563 | 143 |
| 155 | 3300020070 | Ga0206356_11659320 | Ga0206356_116593201 | 143 |
| 156 | 3300020075 | Ga0206349_1877071 | Ga0206349_18770711 | 143 |
| 157 | 3300020076 | Ga0206355_1388814 | Ga0206355_13888143 | 143 |
| 158 | 3300020076 | Ga0206355_1618829 | Ga0206355_16188291 | 143 |
| 159 | 3300020077 | Ga0206351_10677131 | Ga0206351_106771313 | 143 |
| 160 | 3300020078 | Ga0206352_10308703 | Ga0206352_103087032 | 143 |
| 161 | 3300020078 | Ga0206352_11016995 | Ga0206352_110169953 | 143 |
| 162 | 3300020080 | Ga0206350_11323274 | Ga0206350_113232744 | 143 |
| 163 | 3300020081 | Ga0206354_11456630 | Ga0206354_114566301 | 143 |
| 164 | 3300020082 | Ga0206353_11159178 | Ga0206353_111591783 | 143 |
| 165 | 3300020610 | Ga0154015_1134506 | Ga0154015_11345064 | 143 |
| 166 | 3300022467 | Ga0224712_10029435 | Ga0224712_100294354 | 143 |
| 167 | 3300023672 | Ga0247553_100730 | Ga0247553_1007301 | 143 |
| 168 | 3300025909 | Ga0207705_10146373 | Ga0207705_101463731 | 143 |
| 169 | 3300025912 | Ga0207707_10068125 | Ga0207707_100681252 | 143 |
| 170 | 3300025913 | Ga0207695_10129252 | Ga0207695_101292522 | 143 |
| 171 | 3300025917 | Ga0207660_10015830 | Ga0207660_100158304 | 143 |
| 172 | 3300025919 | Ga0207657_10008653 | Ga0207657_100086534 | 143 |
| 173 | 3300025921 | Ga0207652_10105438 | Ga0207652_101054381 | 143 |
| 174 | 3300025924 | Ga0207694_10007162 | Ga0207694_100071623 | 143 |
| 175 | 3300025928 | Ga0207700_10295694 | Ga0207700_102956941 | 143 |
| 176 | 3300025928 | Ga0207700_10736688 | Ga0207700_107366881 | 143 |
| 177 | 3300025949 | Ga0207667_10009317 | Ga0207667_100093175 | 143 |
| 178 | 3300026116 | Ga0207674_10352580 | Ga0207674_103525803 | 143 |
| 179 | 3300026116 | Ga0207674_10398592 | Ga0207674_103985922 | 143 |
| 180 | 3300026142 | Ga0207698_10114764 | Ga0207698_101147643 | 143 |
| 181 | 3300028573 | Ga0265334_10236899 | Ga0265334_102368991 | 143 |
| 182 | 3300028577 | Ga0265318_10182820 | Ga0265318_101828202 | 143 |
| 183 | 3300028800 | Ga0265338_10001506 | Ga0265338_100015062 | 143 |
| 184 | 3300028800 | Ga0265338_10364403 | Ga0265338_103644031 | 143 |
| 185 | 3300028800 | Ga0265338_10763906 | Ga0265338_107639061 | 143 |
| 186 | 3300030863 | Ga0265766_1009802 | Ga0265766_10098021 | 143 |
| 187 | 3300030878 | Ga0265770_1029075 | Ga0265770_10290751 | 143 |
| 188 | 3300030880 | Ga0265776_113917 | Ga0265776_1139171 | 143 |
| 189 | 3300030889 | Ga0265761_103554 | Ga0265761_1035541 | 143 |
| 190 | 3300031018 | Ga0265773_1015382 | Ga0265773_10153822 | 143 |
| 191 | 3300031090 | Ga0265760_10048872 | Ga0265760_100488721 | 143 |
| 192 | 3300031235 | Ga0265330_10018712 | Ga0265330_100187124 | 143 |
| 193 | 3300031235 | Ga0265330_10043868 | Ga0265330_100438683 | 143 |
| 194 | 3300031235 | Ga0265330_10060824 | Ga0265330_100608244 | 143 |
| 195 | 3300031238 | Ga0265332_10015779 | Ga0265332_100157791 | 143 |
| 196 | 3300031239 | Ga0265328_10029018 | Ga0265328_100290181 | 143 |
| 197 | 3300031241 | Ga0265325_10056567 | Ga0265325_100565673 | 143 |
| 198 | 3300031247 | Ga0265340_10355290 | Ga0265340_103552901 | 143 |
| 199 | 3300031249 | Ga0265339_10000162 | Ga0265339_1000016244 | 143 |
| 200 | 3300031249 | Ga0265339_10025263 | Ga0265339_100252635 | 143 |
| 201 | 3300031249 | Ga0265339_10048735 | Ga0265339_100487353 | 143 |
| 202 | 3300031344 | Ga0265316_10000473 | Ga0265316_1000047334 | 143 |
| 203 | 3300031344 | Ga0265316_10019813 | Ga0265316_100198131 | 143 |
| 204 | 3300031344 | Ga0265316_10192589 | Ga0265316_101925891 | 143 |
| 205 | 3300031344 | Ga0265316_10206774 | Ga0265316_102067741 | 143 |
| 206 | 3300031344 | Ga0265316_10279296 | Ga0265316_102792961 | 143 |
| 207 | 3300031595 | Ga0265313_10133138 | Ga0265313_101331382 | 143 |
| 208 | 3300031711 | Ga0265314_10008015 | Ga0265314_100080153 | 143 |
| 209 | 3300031711 | Ga0265314_10081677 | Ga0265314_100816773 | 143 |
| 210 | 3300031712 | Ga0265342_10006040 | Ga0265342_100060406 | 143 |
| 211 | 3300031712 | Ga0265342_10013479 | Ga0265342_100134794 | 143 |
| 212 | 3300031824 | Ga0307413_10124163 | Ga0307413_101241631 | 143 |
| 213 | 3300031824 | Ga0307413_10963183 | Ga0307413_109631831 | 143 |
| 214 | 3300031852 | Ga0307410_10007104 | Ga0307410_100071048 | 143 |
| 215 | 3300031911 | Ga0307412_10004388 | Ga0307412_100043886 | 143 |
| 216 | 3300031995 | Ga0307409_100284493 | Ga0307409_1002844932 | 143 |
| 217 | 3300032005 | Ga0307411_10378352 | Ga0307411_103783522 | 143 |
| 218 | 3300032005 | Ga0307411_11637534 | Ga0307411_116375341 | 143 |
| 219 | 3300032120 | Ga0316053_100943 | Ga0316053_1009433 | 143 |
| 220 | 3300032126 | Ga0307415_100010404 | Ga0307415_1000104042 | 143 |
| 221 | 3300035112 | Ga0373932_0350526 | Ga0373932_0350526_51_488 | 143 |
| 222 | 3300035114 | Ga0373939_0206732 | Ga0373939_0206732_38_475 | 143 |
| 223 | 3300035117 | Ga0373953_0208508 | Ga0373953_0208508_210_647 | 143 |
| 224 | 3300035120 | Ga0373957_0147103 | Ga0373957_0147103_173_604 | 143 |
| 225 | 3300035724 | Ga0373933_0813238 | Ga0373933_0813238_158_589 | 143 |
| 226 | 3300036401 | Ga0373937_0296828 | Ga0373937_0296828_727_1158 | 143 |
| 227 | 3300036457 | Ga0265778_001154 | Ga0265778_001154_1593_2024 | 143 |
| 228 | 3300036457 | Ga0265778_043637 | Ga0265778_043637_38_469 | 143 |
| 229 | 3300037588 | Ga0316581_0253637 | Ga0316581_0253637_66_509 | 143 |
| 230 | 3300037853 | Ga0436364_0422759 | Ga0436364_0422759_849_1286 | 143 |
| 231 | 3300039450 | Ga0436363_0738180 | Ga0436363_0738180_421_852 | 143 |
| 232 | 3300042436 | Ga0439435_0044540 | Ga0439435_0044540_167_598 | 143 |
| 233 | 3300044693 | Ga0466961_0262955 | Ga0466961_0262955_472_903 | 143 |
| 234 | 3300044765 | Ga0466970_0209447 | Ga0466970_0209447_452_883 | 143 |
| 235 | 3300045051 | Ga0451576_0721965 | Ga0451576_0721965_488_925 | 143 |
| 236 | 3300045836 | Ga0466958_0084898 | Ga0466958_0084898_718_1149 | 143 |
| 237 | 3300046459 | Ga0495629_0426401 | Ga0495629_0426401_358_789 | 143 |
| 238 | 3300046535 | Ga0495586_0220041 | Ga0495586_0220041_316_747 | 143 |
| 239 | 3300046683 | Ga0495658_0349385 | Ga0495658_0349385_207_638 | 143 |
| 240 | 3300048907 | Ga0496104_0247612 | Ga0496104_0247612_24_455 | 143 |
| 241 | 3300049568 | Ga0501031_0019878 | Ga0501031_0019878_2886_3317 | 143 |
| 242 | 3300049568 | Ga0501031_0115005 | Ga0501031_0115005_407_838 | 143 |
| 243 | 3300049569 | Ga0501032_0004677 | Ga0501032_0004677_614_1045 | 143 |
| 244 | 3300049569 | Ga0501032_0104806 | Ga0501032_0104806_232_663 | 143 |
| 245 | 3300049570 | Ga0501033_0068252 | Ga0501033_0068252_1344_1775 | 143 |
| 246 | 3300049570 | Ga0501033_0250407 | Ga0501033_0250407_453_884 | 143 |
| 247 | 3300049571 | Ga0501034_0007673 | Ga0501034_0007673_5734_6165 | 143 |
| 248 | 3300049571 | Ga0501034_0040371 | Ga0501034_0040371_2727_3158 | 143 |
| 249 | 3300049571 | Ga0501034_0109776 | Ga0501034_0109776_1607_2038 | 143 |
| 250 | 3300049572 | Ga0501036_0004803 | Ga0501036_0004803_6382_6813 | 143 |
| 251 | 3300049572 | Ga0501036_0013962 | Ga0501036_0013962_210_641 | 143 |
| 252 | 3300049572 | Ga0501036_0057492 | Ga0501036_0057492_2654_3085 | 143 |
| 253 | 3300049573 | Ga0501037_0003317 | Ga0501037_0003317_4044_4475 | 143 |
| 254 | 3300049573 | Ga0501037_0020889 | Ga0501037_0020889_1788_2219 | 143 |
| 255 | 3300049573 | Ga0501037_0248386 | Ga0501037_0248386_662_1093 | 143 |
| 256 | 3300049574 | Ga0501038_0011623 | Ga0501038_0011623_5794_6225 | 143 |
| 257 | 3300049574 | Ga0501038_0052727 | Ga0501038_0052727_1566_1997 | 143 |
| 258 | 3300049575 | Ga0501039_0005483 | Ga0501039_0005483_4639_5070 | 143 |
| 259 | 3300049575 | Ga0501039_0017020 | Ga0501039_0017020_2936_3367 | 143 |
| 260 | 3300049576 | Ga0501040_0092565 | Ga0501040_0092565_380_811 | 143 |
| 261 | 3300049578 | Ga0501042_0004587 | Ga0501042_0004587_2620_3051 | 143 |
| 262 | 3300049578 | Ga0501042_0054879 | Ga0501042_0054879_1845_2276 | 143 |
| 263 | 3300049578 | Ga0501042_0103572 | Ga0501042_0103572_869_1300 | 143 |
| 264 | 3300049579 | Ga0501043_0006527 | Ga0501043_0006527_840_1271 | 143 |
| 265 | 3300049579 | Ga0501043_0044248 | Ga0501043_0044248_2818_3249 | 143 |
| 266 | 3300049580 | Ga0501046_0000732 | Ga0501046_0000732_25753_26184 | 143 |
| 267 | 3300049580 | Ga0501046_0010248 | Ga0501046_0010248_5427_5858 | 143 |
| 268 | 3300049580 | Ga0501046_0108015 | Ga0501046_0108015_487_918 | 143 |
| 269 | 3300049581 | Ga0501047_0007941 | Ga0501047_0007941_8893_9324 | 143 |
| 270 | 3300049581 | Ga0501047_0061918 | Ga0501047_0061918_372_803 | 143 |
| 271 | 3300049581 | Ga0501047_0107267 | Ga0501047_0107267_1532_1963 | 143 |
| 272 | 3300049582 | Ga0501048_0001491 | Ga0501048_0001491_10509_10940 | 143 |
| 273 | 3300049582 | Ga0501048_0001532 | Ga0501048_0001532_12575_13006 | 143 |
| 274 | 3300049583 | Ga0501067_0000553 | Ga0501067_0000553_13324_13755 | 143 |
| 275 | 3300049583 | Ga0501067_0002308 | Ga0501067_0002308_3633_4064 | 143 |
| 276 | 3300049584 | Ga0501068_0001954 | Ga0501068_0001954_5790_6221 | 143 |
| 277 | 3300049584 | Ga0501068_0038437 | Ga0501068_0038437_991_1422 | 143 |
| 278 | 3300049585 | Ga0501069_0000625 | Ga0501069_0000625_7373_7804 | 143 |
| 279 | 3300049585 | Ga0501069_0006050 | Ga0501069_0006050_3274_3705 | 143 |
| 280 | 3300049586 | Ga0501070_0005371 | Ga0501070_0005371_1532_1963 | 143 |
| 281 | 3300049586 | Ga0501070_0195892 | Ga0501070_0195892_1048_1479 | 143 |
| 282 | 3300049586 | Ga0501070_1005278 | Ga0501070_1005278_94_525 | 143 |
| 283 | 3300049587 | Ga0501071_0005838 | Ga0501071_0005838_755_1186 | 143 |
| 284 | 3300049587 | Ga0501071_0128080 | Ga0501071_0128080_1361_1792 | 143 |
| 285 | 3300049588 | Ga0501072_0127765 | Ga0501072_0127765_275_706 | 143 |
| 286 | 3300049589 | Ga0501073_0022416 | Ga0501073_0022416_2906_3337 | 143 |
| 287 | 3300049589 | Ga0501073_0112914 | Ga0501073_0112914_614_1045 | 143 |
| 288 | 3300049589 | Ga0501073_0175163 | Ga0501073_0175163_210_641 | 143 |
| 289 | 3300049590 | Ga0501074_0001905 | Ga0501074_0001905_7036_7467 | 143 |
| 290 | 3300049590 | Ga0501074_0028739 | Ga0501074_0028739_712_1143 | 143 |
| 291 | 3300049590 | Ga0501074_0112224 | Ga0501074_0112224_204_635 | 143 |
| 292 | 3300049592 | Ga0501076_0219371 | Ga0501076_0219371_511_942 | 143 |
| 293 | 3300049592 | Ga0501076_1475592 | Ga0501076_1475592_30_461 | 143 |
| 294 | 3300049741 | Ga0501079_0004720 | Ga0501079_0004720_1572_2003 | 143 |
| 295 | 3300049741 | Ga0501079_0202748 | Ga0501079_0202748_887_1318 | 143 |
| 296 | 3300049741 | Ga0501079_0785596 | Ga0501079_0785596_37_468 | 143 |
| 297 | 3300049741 | Ga0501079_1253839 | Ga0501079_1253839_139_570 | 143 |
| 298 | 3300049742 | Ga0501080_0027279 | Ga0501080_0027279_1986_2417 | 143 |
| 299 | 3300049742 | Ga0501080_0096169 | Ga0501080_0096169_712_1143 | 143 |
| 300 | 3300049742 | Ga0501080_0566707 | Ga0501080_0566707_556_987 | 143 |
| 301 | 3300049743 | Ga0501081_0304195 | Ga0501081_0304195_387_818 | 143 |
| 302 | 3300049744 | Ga0501083_0027266 | Ga0501083_0027266_843_1274 | 143 |
| 303 | 3300049822 | Ga0501035_0010497 | Ga0501035_0010497_5395_5826 | 143 |
| 304 | 3300049822 | Ga0501035_0490204 | Ga0501035_0490204_372_803 | 143 |
| 305 | 3300049823 | Ga0501044_0008765 | Ga0501044_0008765_9100_9531 | 143 |
| 306 | 3300049823 | Ga0501044_0054308 | Ga0501044_0054308_210_641 | 143 |
| 307 | 3300049823 | Ga0501044_1098714 | Ga0501044_1098714_210_641 | 143 |
| 308 | 3300049824 | Ga0501045_0058325 | Ga0501045_0058325_784_1215 | 143 |
| 309 | 3300050507 | nmdc:mga05p37_58091_c1 | nmdc:mga05p37_58091_c1_1429_1860 | 143 |
| 310 | 3300050508 | nmdc:mga09592_14369_c1 | nmdc:mga09592_14369_c1_1520_1951 | 143 |
| 311 | 3300050509 | nmdc:mga0qj67_1398_c1 | nmdc:mga0qj67_1398_c1_13019_13450 | 143 |
| 312 | 3300050509 | nmdc:mga0qj67_8727_c1 | nmdc:mga0qj67_8727_c1_5386_5817 | 143 |
| 313 | 3300050510 | nmdc:mga06r32_196081_c1 | nmdc:mga06r32_196081_c1_1346_1777 | 143 |
| 314 | 3300050512 | nmdc:mga0n895_31_c1 | nmdc:mga0n895_31_c1_38032_38463 | 143 |
| 315 | 3300050512 | nmdc:mga0n895_5693_c1 | nmdc:mga0n895_5693_c1_68_499 | 143 |
| 316 | 3300050513 | nmdc:mga0rr50_1416_c1 | nmdc:mga0rr50_1416_c1_36_467 | 143 |
| 317 | 3300050514 | nmdc:mga08x19_5358_c1 | nmdc:mga08x19_5358_c1_3210_3641 | 143 |
| 318 | 3300050515 | nmdc:mga0a205_259_c1 | nmdc:mga0a205_259_c1_3953_4384 | 143 |
| 319 | 3300050515 | nmdc:mga0a205_562_c1 | nmdc:mga0a205_562_c1_21419_21850 | 143 |
| 320 | 3300054114 | Ga0501084_0022457 | Ga0501084_0022457_752_1183 | 143 |
| 321 | 3300054114 | Ga0501084_0046984 | Ga0501084_0046984_2469_2900 | 143 |
| 322 | 3300059421 | Ga0590071_000580 | Ga0590071_000580_3919_4350 | 143 |
| 323 | 3300059424 | Ga0590075_000837 | Ga0590075_000837_5082_5513 | 143 |
| 324 | 3300059426 | Ga0590077_000903 | Ga0590077_000903_2265_2696 | 143 |
| 325 | 3300059511 | Ga0587091_059626 | Ga0587091_059626_106_537 | 143 |
| 326 | 3300059607 | Ga0587125_009220 | Ga0587125_009220_224_655 | 143 |
| 327 | 3300059660 | Ga0587124_009761 | Ga0587124_009761_190_621 | 143 |
| 328 | 3300060346 | Ga0587111_0112654 | Ga0587111_0112654_153_584 | 143 |
| 329 | 3300060353 | Ga0501082_0005002 | Ga0501082_0005002_4574_5005 | 143 |
| 330 | 3300060353 | Ga0501082_0061915 | Ga0501082_0061915_881_1312 | 143 |
| 331 | 3300060353 | Ga0501082_0133648 | Ga0501082_0133648_415_846 | 143 |
| 332 | 3300061734 | Ga0530510_1484692 | Ga0530510_1484692_39_470 | 143 |
| 333 | 3300003320 | rootH2_10080382 | rootH2_100803822 | 144 |
| 334 | 3300005327 | Ga0070658_10137527 | Ga0070658_101375273 | 144 |
| 335 | 3300005327 | Ga0070658_10232851 | Ga0070658_102328513 | 144 |
| 336 | 3300005327 | Ga0070658_10398281 | Ga0070658_103982811 | 144 |
| 337 | 3300005329 | Ga0070683_100288005 | Ga0070683_1002880053 | 144 |
| 338 | 3300005335 | Ga0070666_10030165 | Ga0070666_100301654 | 144 |
| 339 | 3300005336 | Ga0070680_100108365 | Ga0070680_1001083652 | 144 |
| 340 | 3300005339 | Ga0070660_100028144 | Ga0070660_1000281443 | 144 |
| 341 | 3300005339 | Ga0070660_100087764 | Ga0070660_1000877643 | 144 |
| 342 | 3300005339 | Ga0070660_100134075 | Ga0070660_1001340752 | 144 |
| 343 | 3300005344 | Ga0070661_100222700 | Ga0070661_1002227001 | 144 |
| 344 | 3300005354 | Ga0070675_100383110 | Ga0070675_1003831102 | 144 |
| 345 | 3300005355 | Ga0070671_100001020 | Ga0070671_10000102020 | 144 |
| 346 | 3300005366 | Ga0070659_100010337 | Ga0070659_1000103377 | 144 |
| 347 | 3300005366 | Ga0070659_101142249 | Ga0070659_1011422491 | 144 |
| 348 | 3300005435 | Ga0070714_100270392 | Ga0070714_1002703922 | 144 |
| 349 | 3300005455 | Ga0070663_100046729 | Ga0070663_1000467294 | 144 |
| 350 | 3300005455 | Ga0070663_100079185 | Ga0070663_1000791852 | 144 |
| 351 | 3300005455 | Ga0070663_100318968 | Ga0070663_1003189681 | 144 |
| 352 | 3300005458 | Ga0070681_10334243 | Ga0070681_103342433 | 144 |
| 353 | 3300005458 | Ga0070681_10826020 | Ga0070681_108260202 | 144 |
| 354 | 3300005530 | Ga0070679_100006064 | Ga0070679_1000060644 | 144 |
| 355 | 3300005535 | Ga0070684_100110235 | Ga0070684_1001102352 | 144 |
| 356 | 3300005539 | Ga0068853_100000174 | Ga0068853_10000017444 | 144 |
| 357 | 3300005539 | Ga0068853_100058163 | Ga0068853_1000581632 | 144 |
| 358 | 3300005539 | Ga0068853_100841656 | Ga0068853_1008416561 | 144 |
| 359 | 3300005543 | Ga0070672_100727709 | Ga0070672_1007277092 | 144 |
| 360 | 3300005548 | Ga0070665_100004995 | Ga0070665_1000049953 | 144 |
| 361 | 3300005564 | Ga0070664_100057304 | Ga0070664_1000573044 | 144 |
| 362 | 3300005577 | Ga0068857_100052519 | Ga0068857_1000525192 | 144 |
| 363 | 3300005578 | Ga0068854_100000186 | Ga0068854_10000018642 | 144 |
| 364 | 3300005578 | Ga0068854_100473915 | Ga0068854_1004739152 | 144 |
| 365 | 3300005616 | Ga0068852_100064951 | Ga0068852_1000649511 | 144 |
| 366 | 3300005618 | Ga0068864_100009360 | Ga0068864_1000093609 | 144 |
| 367 | 3300005841 | Ga0068863_100004076 | Ga0068863_1000040764 | 144 |
| 368 | 3300005843 | Ga0068860_100481533 | Ga0068860_1004815331 | 144 |
| 369 | 3300006163 | Ga0070715_10432069 | Ga0070715_104320692 | 144 |
| 370 | 3300006237 | Ga0097621_100662576 | Ga0097621_1006625762 | 144 |
| 371 | 3300006358 | Ga0068871_100346660 | Ga0068871_1003466602 | 144 |
| 372 | 3300009093 | Ga0105240_10018617 | Ga0105240_100186171 | 144 |
| 373 | 3300009093 | Ga0105240_10108808 | Ga0105240_101088082 | 144 |
| 374 | 3300009093 | Ga0105240_10152842 | Ga0105240_101528423 | 144 |
| 375 | 3300009101 | Ga0105247_10207684 | Ga0105247_102076841 | 144 |
| 376 | 3300009174 | Ga0105241_10316100 | Ga0105241_103161001 | 144 |
| 377 | 3300009177 | Ga0105248_10347645 | Ga0105248_103476453 | 144 |
| 378 | 3300009545 | Ga0105237_10068357 | Ga0105237_100683573 | 144 |
| 379 | 3300009545 | Ga0105237_11438114 | Ga0105237_114381141 | 144 |
| 380 | 3300009551 | Ga0105238_10005301 | Ga0105238_100053015 | 144 |
| 381 | 3300013100 | Ga0157373_10454492 | Ga0157373_104544921 | 144 |
| 382 | 3300013102 | Ga0157371_10174405 | Ga0157371_101744051 | 144 |
| 383 | 3300013102 | Ga0157371_10301745 | Ga0157371_103017451 | 144 |
| 384 | 3300013104 | Ga0157370_10012273 | Ga0157370_100122733 | 144 |
| 385 | 3300013104 | Ga0157370_10051672 | Ga0157370_100516724 | 144 |
| 386 | 3300013104 | Ga0157370_10113995 | Ga0157370_101139953 | 144 |
| 387 | 3300013104 | Ga0157370_10188281 | Ga0157370_101882812 | 144 |
| 388 | 3300013104 | Ga0157370_11457419 | Ga0157370_114574191 | 144 |
| 389 | 3300013105 | Ga0157369_10013690 | Ga0157369_100136908 | 144 |
| 390 | 3300013105 | Ga0157369_10068261 | Ga0157369_100682611 | 144 |
| 391 | 3300013105 | Ga0157369_10075191 | Ga0157369_100751915 | 144 |
| 392 | 3300013105 | Ga0157369_10116262 | Ga0157369_101162623 | 144 |
| 393 | 3300013105 | Ga0157369_10469038 | Ga0157369_104690381 | 144 |
| 394 | 3300013105 | Ga0157369_10510624 | Ga0157369_105106242 | 144 |
| 395 | 3300013296 | Ga0157374_10088179 | Ga0157374_100881792 | 144 |
| 396 | 3300013296 | Ga0157374_10104913 | Ga0157374_101049134 | 144 |
| 397 | 3300013297 | Ga0157378_10358353 | Ga0157378_103583532 | 144 |
| 398 | 3300013306 | Ga0163162_10007900 | Ga0163162_1000790011 | 144 |
| 399 | 3300013306 | Ga0163162_10876899 | Ga0163162_108768991 | 144 |
| 400 | 3300013307 | Ga0157372_10005308 | Ga0157372_100053083 | 144 |
| 401 | 3300013307 | Ga0157372_10040606 | Ga0157372_100406062 | 144 |
| 402 | 3300013307 | Ga0157372_10169742 | Ga0157372_101697424 | 144 |
| 403 | 3300013307 | Ga0157372_10691043 | Ga0157372_106910432 | 144 |
| 404 | 3300013308 | Ga0157375_11577136 | Ga0157375_115771361 | 144 |
| 405 | 3300014325 | Ga0163163_10003334 | Ga0163163_100033349 | 144 |
| 406 | 3300014968 | Ga0157379_10094694 | Ga0157379_100946943 | 144 |
| 407 | 3300014968 | Ga0157379_11921050 | Ga0157379_119210501 | 144 |
| 408 | 3300014969 | Ga0157376_10156139 | Ga0157376_101561392 | 144 |
| 409 | 3300020081 | Ga0206354_11100117 | Ga0206354_111001171 | 144 |
| 410 | 3300022467 | Ga0224712_10195201 | Ga0224712_101952011 | 144 |
| 411 | 3300025904 | Ga0207647_10032975 | Ga0207647_100329752 | 144 |
| 412 | 3300025904 | Ga0207647_10177104 | Ga0207647_101771042 | 144 |
| 413 | 3300025909 | Ga0207705_10001912 | Ga0207705_100019129 | 144 |
| 414 | 3300025909 | Ga0207705_10186418 | Ga0207705_101864182 | 144 |
| 415 | 3300025911 | Ga0207654_10273656 | Ga0207654_102736561 | 144 |
| 416 | 3300025912 | Ga0207707_10065953 | Ga0207707_100659534 | 144 |
| 417 | 3300025913 | Ga0207695_10008216 | Ga0207695_100082164 | 144 |
| 418 | 3300025913 | Ga0207695_10084834 | Ga0207695_100848342 | 144 |
| 419 | 3300025914 | Ga0207671_11494245 | Ga0207671_114942451 | 144 |
| 420 | 3300025915 | Ga0207693_10252561 | Ga0207693_102525612 | 144 |
| 421 | 3300025919 | Ga0207657_10001507 | Ga0207657_1000150712 | 144 |
| 422 | 3300025919 | Ga0207657_10017115 | Ga0207657_100171157 | 144 |
| 423 | 3300025919 | Ga0207657_10194237 | Ga0207657_101942372 | 144 |
| 424 | 3300025920 | Ga0207649_10112141 | Ga0207649_101121413 | 144 |
| 425 | 3300025920 | Ga0207649_11410316 | Ga0207649_114103161 | 144 |
| 426 | 3300025925 | Ga0207650_10030159 | Ga0207650_100301595 | 144 |
| 427 | 3300025929 | Ga0207664_10256876 | Ga0207664_102568763 | 144 |
| 428 | 3300025929 | Ga0207664_10260763 | Ga0207664_102607631 | 144 |
| 429 | 3300025931 | Ga0207644_10030504 | Ga0207644_100305044 | 144 |
| 430 | 3300025932 | Ga0207690_10002265 | Ga0207690_1000226511 | 144 |
| 431 | 3300025932 | Ga0207690_10030551 | Ga0207690_100305513 | 144 |
| 432 | 3300025933 | Ga0207706_10064861 | Ga0207706_100648612 | 144 |
| 433 | 3300025938 | Ga0207704_11529824 | Ga0207704_115298241 | 144 |
| 434 | 3300025941 | Ga0207711_10062364 | Ga0207711_100623642 | 144 |
| 435 | 3300025941 | Ga0207711_10077219 | Ga0207711_100772194 | 144 |
| 436 | 3300025941 | Ga0207711_10290489 | Ga0207711_102904892 | 144 |
| 437 | 3300025944 | Ga0207661_10207245 | Ga0207661_102072451 | 144 |
| 438 | 3300025949 | Ga0207667_10088266 | Ga0207667_100882664 | 144 |
| 439 | 3300025949 | Ga0207667_10281503 | Ga0207667_102815033 | 144 |
| 440 | 3300025981 | Ga0207640_10000034 | Ga0207640_100000342 | 144 |
| 441 | 3300025986 | Ga0207658_10388602 | Ga0207658_103886022 | 144 |
| 442 | 3300026041 | Ga0207639_10000115 | Ga0207639_1000011547 | 144 |
| 443 | 3300026041 | Ga0207639_10203754 | Ga0207639_102037541 | 144 |
| 444 | 3300026041 | Ga0207639_11272835 | Ga0207639_112728351 | 144 |
| 445 | 3300026067 | Ga0207678_10003556 | Ga0207678_100035561 | 144 |
| 446 | 3300026067 | Ga0207678_10014956 | Ga0207678_100149563 | 144 |
| 447 | 3300026067 | Ga0207678_10324846 | Ga0207678_103248463 | 144 |
| 448 | 3300026067 | Ga0207678_11091962 | Ga0207678_110919622 | 144 |
| 449 | 3300026088 | Ga0207641_10175274 | Ga0207641_101752742 | 144 |
| 450 | 3300026095 | Ga0207676_10160989 | Ga0207676_101609892 | 144 |
| 451 | 3300026116 | Ga0207674_10005050 | Ga0207674_100050508 | 144 |
| 452 | 3300026121 | Ga0207683_10375192 | Ga0207683_103751922 | 144 |
| 453 | 3300026142 | Ga0207698_10961420 | Ga0207698_109614202 | 144 |
| 454 | 3300037418 | Ga0395900_0158442 | Ga0395900_0158442_1088_1522 | 144 |
| 455 | 3300042436 | Ga0439435_0007548 | Ga0439435_0007548_309_755 | 144 |
| 456 | 3300042461 | Ga0439460_0059828 | Ga0439460_0059828_465_923 | 144 |
| 457 | 3300046452 | Ga0495617_016219 | Ga0495617_016219_487_921 | 144 |
| 458 | 3300046454 | Ga0495592_0097621 | Ga0495592_0097621_1529_1963 | 144 |
| 459 | 3300046455 | Ga0495603_0137902 | Ga0495603_0137902_581_1015 | 144 |
| 460 | 3300046471 | Ga0495650_0000038 | Ga0495650_0000038_161046_161480 | 144 |
| 461 | 3300046472 | Ga0495580_0169549 | Ga0495580_0169549_510_944 | 144 |
| 462 | 3300046491 | Ga0495584_0123430 | Ga0495584_0123430_535_969 | 144 |
| 463 | 3300046492 | Ga0495585_0050871 | Ga0495585_0050871_49_483 | 144 |
| 464 | 3300046499 | Ga0495594_0007770 | Ga0495594_0007770_264_698 | 144 |
| 465 | 3300046500 | Ga0495596_0058708 | Ga0495596_0058708_943_1377 | 144 |
| 466 | 3300046506 | Ga0495583_0022127 | Ga0495583_0022127_1088_1522 | 144 |
| 467 | 3300046507 | Ga0495606_0021082 | Ga0495606_0021082_576_1010 | 144 |
| 468 | 3300046511 | Ga0495608_0433230 | Ga0495608_0433230_117_551 | 144 |
| 469 | 3300046523 | Ga0495644_0000044 | Ga0495644_0000044_32894_33328 | 144 |
| 470 | 3300046525 | Ga0495663_0084669 | Ga0495663_0084669_497_931 | 144 |
| 471 | 3300046538 | Ga0495609_0002185 | Ga0495609_0002185_9641_10075 | 144 |
| 472 | 3300046616 | Ga0495668_0015530 | Ga0495668_0015530_1697_2131 | 144 |
| 473 | 3300046648 | Ga0495611_0016130 | Ga0495611_0016130_2543_2977 | 144 |
| 474 | 3300046660 | Ga0495625_0000580 | Ga0495625_0000580_146_580 | 144 |
| 475 | 3300046660 | Ga0495625_0020612 | Ga0495625_0020612_1754_2188 | 144 |
| 476 | 3300046660 | Ga0495625_0538152 | Ga0495625_0538152_168_602 | 144 |
| 477 | 3300046664 | Ga0495659_0137665 | Ga0495659_0137665_320_754 | 144 |
| 478 | 3300046674 | Ga0495588_0096100 | Ga0495588_0096100_655_1089 | 144 |
| 479 | 3300046679 | Ga0495623_0203974 | Ga0495623_0203974_210_644 | 144 |
| 480 | 3300046684 | Ga0495669_0003780 | Ga0495669_0003780_1749_2183 | 144 |
| 481 | 3300046691 | Ga0495670_0027481 | Ga0495670_0027481_1430_1864 | 144 |
| 482 | 3300046694 | Ga0495649_0208212 | Ga0495649_0208212_398_832 | 144 |
| 483 | 3300047317 | Ga0495604_0016650 | Ga0495604_0016650_3319_3753 | 144 |
| 484 | 3300047318 | Ga0495636_0105372 | Ga0495636_0105372_501_935 | 144 |
| 485 | 3300047320 | Ga0495672_0001831 | Ga0495672_0001831_15797_16231 | 144 |
| 486 | 3300047323 | Ga0495683_0089671 | Ga0495683_0089671_580_1014 | 144 |
| 487 | 3300047445 | Ga0495677_0088244 | Ga0495677_0088244_77_511 | 144 |
| 488 | 3300047447 | Ga0495685_043165 | Ga0495685_043165_652_1086 | 144 |
| 489 | 3300047471 | Ga0495684_0620968 | Ga0495684_0620968_108_584 | 144 |
| 490 | 3300047472 | Ga0495686_0038629 | Ga0495686_0038629_2272_2706 | 144 |
| 491 | 3300047472 | Ga0495686_0314621 | Ga0495686_0314621_239_673 | 144 |
| 492 | 3300048903 | Ga0496100_1342214 | Ga0496100_1342214_43_477 | 144 |
| 493 | 3300048903 | Ga0496100_1610996 | Ga0496100_1610996_56_490 | 144 |
| 494 | 3300048905 | Ga0496102_1448066 | Ga0496102_1448066_128_562 | 144 |
| 495 | 3300048907 | Ga0496104_1286548 | Ga0496104_1286548_62_496 | 144 |
| 496 | 3300048908 | Ga0496105_0377580 | Ga0496105_0377580_544_978 | 144 |
| 497 | 3300048908 | Ga0496105_0541996 | Ga0496105_0541996_399_833 | 144 |
| 498 | 3300048915 | Ga0496112_1215692 | Ga0496112_1215692_20_454 | 144 |
| 499 | 3300048917 | Ga0496114_0032760 | Ga0496114_0032760_2373_2807 | 144 |
| 500 | 3300049568 | Ga0501031_0019586 | Ga0501031_0019586_1221_1655 | 144 |
| 501 | 3300049569 | Ga0501032_0002284 | Ga0501032_0002284_3120_3554 | 144 |
| 502 | 3300049570 | Ga0501033_0000659 | Ga0501033_0000659_24094_24528 | 144 |
| 503 | 3300049571 | Ga0501034_0001806 | Ga0501034_0001806_13494_13928 | 144 |
| 504 | 3300049572 | Ga0501036_0010731 | Ga0501036_0010731_355_789 | 144 |
| 505 | 3300049573 | Ga0501037_0012094 | Ga0501037_0012094_1528_1962 | 144 |
| 506 | 3300049573 | Ga0501037_0050021 | Ga0501037_0050021_2329_2763 | 144 |
| 507 | 3300049574 | Ga0501038_0018000 | Ga0501038_0018000_269_703 | 144 |
| 508 | 3300049574 | Ga0501038_0725129 | Ga0501038_0725129_16_450 | 144 |
| 509 | 3300049575 | Ga0501039_0108274 | Ga0501039_0108274_238_672 | 144 |
| 510 | 3300049579 | Ga0501043_0002589 | Ga0501043_0002589_9924_10358 | 144 |
| 511 | 3300049580 | Ga0501046_0000056 | Ga0501046_0000056_85901_86335 | 144 |
| 512 | 3300049581 | Ga0501047_0051099 | Ga0501047_0051099_1083_1517 | 144 |
| 513 | 3300049581 | Ga0501047_0484092 | Ga0501047_0484092_86_520 | 144 |
| 514 | 3300049585 | Ga0501069_0103712 | Ga0501069_0103712_411_845 | 144 |
| 515 | 3300049586 | Ga0501070_0112578 | Ga0501070_0112578_1446_1880 | 144 |
| 516 | 3300049589 | Ga0501073_0010311 | Ga0501073_0010311_2967_3401 | 144 |
| 517 | 3300049589 | Ga0501073_0019909 | Ga0501073_0019909_872_1306 | 144 |
| 518 | 3300049590 | Ga0501074_0245205 | Ga0501074_0245205_787_1221 | 144 |
| 519 | 3300049742 | Ga0501080_0033309 | Ga0501080_0033309_2508_2942 | 144 |
| 520 | 3300049742 | Ga0501080_0635639 | Ga0501080_0635639_41_475 | 144 |
| 521 | 3300049822 | Ga0501035_0001253 | Ga0501035_0001253_6986_7420 | 144 |
| 522 | 3300049823 | Ga0501044_0007868 | Ga0501044_0007868_9029_9463 | 144 |
| 523 | 3300049823 | Ga0501044_0520600 | Ga0501044_0520600_548_982 | 144 |
| 524 | 3300050507 | nmdc:mga05p37_85593_c1 | nmdc:mga05p37_85593_c1_2322_2756 | 144 |
| 525 | 3300053087 | Ga0500643_053056 | Ga0500643_053056_506_940 | 144 |
| 526 | 3300053119 | Ga0500595_045224 | Ga0500595_045224_315_749 | 144 |
| 527 | 3300003320 | rootH2_10021145 | rootH2_100211452 | 145 |
| 528 | 3300005327 | Ga0070658_10000006 | Ga0070658_10000006169 | 145 |
| 529 | 3300005327 | Ga0070658_10039592 | Ga0070658_100395923 | 145 |
| 530 | 3300005327 | Ga0070658_10134911 | Ga0070658_101349111 | 145 |
| 531 | 3300005330 | Ga0070690_100365598 | Ga0070690_1003655981 | 145 |
| 532 | 3300005336 | Ga0070680_100651889 | Ga0070680_1006518891 | 145 |
| 533 | 3300005340 | Ga0070689_100144210 | Ga0070689_1001442102 | 145 |
| 534 | 3300005364 | Ga0070673_100020375 | Ga0070673_1000203753 | 145 |
| 535 | 3300005365 | Ga0070688_100061220 | Ga0070688_1000612203 | 145 |
| 536 | 3300005365 | Ga0070688_100350705 | Ga0070688_1003507051 | 145 |
| 537 | 3300005440 | Ga0070705_100793432 | Ga0070705_1007934322 | 145 |
| 538 | 3300005455 | Ga0070663_100013088 | Ga0070663_1000130883 | 145 |
| 539 | 3300005455 | Ga0070663_100179349 | Ga0070663_1001793492 | 145 |
| 540 | 3300005458 | Ga0070681_10399810 | Ga0070681_103998102 | 145 |
| 541 | 3300005459 | Ga0068867_100791107 | Ga0068867_1007911072 | 145 |
| 542 | 3300005543 | Ga0070672_100240086 | Ga0070672_1002400863 | 145 |
| 543 | 3300005549 | Ga0070704_100578349 | Ga0070704_1005783492 | 145 |
| 544 | 3300005563 | Ga0068855_100007178 | Ga0068855_10000717815 | 145 |
| 545 | 3300005563 | Ga0068855_100174182 | Ga0068855_1001741822 | 145 |
| 546 | 3300005563 | Ga0068855_100291926 | Ga0068855_1002919263 | 145 |
| 547 | 3300005564 | Ga0070664_100299054 | Ga0070664_1002990542 | 145 |
| 548 | 3300005578 | Ga0068854_100218723 | Ga0068854_1002187233 | 145 |
| 549 | 3300005614 | Ga0068856_100850196 | Ga0068856_1008501961 | 145 |
| 550 | 3300005617 | Ga0068859_100018092 | Ga0068859_1000180927 | 145 |
| 551 | 3300005618 | Ga0068864_100090822 | Ga0068864_1000908223 | 145 |
| 552 | 3300005719 | Ga0068861_100326568 | Ga0068861_1003265682 | 145 |
| 553 | 3300005842 | Ga0068858_100570505 | Ga0068858_1005705051 | 145 |
| 554 | 3300005843 | Ga0068860_101084191 | Ga0068860_1010841912 | 145 |
| 555 | 3300006844 | Ga0075428_100025549 | Ga0075428_1000255498 | 145 |
| 556 | 3300006852 | Ga0075433_10076442 | Ga0075433_100764424 | 145 |
| 557 | 3300006871 | Ga0075434_100110513 | Ga0075434_1001105134 | 145 |
| 558 | 3300006880 | Ga0075429_100013415 | Ga0075429_1000134157 | 145 |
| 559 | 3300006931 | Ga0097620_100018092 | Ga0097620_1000180924 | 145 |
| 560 | 3300007076 | Ga0075435_100286507 | Ga0075435_1002865072 | 145 |
| 561 | 3300009036 | Ga0105244_10053379 | Ga0105244_100533792 | 145 |
| 562 | 3300009093 | Ga0105240_10094503 | Ga0105240_100945033 | 145 |
| 563 | 3300009094 | Ga0111539_10949297 | Ga0111539_109492972 | 145 |
| 564 | 3300009098 | Ga0105245_10006935 | Ga0105245_100069354 | 145 |
| 565 | 3300009147 | Ga0114129_10104725 | Ga0114129_101047252 | 145 |
| 566 | 3300009177 | Ga0105248_10256222 | Ga0105248_102562223 | 145 |
| 567 | 3300009551 | Ga0105238_10320094 | Ga0105238_103200942 | 145 |
| 568 | 3300009553 | Ga0105249_10163025 | Ga0105249_101630252 | 145 |
| 569 | 3300013104 | Ga0157370_10103328 | Ga0157370_101033283 | 145 |
| 570 | 3300013104 | Ga0157370_11074699 | Ga0157370_110746992 | 145 |
| 571 | 3300013105 | Ga0157369_11710280 | Ga0157369_117102801 | 145 |
| 572 | 3300013296 | Ga0157374_10271103 | Ga0157374_102711031 | 145 |
| 573 | 3300013308 | Ga0157375_10059475 | Ga0157375_100594753 | 145 |
| 574 | 3300014745 | Ga0157377_10646896 | Ga0157377_106468961 | 145 |
| 575 | 3300019166 | Ga0184595_107919 | Ga0184595_1079192 | 145 |
| 576 | 3300020069 | Ga0197907_10738779 | Ga0197907_107387791 | 145 |
| 577 | 3300020076 | Ga0206355_1537879 | Ga0206355_15378791 | 145 |
| 578 | 3300025903 | Ga0207680_10414009 | Ga0207680_104140092 | 145 |
| 579 | 3300025909 | Ga0207705_10000012 | Ga0207705_10000012176 | 145 |
| 580 | 3300025909 | Ga0207705_10076147 | Ga0207705_100761473 | 145 |
| 581 | 3300025909 | Ga0207705_10151788 | Ga0207705_101517882 | 145 |
| 582 | 3300025912 | Ga0207707_10023728 | Ga0207707_100237282 | 145 |
| 583 | 3300025913 | Ga0207695_10192236 | Ga0207695_101922363 | 145 |
| 584 | 3300025913 | Ga0207695_10234786 | Ga0207695_102347861 | 145 |
| 585 | 3300025923 | Ga0207681_10289314 | Ga0207681_102893142 | 145 |
| 586 | 3300025927 | Ga0207687_10391695 | Ga0207687_103916951 | 145 |
| 587 | 3300025936 | Ga0207670_10033206 | Ga0207670_100332065 | 145 |
| 588 | 3300025941 | Ga0207711_10165572 | Ga0207711_101655722 | 145 |
| 589 | 3300025942 | Ga0207689_10061204 | Ga0207689_100612042 | 145 |
| 590 | 3300025945 | Ga0207679_10015483 | Ga0207679_100154837 | 145 |
| 591 | 3300025949 | Ga0207667_10016157 | Ga0207667_100161573 | 145 |
| 592 | 3300025949 | Ga0207667_10050332 | Ga0207667_100503323 | 145 |
| 593 | 3300025949 | Ga0207667_11381590 | Ga0207667_113815901 | 145 |
| 594 | 3300025960 | Ga0207651_10006568 | Ga0207651_100065687 | 145 |
| 595 | 3300026035 | Ga0207703_10291778 | Ga0207703_102917782 | 145 |
| 596 | 3300026035 | Ga0207703_10494871 | Ga0207703_104948711 | 145 |
| 597 | 3300026067 | Ga0207678_10021612 | Ga0207678_100216125 | 145 |
| 598 | 3300026078 | Ga0207702_11261545 | Ga0207702_112615451 | 145 |
| 599 | 3300026095 | Ga0207676_10154705 | Ga0207676_101547053 | 145 |
| 600 | 3300026116 | Ga0207674_10398721 | Ga0207674_103987213 | 145 |
| 601 | 3300026118 | Ga0207675_100095349 | Ga0207675_1000953494 | 145 |
| 602 | 3300028800 | Ga0265338_10176577 | Ga0265338_101765771 | 145 |
| 603 | 3300032120 | Ga0316053_103404 | Ga0316053_1034042 | 145 |
| 604 | 3300036401 | Ga0373937_1041203 | Ga0373937_1041203_172_687 | 145 |
| 605 | 3300044658 | Ga0466972_0304243 | Ga0466972_0304243_53_493 | 145 |
| 606 | 3300044694 | Ga0466963_0555421 | Ga0466963_0555421_165_614 | 145 |
| 607 | 3300048905 | Ga0496102_0382754 | Ga0496102_0382754_73_516 | 145 |
| 608 | 3300048908 | Ga0496105_1370255 | Ga0496105_1370255_22_459 | 145 |
| 609 | 3300048910 | Ga0496107_0466959 | Ga0496107_0466959_286_729 | 145 |
| 610 | 3300048916 | Ga0496113_1309957 | Ga0496113_1309957_96_539 | 145 |
| 611 | 3300049460 | Ga0495682_0031856 | Ga0495682_0031856_174_614 | 145 |
| 612 | 3300050507 | nmdc:mga05p37_553621_c1 | nmdc:mga05p37_553621_c1_372_818 | 145 |
| 613 | 3300050512 | nmdc:mga0n895_1245337_c1 | nmdc:mga0n895_1245337_c1_164_610 | 145 |
| 614 | 3300050513 | nmdc:mga0rr50_62289_c1 | nmdc:mga0rr50_62289_c1_1555_2001 | 145 |
| 615 | 3300059510 | Ga0587090_034126 | Ga0587090_034126_284_727 | 145 |
| 616 | 3300060344 | Ga0587071_040397 | Ga0587071_040397_320_763 | 145 |
| 617 | 3300003322 | rootL2_10015203 | rootL2_100152032 | 146 |
| 618 | 3300004799 | Ga0058863_11594059 | Ga0058863_115940591 | 146 |
| 619 | 3300004800 | Ga0058861_11268347 | Ga0058861_112683471 | 146 |
| 620 | 3300004803 | Ga0058862_12433139 | Ga0058862_124331391 | 146 |
| 621 | 3300005337 | Ga0070682_100373030 | Ga0070682_1003730302 | 146 |
| 622 | 3300005343 | Ga0070687_100555500 | Ga0070687_1005555001 | 146 |
| 623 | 3300005364 | Ga0070673_100223203 | Ga0070673_1002232032 | 146 |
| 624 | 3300005437 | Ga0070710_10232429 | Ga0070710_102324292 | 146 |
| 625 | 3300005530 | Ga0070679_100000607 | Ga0070679_10000060720 | 146 |
| 626 | 3300005544 | Ga0070686_100313514 | Ga0070686_1003135142 | 146 |
| 627 | 3300005840 | Ga0068870_10501858 | Ga0068870_105018582 | 146 |
| 628 | 3300006163 | Ga0070715_10404038 | Ga0070715_104040381 | 146 |
| 629 | 3300009093 | Ga0105240_10000001 | Ga0105240_100000012067 | 146 |
| 630 | 3300009093 | Ga0105240_10411545 | Ga0105240_104115451 | 146 |
| 631 | 3300013104 | Ga0157370_10758244 | Ga0157370_107582442 | 146 |
| 632 | 3300013296 | Ga0157374_10168865 | Ga0157374_101688652 | 146 |
| 633 | 3300025898 | Ga0207692_10212724 | Ga0207692_102127241 | 146 |
| 634 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000012070 | 146 |
| 635 | 3300025918 | Ga0207662_10555980 | Ga0207662_105559801 | 146 |
| 636 | 3300025921 | Ga0207652_10011368 | Ga0207652_100113684 | 146 |
| 637 | 3300025960 | Ga0207651_10191582 | Ga0207651_101915823 | 146 |
| 638 | 3300031239 | Ga0265328_10127024 | Ga0265328_101270242 | 146 |
| 639 | 3300031616 | Ga0307508_10057810 | Ga0307508_100578103 | 146 |
| 640 | 3300031665 | Ga0316575_10172676 | Ga0316575_101726762 | 146 |
| 641 | 3300035241 | Ga0373961_0000560 | Ga0373961_0000560_2628_3068 | 146 |
| 642 | 3300035398 | Ga0316574_0001659 | Ga0316574_0001659_1893_2333 | 146 |
| 643 | 3300035692 | Ga0373935_0002837 | Ga0373935_0002837_4211_4654 | 146 |
| 644 | 3300042007 | Ga0439449_0158714 | Ga0439449_0158714_325_792 | 146 |
| 645 | 3300047472 | Ga0495686_0351057 | Ga0495686_0351057_79_537 | 146 |
| 646 | 3300048090 | Ga0495615_0041972 | Ga0495615_0041972_426_875 | 146 |
| 647 | 3300048917 | Ga0496114_0000036 | Ga0496114_0000036_42036_42485 | 146 |
| 648 | 3300049460 | Ga0495682_0061520 | Ga0495682_0061520_317_775 | 146 |
| 649 | 3300049583 | Ga0501067_0024525 | Ga0501067_0024525_1262_1708 | 146 |
| 650 | 3300049584 | Ga0501068_0065117 | Ga0501068_0065117_113_559 | 146 |
| 651 | 3300049584 | Ga0501068_0488041 | Ga0501068_0488041_324_767 | 146 |
| 652 | 3300049591 | Ga0501075_0000962 | Ga0501075_0000962_17244_17690 | 146 |
| 653 | 3300049593 | Ga0501077_0002393 | Ga0501077_0002393_759_1205 | 146 |
| 654 | 3300049742 | Ga0501080_0008888 | Ga0501080_0008888_676_1122 | 146 |
| 655 | 3300050511 | nmdc:mga08y16_587749_c1 | nmdc:mga08y16_587749_c1_505_993 | 146 |
| 656 | 3300050513 | nmdc:mga0rr50_1489417_c1 | nmdc:mga0rr50_1489417_c1_13_477 | 146 |
| 657 | 3300053083 | Ga0495655_0063826 | Ga0495655_0063826_57_503 | 146 |
| 658 | 3300059623 | Ga0587101_013343 | Ga0587101_013343_586_1029 | 146 |
| 659 | 3300060353 | Ga0501082_0000072 | Ga0501082_0000072_10054_10503 | 146 |
| 660 | 3300060353 | Ga0501082_0626769 | Ga0501082_0626769_424_882 | 146 |
| 661 | 3300002239 | JGI24034J26672_10081659 | JGI24034J26672_100816591 | 147 |
| 662 | 3300004785 | Ga0058858_1410928 | Ga0058858_14109282 | 147 |
| 663 | 3300005327 | Ga0070658_10038379 | Ga0070658_100383795 | 147 |
| 664 | 3300005335 | Ga0070666_10127318 | Ga0070666_101273183 | 147 |
| 665 | 3300005338 | Ga0068868_100825760 | Ga0068868_1008257601 | 147 |
| 666 | 3300005364 | Ga0070673_102027871 | Ga0070673_1020278711 | 147 |
| 667 | 3300005434 | Ga0070709_10272640 | Ga0070709_102726403 | 147 |
| 668 | 3300005434 | Ga0070709_10281533 | Ga0070709_102815332 | 147 |
| 669 | 3300005471 | Ga0070698_100551473 | Ga0070698_1005514732 | 147 |
| 670 | 3300005539 | Ga0068853_102204399 | Ga0068853_1022043991 | 147 |
| 671 | 3300005544 | Ga0070686_100078006 | Ga0070686_1000780061 | 147 |
| 672 | 3300006871 | Ga0075434_100051793 | Ga0075434_1000517935 | 147 |
| 673 | 3300006871 | Ga0075434_100134374 | Ga0075434_1001343744 | 147 |
| 674 | 3300006871 | Ga0075434_100287013 | Ga0075434_1002870133 | 147 |
| 675 | 3300006881 | Ga0068865_100316941 | Ga0068865_1003169412 | 147 |
| 676 | 3300006914 | Ga0075436_100019506 | Ga0075436_1000195065 | 147 |
| 677 | 3300007076 | Ga0075435_100032075 | Ga0075435_1000320752 | 147 |
| 678 | 3300009553 | Ga0105249_10100341 | Ga0105249_101003412 | 147 |
| 679 | 3300025906 | Ga0207699_10228473 | Ga0207699_102284731 | 147 |
| 680 | 3300025907 | Ga0207645_10013115 | Ga0207645_100131156 | 147 |
| 681 | 3300025909 | Ga0207705_10019852 | Ga0207705_100198524 | 147 |
| 682 | 3300025961 | Ga0207712_10146032 | Ga0207712_101460323 | 147 |
| 683 | 3300032002 | Ga0307416_101899730 | Ga0307416_1018997301 | 147 |
| 684 | 3300041444 | Ga0451790_48433 | Ga0451790_48433_74_520 | 147 |
| 685 | 3300041496 | Ga0451839_1488214 | Ga0451839_1488214_403_849 | 147 |
| 686 | 3300041509 | Ga0451843_1648800 | Ga0451843_1648800_209_655 | 147 |
| 687 | 3300044694 | Ga0466963_0305858 | Ga0466963_0305858_625_1071 | 147 |
| 688 | 3300049744 | Ga0501083_0002132 | Ga0501083_0002132_8547_8993 | 147 |
| 689 | 3300050512 | nmdc:mga0n895_246885_c1 | nmdc:mga0n895_246885_c1_1329_1775 | 147 |
| 690 | 3300050513 | nmdc:mga0rr50_43944_c1 | nmdc:mga0rr50_43944_c1_595_1041 | 147 |
| 691 | 3300050514 | nmdc:mga08x19_243258_c1 | nmdc:mga08x19_243258_c1_741_1187 | 147 |
| 692 | 3300050514 | nmdc:mga08x19_6642_c1 | nmdc:mga08x19_6642_c1_4071_4556 | 147 |
| 693 | 3300050515 | nmdc:mga0a205_174267_c1 | nmdc:mga0a205_174267_c1_344_790 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4w-assembly1.cif.gz_I | a. baumannii ribosome-eravacycline complex: empty 70s | 0.9637 | 8 | 142 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9635 | 8 | 142 |
| 7jql-assembly2.cif.gz_2N | crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution | 0.9593 | 12 | 142 |
| 7nhn-assembly1.cif.gz_M | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9575 | 11 | 141 |
| 7asn-assembly1.cif.gz_H | staphylococcus aureus 50s after 30 minutes incubation a 37c | 0.9573 | 11 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9606 | 12 | 141 | 3.90.1180.10 |
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9604 | 14 | 144 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9579 | 14 | 144 | 3.90.1180.10 |
| af_Q554U7_3_170_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9508 | 13 | 136 | 3.90.1180.10 |
| af_O96222_56_212_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9397 | 11 | 141 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A5L5J7-F1-model_v4 | deleted | 0.9857 | 8 | 141 |
|
| AF-A0A7C2HIC1-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9809 | 8 | 143 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A7W0YEG7-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9788 | 12 | 143 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A101F7L1-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9776 | 8 | 144 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A3B4X4E0-F1-model_v4 | 50S ribosomal protein L13 | 0.9773 | 14 | 141 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar