F475683

General Info

Members Datasets Scaffolds Average Seq Length
693 347 689 144

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_6642_c1|nmdc:mga08x19_6642_c1_4071_4556
Length 161
Sequence MLQLSDGDLSMKRTYSPKLAEIEHRWFVVDAAVVPLGRLSTLVAHLLMGKHKPTWAPHIDVGDFVIVVNAEKAVLTGRKEDQKMYHRHSGYPGGLKSVTAGQMRQRRPTKLVEEAVRGMLPKSKLGRQLARKLKVYAGPEHPHQAQQPTPLNPADAAQASA

Samples

Sample ID Description Type Environment
1 2643221553 Microbacterium sp. Root553 Isolate Unclassified
2 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
3 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
4 2773857933 Frankia sp. BMG5.30 Isolate Nodule
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
194 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
224 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
225 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
228 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
337 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.5
Metatranscriptomes 6.93
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0.14
Rhizoplane 3.03
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10081659 3300002239 Bacteria 591
2 rootH2_10021145 3300003320 Bacteria 6684
3 rootH2_10080382 3300003320 Bacteria 1106
4 rootL2_10015203 3300003322 Bacteria 2099
5 Ga0058858_1410928 3300004785 Bacteria 760
6 Ga0058859_11553821 3300004798 Bacteria 868
7 Ga0058863_11594059 3300004799 Bacteria 792
8 Ga0058861_11268347 3300004800 Bacteria 754
9 Ga0058862_12433139 3300004803 Bacteria 881
10 Ga0058862_12851463 3300004803 Bacteria 1474
11 Ga0065714_10138911 3300005288 Bacteria 1187
12 Ga0065704_10308306 3300005289 Unclassified 873
13 Ga0065707_10215047 3300005295 Bacteria 1248
14 Ga0070658_10000006 3300005327 Bacteria 374835
15 Ga0070658_10007225 3300005327 Bacteria 8964
16 Ga0070658_10038379 3300005327 Bacteria 3862
17 Ga0070658_10039592 3300005327 Bacteria 3802
18 Ga0070658_10134911 3300005327 Bacteria 2058
19 Ga0070658_10137527 3300005327 Bacteria 2039
20 Ga0070658_10232851 3300005327 Bacteria 1560
21 Ga0070658_10398281 3300005327 Bacteria 1182
22 Ga0070683_100009432 3300005329 Bacteria 8347
23 Ga0070683_100288005 3300005329 Bacteria 1562
24 Ga0070690_100365598 3300005330 Bacteria 1051
25 Ga0070670_100334747 3300005331 Bacteria 1328
26 Ga0070666_10030165 3300005335 Bacteria 3571
27 Ga0070666_10127318 3300005335 Bacteria 1768
28 Ga0070680_100108365 3300005336 Bacteria 2311
29 Ga0070680_100651889 3300005336 Bacteria 905
30 Ga0070682_100373030 3300005337 Bacteria 1071
31 Ga0068868_100825760 3300005338 Bacteria 838
32 Ga0070660_100002152 3300005339 Bacteria 13591
33 Ga0070660_100013713 3300005339 Bacteria 5826
34 Ga0070660_100028144 3300005339 Bacteria 4203
35 Ga0070660_100087764 3300005339 Bacteria 2448
36 Ga0070660_100134075 3300005339 Bacteria 1984
37 Ga0070689_100144210 3300005340 Bacteria 1917
38 Ga0070691_10170258 3300005341 Bacteria 1128
39 Ga0070687_100555500 3300005343 Bacteria 782
40 Ga0070661_100116121 3300005344 Bacteria 2002
41 Ga0070661_100222700 3300005344 Bacteria 1448
42 Ga0070669_100000164 3300005353 Bacteria 58203
43 Ga0070675_100383110 3300005354 Bacteria 1252
44 Ga0070675_100672476 3300005354 Bacteria 942
45 Ga0070671_100001020 3300005355 Bacteria 20592
46 Ga0070673_100020375 3300005364 Bacteria 4783
47 Ga0070673_100223203 3300005364 Bacteria 1632
48 Ga0070673_102027871 3300005364 Bacteria 546
49 Ga0070688_100061220 3300005365 Bacteria 2379
50 Ga0070688_100350705 3300005365 Bacteria 1080
51 Ga0070659_100010337 3300005366 Bacteria 6864
52 Ga0070659_100292248 3300005366 Bacteria 1357
53 Ga0070659_101142249 3300005366 Bacteria 687
54 Ga0070667_100874256 3300005367 Bacteria 836
55 Ga0070709_10272640 3300005434 Bacteria 1227
56 Ga0070709_10281533 3300005434 Bacteria 1209
57 Ga0070714_100270392 3300005435 Bacteria 1576
58 Ga0070713_101251718 3300005436 Bacteria 719
59 Ga0070713_101268654 3300005436 Bacteria 714
60 Ga0070710_10232429 3300005437 Bacteria 1178
61 Ga0070701_10292922 3300005438 Bacteria 998
62 Ga0070705_100252361 3300005440 Bacteria 1239
63 Ga0070705_100793432 3300005440 Bacteria 753
64 Ga0070700_100170164 3300005441 Bacteria 1508
65 Ga0070694_100155421 3300005444 Bacteria 1674
66 Ga0070663_100013088 3300005455 Bacteria 5272
67 Ga0070663_100046729 3300005455 Bacteria 3064
68 Ga0070663_100079185 3300005455 Bacteria 2410
69 Ga0070663_100179349 3300005455 Bacteria 1642
70 Ga0070663_100318968 3300005455 Bacteria 1249
71 Ga0070681_10093860 3300005458 Bacteria 2950
72 Ga0070681_10198698 3300005458 Bacteria 1924
73 Ga0070681_10334243 3300005458 Bacteria 1424
74 Ga0070681_10399810 3300005458 Bacteria 1285
75 Ga0070681_10826020 3300005458 Bacteria 844
76 Ga0068867_100791107 3300005459 Bacteria 845
77 Ga0068867_101786507 3300005459 Bacteria 578
78 Ga0070698_100551473 3300005471 Bacteria 1092
79 Ga0070679_100000607 3300005530 Bacteria 30473
80 Ga0070679_100006064 3300005530 Bacteria 11247
81 Ga0070679_100024592 3300005530 Bacteria 5905
82 Ga0070679_100059401 3300005530 Bacteria 3811
83 Ga0070684_100005900 3300005535 Bacteria 9431
84 Ga0070684_100110235 3300005535 Bacteria 2467
85 Ga0070684_100591579 3300005535 Bacteria 1031
86 Ga0068853_100000174 3300005539 Bacteria 44771
87 Ga0068853_100044099 3300005539 Bacteria 3818
88 Ga0068853_100058163 3300005539 Bacteria 3337
89 Ga0068853_100841656 3300005539 Bacteria 880
90 Ga0068853_102204399 3300005539 Bacteria 534
91 Ga0070672_100240086 3300005543 Bacteria 1524
92 Ga0070672_100727709 3300005543 Bacteria 870
93 Ga0070686_100078006 3300005544 Bacteria 2186
94 Ga0070686_100313514 3300005544 Bacteria 1167
95 Ga0070665_100000280 3300005548 Bacteria 83526
96 Ga0070665_100004995 3300005548 Bacteria 13757
97 Ga0070704_100023634 3300005549 Bacteria 4020
98 Ga0070704_100578349 3300005549 Bacteria 985
99 Ga0068855_100007178 3300005563 Bacteria 13520
100 Ga0068855_100154131 3300005563 Bacteria 2611
101 Ga0068855_100174182 3300005563 Bacteria 2435
102 Ga0068855_100291926 3300005563 Bacteria 1807
103 Ga0068855_100301722 3300005563 Bacteria 1773
104 Ga0070664_100057304 3300005564 Bacteria 3312
105 Ga0070664_100299054 3300005564 Bacteria 1454
106 Ga0070664_100748375 3300005564 Bacteria 912
107 Ga0068857_100017675 3300005577 Bacteria 6254
108 Ga0068857_100052519 3300005577 Bacteria 3616
109 Ga0068854_100000186 3300005578 Bacteria 41742
110 Ga0068854_100218723 3300005578 Bacteria 1506
111 Ga0068854_100473915 3300005578 Bacteria 1050
112 Ga0068854_101619604 3300005578 Bacteria 590
113 Ga0068856_100013051 3300005614 Bacteria 8047
114 Ga0068856_100850196 3300005614 Bacteria 932
115 Ga0068852_100042793 3300005616 Bacteria 3836
116 Ga0068852_100064951 3300005616 Bacteria 3183
117 Ga0068852_100128851 3300005616 Bacteria 2327
118 Ga0068859_100018092 3300005617 Bacteria 7082
119 Ga0068864_100009360 3300005618 Bacteria 8083
120 Ga0068864_100090822 3300005618 Bacteria 2693
121 Ga0068861_100326568 3300005719 Bacteria 1338
122 Ga0068870_10501858 3300005840 Bacteria 809
123 Ga0068863_100004076 3300005841 Bacteria 14431
124 Ga0068858_100570505 3300005842 Bacteria 1096
125 Ga0068860_100481533 3300005843 Bacteria 1237
126 Ga0068860_101084191 3300005843 Bacteria 820
127 Ga0070717_10001558 3300006028 Bacteria 15887
128 Ga0070717_10404308 3300006028 Bacteria 1227
129 Ga0075368_10012903 3300006042 Bacteria 3061
130 Ga0075364_10128675 3300006051 Bacteria 1699
131 Ga0070715_10404038 3300006163 Bacteria 760
132 Ga0070715_10432069 3300006163 Bacteria 739
133 Ga0075367_10110568 3300006178 Bacteria 1686
134 Ga0075369_10004944 3300006186 Bacteria 4958
135 Ga0097621_100000066 3300006237 Bacteria 54619
136 Ga0097621_100662576 3300006237 Bacteria 958
137 Ga0068871_100000170 3300006358 Bacteria 43522
138 Ga0068871_100346660 3300006358 Bacteria 1313
139 Ga0075428_100025549 3300006844 Bacteria 6539
140 Ga0075428_100188315 3300006844 Bacteria 2232
141 Ga0075433_10006367 3300006852 Bacteria 9334
142 Ga0075433_10076442 3300006852 Bacteria 2948
143 Ga0075434_100000005 3300006871 Bacteria 104425
144 Ga0075434_100051793 3300006871 Bacteria 4079
145 Ga0075434_100110513 3300006871 Bacteria 2759
146 Ga0075434_100134374 3300006871 Bacteria 2493
147 Ga0075434_100287013 3300006871 Bacteria 1665
148 Ga0075429_100013415 3300006880 Bacteria 7106
149 Ga0068865_100316941 3300006881 Bacteria 1253
150 Ga0075436_100007285 3300006914 Bacteria 7566
151 Ga0075436_100019506 3300006914 Bacteria 4647
152 Ga0097620_100018092 3300006931 Bacteria 7082
153 Ga0075435_100024980 3300007076 Bacteria 4645
154 Ga0075435_100032075 3300007076 Bacteria 4147
155 Ga0075435_100286507 3300007076 Bacteria 1407
156 Ga0105244_10053379 3300009036 Bacteria 2054
157 Ga0105240_10000001 3300009093 Bacteria 2887840
158 Ga0105240_10018617 3300009093 Bacteria 9311
159 Ga0105240_10094503 3300009093 Bacteria 3646
160 Ga0105240_10108808 3300009093 Bacteria 3357
161 Ga0105240_10152842 3300009093 Bacteria 2747
162 Ga0105240_10411545 3300009093 Bacteria 1521
163 Ga0105240_10483312 3300009093 Bacteria 1380
164 Ga0105240_11213535 3300009093 Bacteria 798
165 Ga0111539_10102893 3300009094 Bacteria 3352
166 Ga0111539_10949297 3300009094 Bacteria 1000
167 Ga0105245_10006935 3300009098 Bacteria 9931
168 Ga0105247_10207684 3300009101 Bacteria 1319
169 Ga0114129_10104725 3300009147 Bacteria 3910
170 Ga0114129_10271377 3300009147 Bacteria 2269
171 Ga0114129_10331348 3300009147 Bacteria 2021
172 Ga0105241_10316100 3300009174 Bacteria 1345
173 Ga0105248_10256222 3300009177 Bacteria 1970
174 Ga0105248_10347645 3300009177 Bacteria 1669
175 Ga0105248_10604239 3300009177 Bacteria 1238
176 Ga0105237_10068357 3300009545 Bacteria 3546
177 Ga0105237_10328505 3300009545 Bacteria 1533
178 Ga0105237_11438114 3300009545 Bacteria 696
179 Ga0105238_10005301 3300009551 Bacteria 12738
180 Ga0105238_10122060 3300009551 Bacteria 2585
181 Ga0105238_10320094 3300009551 Bacteria 1537
182 Ga0105249_10100341 3300009553 Bacteria 2722
183 Ga0105249_10163025 3300009553 Bacteria 2156
184 Ga0105249_11136780 3300009553 Bacteria 851
185 Ga0105239_10669784 3300010375 Bacteria 1185
186 Ga0157373_10454492 3300013100 Bacteria 922
187 Ga0157371_10007064 3300013102 Bacteria 9136
188 Ga0157371_10135608 3300013102 Bacteria 1753
189 Ga0157371_10174405 3300013102 Bacteria 1537
190 Ga0157371_10301745 3300013102 Bacteria 1159
191 Ga0157370_10012273 3300013104 Bacteria 8893
192 Ga0157370_10051672 3300013104 Bacteria 3926
193 Ga0157370_10103328 3300013104 Bacteria 2667
194 Ga0157370_10113995 3300013104 Bacteria 2526
195 Ga0157370_10188281 3300013104 Bacteria 1916
196 Ga0157370_10391993 3300013104 Bacteria 1279
197 Ga0157370_10758244 3300013104 Bacteria 884
198 Ga0157370_11074699 3300013104 Bacteria 727
199 Ga0157370_11457419 3300013104 Bacteria 616
200 Ga0157369_10013690 3300013105 Bacteria 9170
201 Ga0157369_10036291 3300013105 Bacteria 5402
202 Ga0157369_10068261 3300013105 Bacteria 3819
203 Ga0157369_10075191 3300013105 Bacteria 3622
204 Ga0157369_10116262 3300013105 Bacteria 2840
205 Ga0157369_10228469 3300013105 Bacteria 1946
206 Ga0157369_10359774 3300013105 Bacteria 1511
207 Ga0157369_10469038 3300013105 Bacteria 1303
208 Ga0157369_10510624 3300013105 Bacteria 1243
209 Ga0157369_10793528 3300013105 Unclassified 973
210 Ga0157369_11710280 3300013105 Bacteria 639
211 Ga0157374_10088179 3300013296 Bacteria 2955
212 Ga0157374_10104913 3300013296 Bacteria 2714
213 Ga0157374_10168865 3300013296 Bacteria 2133
214 Ga0157374_10271103 3300013296 Bacteria 1673
215 Ga0157374_11177568 3300013296 Bacteria 788
216 Ga0157378_10358353 3300013297 Bacteria 1427
217 Ga0157378_10961232 3300013297 Bacteria 887
218 Ga0163162_10007900 3300013306 Bacteria 10367
219 Ga0163162_10876899 3300013306 Bacteria 1011
220 Ga0157372_10005308 3300013307 Bacteria 13687
221 Ga0157372_10040606 3300013307 Bacteria 5139
222 Ga0157372_10096540 3300013307 Bacteria 3369
223 Ga0157372_10096633 3300013307 Bacteria 3367
224 Ga0157372_10169742 3300013307 Bacteria 2524
225 Ga0157372_10273045 3300013307 Bacteria 1965
226 Ga0157372_10691043 3300013307 Bacteria 1187
227 Ga0157372_11497160 3300013307 Bacteria 777
228 Ga0157375_10059475 3300013308 Bacteria 3786
229 Ga0157375_11577136 3300013308 Bacteria 776
230 Ga0163163_10003334 3300014325 Bacteria 13627
231 Ga0163163_10762424 3300014325 Bacteria 1031
232 Ga0157380_10004468 3300014326 Bacteria 9690
233 Ga0157380_10435330 3300014326 Bacteria 1255
234 Ga0157377_10646896 3300014745 Bacteria 760
235 Ga0157379_10094694 3300014968 Bacteria 2680
236 Ga0157379_10182718 3300014968 Bacteria 1895
237 Ga0157379_11921050 3300014968 Bacteria 584
238 Ga0157376_10156139 3300014969 Bacteria 2063
239 Ga0157376_10199452 3300014969 Bacteria 1840
240 Ga0157376_10519561 3300014969 Bacteria 1173
241 Ga0184595_107919 3300019166 Bacteria 769
242 Ga0184595_123911 3300019166 Bacteria 533
243 Ga0197907_10738779 3300020069 Bacteria 679
244 Ga0197907_11223624 3300020069 Bacteria 1765
245 Ga0206356_11110856 3300020070 Bacteria 2257
246 Ga0206356_11659320 3300020070 Bacteria 815
247 Ga0206349_1877071 3300020075 Bacteria 923
248 Ga0206355_1388814 3300020076 Bacteria 2191
249 Ga0206355_1537879 3300020076 Bacteria 647
250 Ga0206355_1618829 3300020076 Bacteria 1504
251 Ga0206351_10677131 3300020077 Bacteria 1293
252 Ga0206352_10308703 3300020078 Bacteria 1181
253 Ga0206352_10599768 3300020078 Bacteria 1047
254 Ga0206352_11016995 3300020078 Bacteria 1759
255 Ga0206350_11323274 3300020080 Bacteria 2180
256 Ga0206354_11100117 3300020081 Bacteria 910
257 Ga0206354_11456630 3300020081 Bacteria 1594
258 Ga0206353_11159178 3300020082 Bacteria 1439
259 Ga0154015_1134506 3300020610 Bacteria 1841
260 Ga0224712_10029435 3300022467 Bacteria 1972
261 Ga0224712_10172953 3300022467 Unclassified 969
262 Ga0224712_10195201 3300022467 Bacteria 918
263 Ga0247553_100730 3300023672 Bacteria 1267
264 Ga0207692_10212724 3300025898 Bacteria 1142
265 Ga0207680_10414009 3300025903 Bacteria 954
266 Ga0207647_10032975 3300025904 Bacteria 3321
267 Ga0207647_10177104 3300025904 Bacteria 1240
268 Ga0207699_10228473 3300025906 Bacteria 1274
269 Ga0207645_10013115 3300025907 Bacteria 5599
270 Ga0207643_10285319 3300025908 Bacteria 1024
271 Ga0207705_10000012 3300025909 Bacteria 472336
272 Ga0207705_10001912 3300025909 Bacteria 16281
273 Ga0207705_10002156 3300025909 Bacteria 15252
274 Ga0207705_10010724 3300025909 Bacteria 6653
275 Ga0207705_10019852 3300025909 Bacteria 4807
276 Ga0207705_10076147 3300025909 Bacteria 2439
277 Ga0207705_10146373 3300025909 Bacteria 1768
278 Ga0207705_10151788 3300025909 Bacteria 1736
279 Ga0207705_10186418 3300025909 Bacteria 1567
280 Ga0207654_10273656 3300025911 Bacteria 1140
281 Ga0207707_10023728 3300025912 Bacteria 5365
282 Ga0207707_10065953 3300025912 Bacteria 3152
283 Ga0207707_10068125 3300025912 Bacteria 3100
284 Ga0207695_10000001 3300025913 Bacteria 2888630
285 Ga0207695_10008216 3300025913 Bacteria 13110
286 Ga0207695_10084834 3300025913 Bacteria 3197
287 Ga0207695_10129252 3300025913 Bacteria 2485
288 Ga0207695_10192236 3300025913 Bacteria 1958
289 Ga0207695_10234786 3300025913 Bacteria 1737
290 Ga0207695_10542425 3300025913 Bacteria 1044
291 Ga0207671_11494245 3300025914 Bacteria 522
292 Ga0207693_10252561 3300025915 Bacteria 1383
293 Ga0207660_10015830 3300025917 Bacteria 4984
294 Ga0207662_10555980 3300025918 Bacteria 795
295 Ga0207657_10001507 3300025919 Bacteria 24916
296 Ga0207657_10008653 3300025919 Bacteria 10304
297 Ga0207657_10017115 3300025919 Bacteria 6967
298 Ga0207657_10026932 3300025919 Bacteria 5272
299 Ga0207657_10194237 3300025919 Bacteria 1636
300 Ga0207657_10394359 3300025919 Bacteria 1089
301 Ga0207649_10037830 3300025920 Bacteria 2917
302 Ga0207649_10112141 3300025920 Bacteria 1824
303 Ga0207649_11410316 3300025920 Bacteria 551
304 Ga0207652_10011368 3300025921 Bacteria 7173
305 Ga0207652_10105438 3300025921 Bacteria 2494
306 Ga0207652_10127248 3300025921 Bacteria 2270
307 Ga0207681_10000056 3300025923 Bacteria 106145
308 Ga0207681_10289314 3300025923 Bacteria 1293
309 Ga0207694_10007162 3300025924 Bacteria 8474
310 Ga0207694_10177219 3300025924 Bacteria 1727
311 Ga0207694_10183553 3300025924 Bacteria 1697
312 Ga0207650_10030159 3300025925 Bacteria 3904
313 Ga0207687_10391695 3300025927 Bacteria 1141
314 Ga0207700_10295694 3300025928 Bacteria 1397
315 Ga0207700_10736688 3300025928 Bacteria 881
316 Ga0207664_10256876 3300025929 Bacteria 1527
317 Ga0207664_10260763 3300025929 Bacteria 1516
318 Ga0207644_10030504 3300025931 Bacteria 3750
319 Ga0207690_10002265 3300025932 Bacteria 11729
320 Ga0207690_10030551 3300025932 Bacteria 3438
321 Ga0207690_10119581 3300025932 Bacteria 1911
322 Ga0207706_10064861 3300025933 Bacteria 3216
323 Ga0207686_11015805 3300025934 Bacteria 673
324 Ga0207670_10033206 3300025936 Bacteria 3324
325 Ga0207704_11529824 3300025938 Bacteria 573
326 Ga0207711_10062364 3300025941 Bacteria 3216
327 Ga0207711_10077219 3300025941 Bacteria 2902
328 Ga0207711_10165572 3300025941 Bacteria 2004
329 Ga0207711_10290489 3300025941 Bacteria 1507
330 Ga0207689_10061204 3300025942 Bacteria 3095
331 Ga0207661_10207245 3300025944 Bacteria 1726
332 Ga0207679_10015483 3300025945 Bacteria 5041
333 Ga0207679_10683648 3300025945 Bacteria 930
334 Ga0207667_10009317 3300025949 Bacteria 11579
335 Ga0207667_10016157 3300025949 Bacteria 8440
336 Ga0207667_10032870 3300025949 Bacteria 5584
337 Ga0207667_10050332 3300025949 Bacteria 4396
338 Ga0207667_10088266 3300025949 Bacteria 3207
339 Ga0207667_10281503 3300025949 Bacteria 1699
340 Ga0207667_10579575 3300025949 Bacteria 1133
341 Ga0207667_11381590 3300025949 Bacteria 678
342 Ga0207651_10006568 3300025960 Bacteria 6109
343 Ga0207651_10191582 3300025960 Bacteria 1631
344 Ga0207712_10146032 3300025961 Bacteria 1821
345 Ga0207640_10000034 3300025981 Bacteria 112705
346 Ga0207658_10388602 3300025986 Bacteria 1224
347 Ga0207703_10291778 3300026035 Bacteria 1485
348 Ga0207703_10494871 3300026035 Bacteria 1147
349 Ga0207639_10000115 3300026041 Bacteria 62079
350 Ga0207639_10148947 3300026041 Bacteria 1958
351 Ga0207639_10203754 3300026041 Bacteria 1699
352 Ga0207639_11272835 3300026041 Bacteria 690
353 Ga0207678_10003556 3300026067 Bacteria 14017
354 Ga0207678_10014956 3300026067 Bacteria 6828
355 Ga0207678_10021612 3300026067 Bacteria 5642
356 Ga0207678_10324846 3300026067 Bacteria 1324
357 Ga0207678_11091962 3300026067 Bacteria 706
358 Ga0207708_10176959 3300026075 Bacteria 1692
359 Ga0207708_10676469 3300026075 Bacteria 880
360 Ga0207702_11261545 3300026078 Bacteria 733
361 Ga0207641_10175274 3300026088 Bacteria 1960
362 Ga0207648_11406470 3300026089 Bacteria 656
363 Ga0207676_10154705 3300026095 Bacteria 1979
364 Ga0207676_10160989 3300026095 Bacteria 1944
365 Ga0207674_10005050 3300026116 Bacteria 15749
366 Ga0207674_10352580 3300026116 Bacteria 1422
367 Ga0207674_10398592 3300026116 Bacteria 1330
368 Ga0207674_10398721 3300026116 Bacteria 1330
369 Ga0207675_100095349 3300026118 Bacteria 2799
370 Ga0207675_100640564 3300026118 Bacteria 1068
371 Ga0207683_10375192 3300026121 Bacteria 1307
372 Ga0207698_10114764 3300026142 Bacteria 2266
373 Ga0207698_10128602 3300026142 Bacteria 2160
374 Ga0207698_10961420 3300026142 Bacteria 863
375 Ga0207428_10022079 3300027907 Bacteria 5375
376 Ga0268266_10001178 3300028379 Bacteria 32300
377 Ga0265334_10236899 3300028573 Bacteria 630
378 Ga0265318_10182820 3300028577 Bacteria 768
379 Ga0265338_10001506 3300028800 Bacteria 37692
380 Ga0265338_10114840 3300028800 Bacteria 2160
381 Ga0265338_10176577 3300028800 Bacteria 1632
382 Ga0265338_10364403 3300028800 Bacteria 1036
383 Ga0265338_10763906 3300028800 Bacteria 664
384 Ga0265766_1009802 3300030863 Bacteria 675
385 Ga0265770_1029075 3300030878 Bacteria 916
386 Ga0265776_113917 3300030880 Bacteria 503
387 Ga0265761_103554 3300030889 Bacteria 769
388 Ga0265773_1015382 3300031018 Bacteria 704
389 Ga0265760_10048872 3300031090 Bacteria 1271
390 Ga0265330_10000495 3300031235 Bacteria 26302
391 Ga0265330_10018712 3300031235 Bacteria 3178
392 Ga0265330_10043868 3300031235 Bacteria 1977
393 Ga0265330_10060824 3300031235 Bacteria 1643
394 Ga0265332_10015779 3300031238 Bacteria 3335
395 Ga0265328_10029018 3300031239 Bacteria 2068
396 Ga0265328_10127024 3300031239 Bacteria 953
397 Ga0265325_10000217 3300031241 Bacteria 40450
398 Ga0265325_10056567 3300031241 Bacteria 2003
399 Ga0265340_10084518 3300031247 Bacteria 1490
400 Ga0265340_10355290 3300031247 Bacteria 647
401 Ga0265339_10000162 3300031249 Bacteria 55877
402 Ga0265339_10025263 3300031249 Bacteria 3411
403 Ga0265339_10036580 3300031249 Bacteria 2747
404 Ga0265339_10048735 3300031249 Bacteria 2322
405 Ga0265316_10000473 3300031344 Bacteria 45865
406 Ga0265316_10006109 3300031344 Bacteria 11553
407 Ga0265316_10013958 3300031344 Bacteria 7104
408 Ga0265316_10019813 3300031344 Bacteria 5745
409 Ga0265316_10192589 3300031344 Bacteria 1514
410 Ga0265316_10206774 3300031344 Bacteria 1453
411 Ga0265316_10279296 3300031344 Bacteria 1220
412 Ga0265313_10006715 3300031595 Bacteria 8055
413 Ga0265313_10133138 3300031595 Bacteria 1075
414 Ga0307508_10057810 3300031616 Bacteria 3432
415 Ga0316575_10172676 3300031665 Unclassified 896
416 Ga0316579_10142788 3300031691 Bacteria 1154
417 Ga0265314_10008015 3300031711 Bacteria 9109
418 Ga0265314_10081677 3300031711 Bacteria 2129
419 Ga0265314_10310105 3300031711 Bacteria 882
420 Ga0265342_10001956 3300031712 Bacteria 18426
421 Ga0265342_10006040 3300031712 Bacteria 9091
422 Ga0265342_10013479 3300031712 Bacteria 5480
423 Ga0265342_10041032 3300031712 Bacteria 2804
424 Ga0316577_10003396 3300031733 Bacteria 8034
425 Ga0307413_10124163 3300031824 Bacteria 1754
426 Ga0307413_10963183 3300031824 Unclassified 729
427 Ga0307410_10007104 3300031852 Bacteria 6107
428 Ga0307412_10004388 3300031911 Bacteria 7864
429 Ga0307409_100284493 3300031995 Bacteria 1530
430 Ga0307416_101899730 3300032002 Bacteria 699
431 Ga0307411_10378352 3300032005 Bacteria 1164
432 Ga0307411_11637534 3300032005 Bacteria 594
433 Ga0316053_100943 3300032120 Bacteria 1447
434 Ga0316053_103404 3300032120 Bacteria 942
435 Ga0307415_100010404 3300032126 Bacteria 5269
436 Ga0316593_10219597 3300032168 Unclassified 706
437 Ga0373932_0350526 3300035112 Unclassified 561
438 Ga0373939_0206732 3300035114 Unclassified 745
439 Ga0373953_0208508 3300035117 Unclassified 846
440 Ga0373957_0147103 3300035120 Bacteria 966
441 Ga0373961_0000560 3300035241 Bacteria 14051
442 Ga0316574_0001659 3300035398 Bacteria 10721
443 Ga0373935_0002837 3300035692 Bacteria 9969
444 Ga0373933_0813238 3300035724 Bacteria 615
445 Ga0373937_0296828 3300036401 Bacteria 1527
446 Ga0373937_1041203 3300036401 Bacteria 767
447 Ga0265778_001154 3300036457 Bacteria 2333
448 Ga0265778_043637 3300036457 Bacteria 602
449 Ga0316582_0125491 3300036647 Bacteria 1720
450 Ga0316584_0030324 3300036712 Bacteria 3995
451 Ga0395900_0158442 3300037418 Bacteria 2311
452 Ga0316581_0253637 3300037588 Bacteria 540
453 Ga0436364_0422759 3300037853 Bacteria 1306
454 Ga0436363_0738180 3300039450 Bacteria 1152
455 Ga0451790_48433 3300041444 Bacteria 561
456 Ga0451798_0883000 3300041458 Bacteria 818
457 Ga0451804_0024815 3300041463 Bacteria 633
458 Ga0451804_1096986 3300041463 Bacteria 808
459 Ga0451807_0879487 3300041486 Bacteria 909
460 Ga0451839_1488214 3300041496 Bacteria 911
461 Ga0451843_1648800 3300041509 Bacteria 1202
462 Ga0439448_0013651 3300042005 Bacteria 2443
463 Ga0439449_0158714 3300042007 Bacteria 844
464 Ga0439435_0007548 3300042436 Bacteria 2493
465 Ga0439435_0044540 3300042436 Unclassified 1251
466 Ga0439460_0059828 3300042461 Bacteria 1161
467 Ga0451577_0056839 3300042876 Bacteria 3490
468 Ga0466972_0304243 3300044658 Bacteria 745
469 Ga0466961_0262955 3300044693 Bacteria 1058
470 Ga0466963_0305858 3300044694 Bacteria 1118
471 Ga0466963_0555421 3300044694 Bacteria 811
472 Ga0453684_0029003 3300044712 Bacteria 7874
473 Ga0453684_0101505 3300044712 Bacteria 3520
474 Ga0453684_0236687 3300044712 Bacteria 2105
475 Ga0453684_0319714 3300044712 Bacteria 1758
476 Ga0453684_0531820 3300044712 Bacteria 1297
477 Ga0466970_0209447 3300044765 Bacteria 1086
478 Ga0466959_0077224 3300045049 Bacteria 2404
479 Ga0451576_0721965 3300045051 Unclassified 1047
480 Ga0466958_0084898 3300045836 Bacteria 1953
481 Ga0466967_0359443 3300045976 Unclassified 1411
482 Ga0495617_016219 3300046452 Bacteria 2519
483 Ga0495592_0097621 3300046454 Bacteria 2098
484 Ga0495603_0137902 3300046455 Bacteria 1419
485 Ga0495629_0426401 3300046459 Bacteria 900
486 Ga0495650_0000038 3300046471 Bacteria 377530
487 Ga0495580_0036966 3300046472 Bacteria 3505
488 Ga0495580_0169549 3300046472 Bacteria 1509
489 Ga0495584_0123430 3300046491 Bacteria 1312
490 Ga0495585_0050871 3300046492 Bacteria 2297
491 Ga0495594_0007770 3300046499 Bacteria 5515
492 Ga0495596_0058708 3300046500 Bacteria 1500
493 Ga0495583_0022127 3300046506 Bacteria 3252
494 Ga0495606_0021082 3300046507 Bacteria 4781
495 Ga0495608_0433230 3300046511 Bacteria 801
496 Ga0495644_0000044 3300046523 Bacteria 60246
497 Ga0495663_0084669 3300046525 Bacteria 1026
498 Ga0495654_0014677 3300046530 Bacteria 4166
499 Ga0495586_0220041 3300046535 Bacteria 1079
500 Ga0495609_0002185 3300046538 Bacteria 12297
501 Ga0495668_0015530 3300046616 Bacteria 4443
502 Ga0495611_0016130 3300046648 Bacteria 3194
503 Ga0495625_0000580 3300046660 Bacteria 53177
504 Ga0495625_0020612 3300046660 Bacteria 5086
505 Ga0495625_0538152 3300046660 Bacteria 709
506 Ga0495659_0137665 3300046664 Bacteria 972
507 Ga0495588_0096100 3300046674 Bacteria 1554
508 Ga0495623_0203974 3300046679 Bacteria 1135
509 Ga0495658_0201900 3300046683 Bacteria 1239
510 Ga0495658_0349385 3300046683 Bacteria 940
511 Ga0495669_0003780 3300046684 Bacteria 6222
512 Ga0495670_0027481 3300046691 Bacteria 2819
513 Ga0495649_0208212 3300046694 Bacteria 1014
514 Ga0495604_0016650 3300047317 Bacteria 5879
515 Ga0495636_0105372 3300047318 Bacteria 1236
516 Ga0495672_0001831 3300047320 Bacteria 20338
517 Ga0495672_0451019 3300047320 Bacteria 580
518 Ga0495683_0089671 3300047323 Bacteria 1491
519 Ga0495677_0088244 3300047445 Bacteria 1167
520 Ga0495685_043165 3300047447 Bacteria 1539
521 Ga0495684_0620968 3300047471 Bacteria 727
522 Ga0495686_0038629 3300047472 Bacteria 3052
523 Ga0495686_0068800 3300047472 Bacteria 2184
524 Ga0495686_0314621 3300047472 Bacteria 860
525 Ga0495686_0351057 3300047472 Bacteria 802
526 Ga0495615_0041972 3300048090 Bacteria 1145
527 Ga0496100_1342214 3300048903 Bacteria 564
528 Ga0496100_1610996 3300048903 Bacteria 513
529 Ga0496102_0382754 3300048905 Bacteria 1324
530 Ga0496102_1448066 3300048905 Bacteria 606
531 Ga0496104_0247612 3300048907 Bacteria 1695
532 Ga0496104_0445350 3300048907 Bacteria 1207
533 Ga0496104_0607879 3300048907 Bacteria 1003
534 Ga0496104_1286548 3300048907 Bacteria 634
535 Ga0496105_0377580 3300048908 Bacteria 1128
536 Ga0496105_0541996 3300048908 Bacteria 909
537 Ga0496105_1370255 3300048908 Bacteria 513
538 Ga0496107_0466959 3300048910 Bacteria 937
539 Ga0496112_1215692 3300048915 Bacteria 670
540 Ga0496113_1309957 3300048916 Bacteria 563
541 Ga0496114_0000036 3300048917 Bacteria 155622
542 Ga0496114_0032760 3300048917 Bacteria 4280
543 Ga0496118_0311920 3300048921 Bacteria 858
544 Ga0495682_0031856 3300049460 Bacteria 1948
545 Ga0495682_0061520 3300049460 Bacteria 1355
546 Ga0501031_0019586 3300049568 Bacteria 4408
547 Ga0501031_0019878 3300049568 Bacteria 4377
548 Ga0501031_0115005 3300049568 Bacteria 1757
549 Ga0501032_0002284 3300049569 Bacteria 15059
550 Ga0501032_0004677 3300049569 Bacteria 10272
551 Ga0501032_0104806 3300049569 Bacteria 1873
552 Ga0501033_0000659 3300049570 Bacteria 31942
553 Ga0501033_0068252 3300049570 Bacteria 2614
554 Ga0501033_0250407 3300049570 Bacteria 1255
555 Ga0501034_0001806 3300049571 Bacteria 27246
556 Ga0501034_0007673 3300049571 Bacteria 11480
557 Ga0501034_0040371 3300049571 Bacteria 4723
558 Ga0501034_0109776 3300049571 Bacteria 2749
559 Ga0501036_0004803 3300049572 Bacteria 10922
560 Ga0501036_0010731 3300049572 Bacteria 7573
561 Ga0501036_0013962 3300049572 Bacteria 6678
562 Ga0501036_0057492 3300049572 Bacteria 3294
563 Ga0501037_0003317 3300049573 Bacteria 11700
564 Ga0501037_0012094 3300049573 Bacteria 6356
565 Ga0501037_0020889 3300049573 Bacteria 4834
566 Ga0501037_0050021 3300049573 Bacteria 3060
567 Ga0501037_0248386 3300049573 Bacteria 1245
568 Ga0501038_0011623 3300049574 Bacteria 8031
569 Ga0501038_0018000 3300049574 Bacteria 6382
570 Ga0501038_0052727 3300049574 Bacteria 3505
571 Ga0501038_0725129 3300049574 Bacteria 743
572 Ga0501039_0005483 3300049575 Bacteria 9599
573 Ga0501039_0017020 3300049575 Bacteria 5573
574 Ga0501039_0108274 3300049575 Bacteria 2172
575 Ga0501040_0092565 3300049576 Bacteria 2102
576 Ga0501042_0004587 3300049578 Bacteria 8819
577 Ga0501042_0054879 3300049578 Bacteria 2842
578 Ga0501042_0103572 3300049578 Bacteria 2048
579 Ga0501043_0002589 3300049579 Bacteria 15289
580 Ga0501043_0006527 3300049579 Bacteria 9357
581 Ga0501043_0044248 3300049579 Bacteria 3500
582 Ga0501046_0000056 3300049580 Bacteria 129342
583 Ga0501046_0000732 3300049580 Bacteria 31713
584 Ga0501046_0010248 3300049580 Bacteria 8065
585 Ga0501046_0108015 3300049580 Bacteria 2128
586 Ga0501047_0007941 3300049581 Bacteria 10007
587 Ga0501047_0051099 3300049581 Bacteria 3992
588 Ga0501047_0061918 3300049581 Bacteria 3610
589 Ga0501047_0107267 3300049581 Bacteria 2674
590 Ga0501047_0484092 3300049581 Bacteria 1065
591 Ga0501048_0001491 3300049582 Bacteria 17769
592 Ga0501048_0001532 3300049582 Bacteria 17526
593 Ga0501067_0000553 3300049583 Bacteria 20247
594 Ga0501067_0002308 3300049583 Bacteria 10547
595 Ga0501067_0024525 3300049583 Bacteria 3345
596 Ga0501068_0001954 3300049584 Bacteria 10960
597 Ga0501068_0038437 3300049584 Bacteria 2867
598 Ga0501068_0065117 3300049584 Bacteria 2218
599 Ga0501068_0488041 3300049584 Bacteria 798
600 Ga0501069_0000625 3300049585 Bacteria 16324
601 Ga0501069_0006050 3300049585 Bacteria 6318
602 Ga0501069_0103712 3300049585 Bacteria 1616
603 Ga0501070_0005371 3300049586 Bacteria 10926
604 Ga0501070_0112578 3300049586 Bacteria 2249
605 Ga0501070_0195892 3300049586 Bacteria 1659
606 Ga0501070_1005278 3300049586 Bacteria 646
607 Ga0501071_0005838 3300049587 Bacteria 7953
608 Ga0501071_0128080 3300049587 Bacteria 1885
609 Ga0501072_0127765 3300049588 Bacteria 2025
610 Ga0501073_0010311 3300049589 Bacteria 6859
611 Ga0501073_0019909 3300049589 Bacteria 4841
612 Ga0501073_0022416 3300049589 Bacteria 4547
613 Ga0501073_0112914 3300049589 Bacteria 1884
614 Ga0501073_0175163 3300049589 Bacteria 1484
615 Ga0501074_0001905 3300049590 Bacteria 14330
616 Ga0501074_0028739 3300049590 Bacteria 4028
617 Ga0501074_0112224 3300049590 Bacteria 1950
618 Ga0501074_0245205 3300049590 Bacteria 1274
619 Ga0501075_0000962 3300049591 Bacteria 18337
620 Ga0501076_0219371 3300049592 Bacteria 1554
621 Ga0501076_1475592 3300049592 Bacteria 558
622 Ga0501077_0002393 3300049593 Bacteria 11251
623 Ga0501079_0004720 3300049741 Bacteria 10088
624 Ga0501079_0202748 3300049741 Bacteria 1549
625 Ga0501079_0785596 3300049741 Bacteria 749
626 Ga0501079_1253839 3300049741 Unclassified 584
627 Ga0501080_0008888 3300049742 Bacteria 9136
628 Ga0501080_0027279 3300049742 Bacteria 5311
629 Ga0501080_0033309 3300049742 Bacteria 4808
630 Ga0501080_0096169 3300049742 Bacteria 2749
631 Ga0501080_0566707 3300049742 Bacteria 1010
632 Ga0501080_0635639 3300049742 Bacteria 945
633 Ga0501081_0304195 3300049743 Bacteria 1170
634 Ga0501083_0002132 3300049744 Bacteria 13574
635 Ga0501083_0027266 3300049744 Bacteria 3942
636 Ga0501035_0001253 3300049822 Bacteria 26374
637 Ga0501035_0010497 3300049822 Bacteria 8583
638 Ga0501035_0490204 3300049822 Bacteria 1012
639 Ga0501044_0007868 3300049823 Bacteria 11719
640 Ga0501044_0008765 3300049823 Bacteria 11062
641 Ga0501044_0054308 3300049823 Bacteria 4118
642 Ga0501044_0520600 3300049823 Bacteria 1089
643 Ga0501044_1098714 3300049823 Bacteria 664
644 Ga0501045_0058325 3300049824 Bacteria 2826
645 nmdc:mga05p37_553621_c1 3300050507 Bacteria 1309
646 nmdc:mga05p37_58091_c1 3300050507 Bacteria 4764
647 nmdc:mga05p37_85593_c1 3300050507 Bacteria 3885
648 nmdc:mga09592_14369_c1 3300050508 Bacteria 6463
649 nmdc:mga0qj67_1398_c1 3300050509 Bacteria 16934
650 nmdc:mga0qj67_8727_c1 3300050509 Bacteria 7529
651 nmdc:mga06r32_196081_c1 3300050510 Bacteria 2007
652 nmdc:mga08y16_587749_c1 3300050511 Bacteria 1123
653 nmdc:mga08y16_93645_c1 3300050511 Bacteria 3130
654 nmdc:mga0n895_1245337_c1 3300050512 Bacteria 717
655 nmdc:mga0n895_246885_c1 3300050512 Bacteria 1812
656 nmdc:mga0n895_31_c1 3300050512 Bacteria 81579
657 nmdc:mga0n895_5693_c1 3300050512 Bacteria 10448
658 nmdc:mga0rr50_1416_c1 3300050513 Bacteria 13144
659 nmdc:mga0rr50_1489417_c1 3300050513 Bacteria 572
660 nmdc:mga0rr50_43944_c1 3300050513 Bacteria 3273
661 nmdc:mga0rr50_62289_c1 3300050513 Bacteria 2813
662 nmdc:mga08x19_243258_c1 3300050514 Bacteria 1241
663 nmdc:mga08x19_5358_c1 3300050514 Bacteria 7584
664 nmdc:mga08x19_6642_c1 3300050514 Bacteria 6862
665 nmdc:mga0a205_174267_c1 3300050515 Bacteria 2047
666 nmdc:mga0a205_259_c1 3300050515 Bacteria 38100
667 nmdc:mga0a205_562_c1 3300050515 Bacteria 29493
668 Ga0495655_0063826 3300053083 Bacteria 1012
669 Ga0495619_0352274 3300053085 Bacteria 1018
670 Ga0500643_053056 3300053087 Bacteria 1154
671 Ga0500595_045224 3300053119 Bacteria 1391
672 Ga0501084_0022457 3300054114 Bacteria 5264
673 Ga0501084_0046984 3300054114 Bacteria 3615
674 Ga0590071_000580 3300059421 Bacteria 10531
675 Ga0590075_000837 3300059424 Bacteria 8088
676 Ga0590077_000903 3300059426 Bacteria 7581
677 Ga0587090_034126 3300059510 Bacteria 866
678 Ga0587091_059626 3300059511 Bacteria 807
679 Ga0587125_009220 3300059607 Bacteria 995
680 Ga0587101_013343 3300059623 Bacteria 1081
681 Ga0587124_009761 3300059660 Bacteria 846
682 Ga0587071_040397 3300060344 Bacteria 933
683 Ga0587111_0112654 3300060346 Bacteria 691
684 Ga0501082_0000072 3300060353 Bacteria 73322
685 Ga0501082_0005002 3300060353 Bacteria 11568
686 Ga0501082_0061915 3300060353 Bacteria 3221
687 Ga0501082_0133648 3300060353 Bacteria 2152
688 Ga0501082_0626769 3300060353 Bacteria 941
689 Ga0530510_1484692 3300061734 Bacteria 520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041458 Ga0451798_0883000 Ga0451798_0883000_208_654 122
2 3300041463 Ga0451804_1096986 Ga0451804_1096986_229_675 122
3 3300046530 Ga0495654_0014677 Ga0495654_0014677_108_554 124
4 3300005288 Ga0065714_10138911 Ga0065714_101389112 125
5 3300005331 Ga0070670_100334747 Ga0070670_1003347472 125
6 3300005354 Ga0070675_100672476 Ga0070675_1006724762 125
7 3300005367 Ga0070667_100874256 Ga0070667_1008742562 125
8 3300006042 Ga0075368_10012903 Ga0075368_100129034 125
9 3300006051 Ga0075364_10128675 Ga0075364_101286753 125
10 3300006178 Ga0075367_10110568 Ga0075367_101105683 125
11 3300006186 Ga0075369_10004944 Ga0075369_100049443 125
12 3300014325 Ga0163163_10762424 Ga0163163_107624242 125
13 3300014326 Ga0157380_10435330 Ga0157380_104353301 125
14 3300004798 Ga0058859_11553821 Ga0058859_115538211 128
15 3300005353 Ga0070669_100000164 Ga0070669_10000016441 128
16 3300005548 Ga0070665_100000280 Ga0070665_10000028059 128
17 3300025923 Ga0207681_10000056 Ga0207681_1000005680 128
18 3300026075 Ga0207708_10676469 Ga0207708_106764692 128
19 3300028379 Ga0268266_10001178 Ga0268266_1000117828 128
20 3300041463 Ga0451804_0024815 Ga0451804_0024815_69_515 128
21 3300041486 Ga0451807_0879487 Ga0451807_0879487_17_418 133
22 3300047320 Ga0495672_0451019 Ga0495672_0451019_11_418 135
23 3300048907 Ga0496104_0445350 Ga0496104_0445350_28_474 136
24 3300048921 Ga0496118_0311920 Ga0496118_0311920_34_480 136
25 3300042876 Ga0451577_0056839 Ga0451577_0056839_2562_3005 138
26 3300044712 Ga0453684_0101505 Ga0453684_0101505_997_1440 138
27 3300009147 Ga0114129_10271377 Ga0114129_102713771 139
28 3300028800 Ga0265338_10114840 Ga0265338_101148403 139
29 3300044712 Ga0453684_0236687 Ga0453684_0236687_1653_2072 139
30 3300046683 Ga0495658_0201900 Ga0495658_0201900_263_688 139
31 3300053085 Ga0495619_0352274 Ga0495619_0352274_315_740 139
32 3300005458 Ga0070681_10198698 Ga0070681_101986982 140
33 3300031235 Ga0265330_10000495 Ga0265330_1000049514 140
34 3300031241 Ga0265325_10000217 Ga0265325_100002175 140
35 3300031247 Ga0265340_10084518 Ga0265340_100845183 140
36 3300031249 Ga0265339_10036580 Ga0265339_100365803 140
37 3300031344 Ga0265316_10006109 Ga0265316_100061098 140
38 3300031344 Ga0265316_10013958 Ga0265316_100139586 140
39 3300031595 Ga0265313_10006715 Ga0265313_100067152 140
40 3300031711 Ga0265314_10310105 Ga0265314_103101051 140
41 3300031712 Ga0265342_10001956 Ga0265342_100019565 140
42 3300031712 Ga0265342_10041032 Ga0265342_100410324 140
43 iso_pu_bacteria 2773857933 2774902874 140
44 3300013296 Ga0157374_11177568 Ga0157374_111775681 141
45 3300013307 Ga0157372_10273045 Ga0157372_102730452 141
46 3300022467 Ga0224712_10172953 Ga0224712_101729531 141
47 3300025934 Ga0207686_11015805 Ga0207686_110158052 141
48 3300044712 Ga0453684_0029003 Ga0453684_0029003_1743_2168 141
49 3300044712 Ga0453684_0319714 Ga0453684_0319714_483_908 141
50 3300046472 Ga0495580_0036966 Ga0495580_0036966_1088_1528 141
51 3300047472 Ga0495686_0068800 Ga0495686_0068800_441_905 141
52 3300048907 Ga0496104_0607879 Ga0496104_0607879_348_785 141
53 iso_pu_bacteria 2643221553 2643783564 141
54 iso_pu_bacteria 2643221724 2644679191 141
55 iso_pu_bacteria 2728369380 2730228694 141
56 3300005289 Ga0065704_10308306 Ga0065704_103083062 142
57 3300005295 Ga0065707_10215047 Ga0065707_102150472 142
58 3300005339 Ga0070660_100002152 Ga0070660_1000021529 142
59 3300005341 Ga0070691_10170258 Ga0070691_101702582 142
60 3300005344 Ga0070661_100116121 Ga0070661_1001161212 142
61 3300005366 Ga0070659_100292248 Ga0070659_1002922482 142
62 3300005438 Ga0070701_10292922 Ga0070701_102929221 142
63 3300005440 Ga0070705_100252361 Ga0070705_1002523613 142
64 3300005441 Ga0070700_100170164 Ga0070700_1001701642 142
65 3300005444 Ga0070694_100155421 Ga0070694_1001554212 142
66 3300005459 Ga0068867_101786507 Ga0068867_1017865071 142
67 3300005530 Ga0070679_100024592 Ga0070679_1000245929 142
68 3300005535 Ga0070684_100591579 Ga0070684_1005915791 142
69 3300005539 Ga0068853_100044099 Ga0068853_1000440992 142
70 3300005549 Ga0070704_100023634 Ga0070704_1000236343 142
71 3300005563 Ga0068855_100301722 Ga0068855_1003017222 142
72 3300005564 Ga0070664_100748375 Ga0070664_1007483752 142
73 3300005616 Ga0068852_100128851 Ga0068852_1001288512 142
74 3300006844 Ga0075428_100188315 Ga0075428_1001883153 142
75 3300009094 Ga0111539_10102893 Ga0111539_101028932 142
76 3300009147 Ga0114129_10331348 Ga0114129_103313482 142
77 3300009551 Ga0105238_10122060 Ga0105238_101220603 142
78 3300009553 Ga0105249_11136780 Ga0105249_111367802 142
79 3300010375 Ga0105239_10669784 Ga0105239_106697841 142
80 3300013102 Ga0157371_10135608 Ga0157371_101356082 142
81 3300013105 Ga0157369_10036291 Ga0157369_100362912 142
82 3300013105 Ga0157369_10793528 Ga0157369_107935281 142
83 3300013297 Ga0157378_10961232 Ga0157378_109612321 142
84 3300013307 Ga0157372_10096633 Ga0157372_100966335 142
85 3300013307 Ga0157372_11497160 Ga0157372_114971601 142
86 3300014326 Ga0157380_10004468 Ga0157380_100044688 142
87 3300014969 Ga0157376_10199452 Ga0157376_101994522 142
88 3300020078 Ga0206352_10599768 Ga0206352_105997682 142
89 3300025908 Ga0207643_10285319 Ga0207643_102853191 142
90 3300025909 Ga0207705_10002156 Ga0207705_100021563 142
91 3300025909 Ga0207705_10010724 Ga0207705_100107244 142
92 3300025913 Ga0207695_10542425 Ga0207695_105424251 142
93 3300025919 Ga0207657_10026932 Ga0207657_100269325 142
94 3300025919 Ga0207657_10394359 Ga0207657_103943592 142
95 3300025920 Ga0207649_10037830 Ga0207649_100378302 142
96 3300025921 Ga0207652_10127248 Ga0207652_101272481 142
97 3300025924 Ga0207694_10177219 Ga0207694_101772192 142
98 3300025924 Ga0207694_10183553 Ga0207694_101835533 142
99 3300025932 Ga0207690_10119581 Ga0207690_101195812 142
100 3300025945 Ga0207679_10683648 Ga0207679_106836481 142
101 3300025949 Ga0207667_10032870 Ga0207667_100328705 142
102 3300025949 Ga0207667_10579575 Ga0207667_105795751 142
103 3300026041 Ga0207639_10148947 Ga0207639_101489472 142
104 3300026075 Ga0207708_10176959 Ga0207708_101769591 142
105 3300026089 Ga0207648_11406470 Ga0207648_114064702 142
106 3300026118 Ga0207675_100640564 Ga0207675_1006405642 142
107 3300026142 Ga0207698_10128602 Ga0207698_101286022 142
108 3300027907 Ga0207428_10022079 Ga0207428_100220792 142
109 3300031691 Ga0316579_10142788 Ga0316579_101427882 142
110 3300031733 Ga0316577_10003396 Ga0316577_100033963 142
111 3300032168 Ga0316593_10219597 Ga0316593_102195972 142
112 3300036647 Ga0316582_0125491 Ga0316582_0125491_836_1264 142
113 3300036712 Ga0316584_0030324 Ga0316584_0030324_829_1257 142
114 3300042005 Ga0439448_0013651 Ga0439448_0013651_108_539 142
115 3300044712 Ga0453684_0531820 Ga0453684_0531820_808_1272 142
116 3300045049 Ga0466959_0077224 Ga0466959_0077224_847_1278 142
117 3300045976 Ga0466967_0359443 Ga0466967_0359443_99_530 142
118 3300050511 nmdc:mga08y16_93645_c1 nmdc:mga08y16_93645_c1_919_1347 142
119 3300004803 Ga0058862_12851463 Ga0058862_128514633 143
120 3300005327 Ga0070658_10007225 Ga0070658_100072252 143
121 3300005329 Ga0070683_100009432 Ga0070683_1000094322 143
122 3300005339 Ga0070660_100013713 Ga0070660_1000137133 143
123 3300005436 Ga0070713_101251718 Ga0070713_1012517181 143
124 3300005436 Ga0070713_101268654 Ga0070713_1012686541 143
125 3300005458 Ga0070681_10093860 Ga0070681_100938601 143
126 3300005530 Ga0070679_100059401 Ga0070679_1000594012 143
127 3300005535 Ga0070684_100005900 Ga0070684_1000059004 143
128 3300005563 Ga0068855_100154131 Ga0068855_1001541314 143
129 3300005577 Ga0068857_100017675 Ga0068857_1000176755 143
130 3300005578 Ga0068854_101619604 Ga0068854_1016196041 143
131 3300005614 Ga0068856_100013051 Ga0068856_1000130513 143
132 3300005616 Ga0068852_100042793 Ga0068852_1000427934 143
133 3300006028 Ga0070717_10001558 Ga0070717_100015585 143
134 3300006028 Ga0070717_10404308 Ga0070717_104043081 143
135 3300006237 Ga0097621_100000066 Ga0097621_10000006639 143
136 3300006358 Ga0068871_100000170 Ga0068871_10000017026 143
137 3300006852 Ga0075433_10006367 Ga0075433_100063675 143
138 3300006871 Ga0075434_100000005 Ga0075434_10000000525 143
139 3300006914 Ga0075436_100007285 Ga0075436_1000072855 143
140 3300007076 Ga0075435_100024980 Ga0075435_1000249807 143
141 3300009093 Ga0105240_10483312 Ga0105240_104833122 143
142 3300009093 Ga0105240_11213535 Ga0105240_112135352 143
143 3300009177 Ga0105248_10604239 Ga0105248_106042392 143
144 3300009545 Ga0105237_10328505 Ga0105237_103285051 143
145 3300013102 Ga0157371_10007064 Ga0157371_100070644 143
146 3300013104 Ga0157370_10391993 Ga0157370_103919932 143
147 3300013105 Ga0157369_10228469 Ga0157369_102284692 143
148 3300013105 Ga0157369_10359774 Ga0157369_103597742 143
149 3300013307 Ga0157372_10096540 Ga0157372_100965404 143
150 3300014968 Ga0157379_10182718 Ga0157379_101827182 143
151 3300014969 Ga0157376_10519561 Ga0157376_105195612 143
152 3300019166 Ga0184595_123911 Ga0184595_1239111 143
153 3300020069 Ga0197907_11223624 Ga0197907_112236243 143
154 3300020070 Ga0206356_11110856 Ga0206356_111108563 143
155 3300020070 Ga0206356_11659320 Ga0206356_116593201 143
156 3300020075 Ga0206349_1877071 Ga0206349_18770711 143
157 3300020076 Ga0206355_1388814 Ga0206355_13888143 143
158 3300020076 Ga0206355_1618829 Ga0206355_16188291 143
159 3300020077 Ga0206351_10677131 Ga0206351_106771313 143
160 3300020078 Ga0206352_10308703 Ga0206352_103087032 143
161 3300020078 Ga0206352_11016995 Ga0206352_110169953 143
162 3300020080 Ga0206350_11323274 Ga0206350_113232744 143
163 3300020081 Ga0206354_11456630 Ga0206354_114566301 143
164 3300020082 Ga0206353_11159178 Ga0206353_111591783 143
165 3300020610 Ga0154015_1134506 Ga0154015_11345064 143
166 3300022467 Ga0224712_10029435 Ga0224712_100294354 143
167 3300023672 Ga0247553_100730 Ga0247553_1007301 143
168 3300025909 Ga0207705_10146373 Ga0207705_101463731 143
169 3300025912 Ga0207707_10068125 Ga0207707_100681252 143
170 3300025913 Ga0207695_10129252 Ga0207695_101292522 143
171 3300025917 Ga0207660_10015830 Ga0207660_100158304 143
172 3300025919 Ga0207657_10008653 Ga0207657_100086534 143
173 3300025921 Ga0207652_10105438 Ga0207652_101054381 143
174 3300025924 Ga0207694_10007162 Ga0207694_100071623 143
175 3300025928 Ga0207700_10295694 Ga0207700_102956941 143
176 3300025928 Ga0207700_10736688 Ga0207700_107366881 143
177 3300025949 Ga0207667_10009317 Ga0207667_100093175 143
178 3300026116 Ga0207674_10352580 Ga0207674_103525803 143
179 3300026116 Ga0207674_10398592 Ga0207674_103985922 143
180 3300026142 Ga0207698_10114764 Ga0207698_101147643 143
181 3300028573 Ga0265334_10236899 Ga0265334_102368991 143
182 3300028577 Ga0265318_10182820 Ga0265318_101828202 143
183 3300028800 Ga0265338_10001506 Ga0265338_100015062 143
184 3300028800 Ga0265338_10364403 Ga0265338_103644031 143
185 3300028800 Ga0265338_10763906 Ga0265338_107639061 143
186 3300030863 Ga0265766_1009802 Ga0265766_10098021 143
187 3300030878 Ga0265770_1029075 Ga0265770_10290751 143
188 3300030880 Ga0265776_113917 Ga0265776_1139171 143
189 3300030889 Ga0265761_103554 Ga0265761_1035541 143
190 3300031018 Ga0265773_1015382 Ga0265773_10153822 143
191 3300031090 Ga0265760_10048872 Ga0265760_100488721 143
192 3300031235 Ga0265330_10018712 Ga0265330_100187124 143
193 3300031235 Ga0265330_10043868 Ga0265330_100438683 143
194 3300031235 Ga0265330_10060824 Ga0265330_100608244 143
195 3300031238 Ga0265332_10015779 Ga0265332_100157791 143
196 3300031239 Ga0265328_10029018 Ga0265328_100290181 143
197 3300031241 Ga0265325_10056567 Ga0265325_100565673 143
198 3300031247 Ga0265340_10355290 Ga0265340_103552901 143
199 3300031249 Ga0265339_10000162 Ga0265339_1000016244 143
200 3300031249 Ga0265339_10025263 Ga0265339_100252635 143
201 3300031249 Ga0265339_10048735 Ga0265339_100487353 143
202 3300031344 Ga0265316_10000473 Ga0265316_1000047334 143
203 3300031344 Ga0265316_10019813 Ga0265316_100198131 143
204 3300031344 Ga0265316_10192589 Ga0265316_101925891 143
205 3300031344 Ga0265316_10206774 Ga0265316_102067741 143
206 3300031344 Ga0265316_10279296 Ga0265316_102792961 143
207 3300031595 Ga0265313_10133138 Ga0265313_101331382 143
208 3300031711 Ga0265314_10008015 Ga0265314_100080153 143
209 3300031711 Ga0265314_10081677 Ga0265314_100816773 143
210 3300031712 Ga0265342_10006040 Ga0265342_100060406 143
211 3300031712 Ga0265342_10013479 Ga0265342_100134794 143
212 3300031824 Ga0307413_10124163 Ga0307413_101241631 143
213 3300031824 Ga0307413_10963183 Ga0307413_109631831 143
214 3300031852 Ga0307410_10007104 Ga0307410_100071048 143
215 3300031911 Ga0307412_10004388 Ga0307412_100043886 143
216 3300031995 Ga0307409_100284493 Ga0307409_1002844932 143
217 3300032005 Ga0307411_10378352 Ga0307411_103783522 143
218 3300032005 Ga0307411_11637534 Ga0307411_116375341 143
219 3300032120 Ga0316053_100943 Ga0316053_1009433 143
220 3300032126 Ga0307415_100010404 Ga0307415_1000104042 143
221 3300035112 Ga0373932_0350526 Ga0373932_0350526_51_488 143
222 3300035114 Ga0373939_0206732 Ga0373939_0206732_38_475 143
223 3300035117 Ga0373953_0208508 Ga0373953_0208508_210_647 143
224 3300035120 Ga0373957_0147103 Ga0373957_0147103_173_604 143
225 3300035724 Ga0373933_0813238 Ga0373933_0813238_158_589 143
226 3300036401 Ga0373937_0296828 Ga0373937_0296828_727_1158 143
227 3300036457 Ga0265778_001154 Ga0265778_001154_1593_2024 143
228 3300036457 Ga0265778_043637 Ga0265778_043637_38_469 143
229 3300037588 Ga0316581_0253637 Ga0316581_0253637_66_509 143
230 3300037853 Ga0436364_0422759 Ga0436364_0422759_849_1286 143
231 3300039450 Ga0436363_0738180 Ga0436363_0738180_421_852 143
232 3300042436 Ga0439435_0044540 Ga0439435_0044540_167_598 143
233 3300044693 Ga0466961_0262955 Ga0466961_0262955_472_903 143
234 3300044765 Ga0466970_0209447 Ga0466970_0209447_452_883 143
235 3300045051 Ga0451576_0721965 Ga0451576_0721965_488_925 143
236 3300045836 Ga0466958_0084898 Ga0466958_0084898_718_1149 143
237 3300046459 Ga0495629_0426401 Ga0495629_0426401_358_789 143
238 3300046535 Ga0495586_0220041 Ga0495586_0220041_316_747 143
239 3300046683 Ga0495658_0349385 Ga0495658_0349385_207_638 143
240 3300048907 Ga0496104_0247612 Ga0496104_0247612_24_455 143
241 3300049568 Ga0501031_0019878 Ga0501031_0019878_2886_3317 143
242 3300049568 Ga0501031_0115005 Ga0501031_0115005_407_838 143
243 3300049569 Ga0501032_0004677 Ga0501032_0004677_614_1045 143
244 3300049569 Ga0501032_0104806 Ga0501032_0104806_232_663 143
245 3300049570 Ga0501033_0068252 Ga0501033_0068252_1344_1775 143
246 3300049570 Ga0501033_0250407 Ga0501033_0250407_453_884 143
247 3300049571 Ga0501034_0007673 Ga0501034_0007673_5734_6165 143
248 3300049571 Ga0501034_0040371 Ga0501034_0040371_2727_3158 143
249 3300049571 Ga0501034_0109776 Ga0501034_0109776_1607_2038 143
250 3300049572 Ga0501036_0004803 Ga0501036_0004803_6382_6813 143
251 3300049572 Ga0501036_0013962 Ga0501036_0013962_210_641 143
252 3300049572 Ga0501036_0057492 Ga0501036_0057492_2654_3085 143
253 3300049573 Ga0501037_0003317 Ga0501037_0003317_4044_4475 143
254 3300049573 Ga0501037_0020889 Ga0501037_0020889_1788_2219 143
255 3300049573 Ga0501037_0248386 Ga0501037_0248386_662_1093 143
256 3300049574 Ga0501038_0011623 Ga0501038_0011623_5794_6225 143
257 3300049574 Ga0501038_0052727 Ga0501038_0052727_1566_1997 143
258 3300049575 Ga0501039_0005483 Ga0501039_0005483_4639_5070 143
259 3300049575 Ga0501039_0017020 Ga0501039_0017020_2936_3367 143
260 3300049576 Ga0501040_0092565 Ga0501040_0092565_380_811 143
261 3300049578 Ga0501042_0004587 Ga0501042_0004587_2620_3051 143
262 3300049578 Ga0501042_0054879 Ga0501042_0054879_1845_2276 143
263 3300049578 Ga0501042_0103572 Ga0501042_0103572_869_1300 143
264 3300049579 Ga0501043_0006527 Ga0501043_0006527_840_1271 143
265 3300049579 Ga0501043_0044248 Ga0501043_0044248_2818_3249 143
266 3300049580 Ga0501046_0000732 Ga0501046_0000732_25753_26184 143
267 3300049580 Ga0501046_0010248 Ga0501046_0010248_5427_5858 143
268 3300049580 Ga0501046_0108015 Ga0501046_0108015_487_918 143
269 3300049581 Ga0501047_0007941 Ga0501047_0007941_8893_9324 143
270 3300049581 Ga0501047_0061918 Ga0501047_0061918_372_803 143
271 3300049581 Ga0501047_0107267 Ga0501047_0107267_1532_1963 143
272 3300049582 Ga0501048_0001491 Ga0501048_0001491_10509_10940 143
273 3300049582 Ga0501048_0001532 Ga0501048_0001532_12575_13006 143
274 3300049583 Ga0501067_0000553 Ga0501067_0000553_13324_13755 143
275 3300049583 Ga0501067_0002308 Ga0501067_0002308_3633_4064 143
276 3300049584 Ga0501068_0001954 Ga0501068_0001954_5790_6221 143
277 3300049584 Ga0501068_0038437 Ga0501068_0038437_991_1422 143
278 3300049585 Ga0501069_0000625 Ga0501069_0000625_7373_7804 143
279 3300049585 Ga0501069_0006050 Ga0501069_0006050_3274_3705 143
280 3300049586 Ga0501070_0005371 Ga0501070_0005371_1532_1963 143
281 3300049586 Ga0501070_0195892 Ga0501070_0195892_1048_1479 143
282 3300049586 Ga0501070_1005278 Ga0501070_1005278_94_525 143
283 3300049587 Ga0501071_0005838 Ga0501071_0005838_755_1186 143
284 3300049587 Ga0501071_0128080 Ga0501071_0128080_1361_1792 143
285 3300049588 Ga0501072_0127765 Ga0501072_0127765_275_706 143
286 3300049589 Ga0501073_0022416 Ga0501073_0022416_2906_3337 143
287 3300049589 Ga0501073_0112914 Ga0501073_0112914_614_1045 143
288 3300049589 Ga0501073_0175163 Ga0501073_0175163_210_641 143
289 3300049590 Ga0501074_0001905 Ga0501074_0001905_7036_7467 143
290 3300049590 Ga0501074_0028739 Ga0501074_0028739_712_1143 143
291 3300049590 Ga0501074_0112224 Ga0501074_0112224_204_635 143
292 3300049592 Ga0501076_0219371 Ga0501076_0219371_511_942 143
293 3300049592 Ga0501076_1475592 Ga0501076_1475592_30_461 143
294 3300049741 Ga0501079_0004720 Ga0501079_0004720_1572_2003 143
295 3300049741 Ga0501079_0202748 Ga0501079_0202748_887_1318 143
296 3300049741 Ga0501079_0785596 Ga0501079_0785596_37_468 143
297 3300049741 Ga0501079_1253839 Ga0501079_1253839_139_570 143
298 3300049742 Ga0501080_0027279 Ga0501080_0027279_1986_2417 143
299 3300049742 Ga0501080_0096169 Ga0501080_0096169_712_1143 143
300 3300049742 Ga0501080_0566707 Ga0501080_0566707_556_987 143
301 3300049743 Ga0501081_0304195 Ga0501081_0304195_387_818 143
302 3300049744 Ga0501083_0027266 Ga0501083_0027266_843_1274 143
303 3300049822 Ga0501035_0010497 Ga0501035_0010497_5395_5826 143
304 3300049822 Ga0501035_0490204 Ga0501035_0490204_372_803 143
305 3300049823 Ga0501044_0008765 Ga0501044_0008765_9100_9531 143
306 3300049823 Ga0501044_0054308 Ga0501044_0054308_210_641 143
307 3300049823 Ga0501044_1098714 Ga0501044_1098714_210_641 143
308 3300049824 Ga0501045_0058325 Ga0501045_0058325_784_1215 143
309 3300050507 nmdc:mga05p37_58091_c1 nmdc:mga05p37_58091_c1_1429_1860 143
310 3300050508 nmdc:mga09592_14369_c1 nmdc:mga09592_14369_c1_1520_1951 143
311 3300050509 nmdc:mga0qj67_1398_c1 nmdc:mga0qj67_1398_c1_13019_13450 143
312 3300050509 nmdc:mga0qj67_8727_c1 nmdc:mga0qj67_8727_c1_5386_5817 143
313 3300050510 nmdc:mga06r32_196081_c1 nmdc:mga06r32_196081_c1_1346_1777 143
314 3300050512 nmdc:mga0n895_31_c1 nmdc:mga0n895_31_c1_38032_38463 143
315 3300050512 nmdc:mga0n895_5693_c1 nmdc:mga0n895_5693_c1_68_499 143
316 3300050513 nmdc:mga0rr50_1416_c1 nmdc:mga0rr50_1416_c1_36_467 143
317 3300050514 nmdc:mga08x19_5358_c1 nmdc:mga08x19_5358_c1_3210_3641 143
318 3300050515 nmdc:mga0a205_259_c1 nmdc:mga0a205_259_c1_3953_4384 143
319 3300050515 nmdc:mga0a205_562_c1 nmdc:mga0a205_562_c1_21419_21850 143
320 3300054114 Ga0501084_0022457 Ga0501084_0022457_752_1183 143
321 3300054114 Ga0501084_0046984 Ga0501084_0046984_2469_2900 143
322 3300059421 Ga0590071_000580 Ga0590071_000580_3919_4350 143
323 3300059424 Ga0590075_000837 Ga0590075_000837_5082_5513 143
324 3300059426 Ga0590077_000903 Ga0590077_000903_2265_2696 143
325 3300059511 Ga0587091_059626 Ga0587091_059626_106_537 143
326 3300059607 Ga0587125_009220 Ga0587125_009220_224_655 143
327 3300059660 Ga0587124_009761 Ga0587124_009761_190_621 143
328 3300060346 Ga0587111_0112654 Ga0587111_0112654_153_584 143
329 3300060353 Ga0501082_0005002 Ga0501082_0005002_4574_5005 143
330 3300060353 Ga0501082_0061915 Ga0501082_0061915_881_1312 143
331 3300060353 Ga0501082_0133648 Ga0501082_0133648_415_846 143
332 3300061734 Ga0530510_1484692 Ga0530510_1484692_39_470 143
333 3300003320 rootH2_10080382 rootH2_100803822 144
334 3300005327 Ga0070658_10137527 Ga0070658_101375273 144
335 3300005327 Ga0070658_10232851 Ga0070658_102328513 144
336 3300005327 Ga0070658_10398281 Ga0070658_103982811 144
337 3300005329 Ga0070683_100288005 Ga0070683_1002880053 144
338 3300005335 Ga0070666_10030165 Ga0070666_100301654 144
339 3300005336 Ga0070680_100108365 Ga0070680_1001083652 144
340 3300005339 Ga0070660_100028144 Ga0070660_1000281443 144
341 3300005339 Ga0070660_100087764 Ga0070660_1000877643 144
342 3300005339 Ga0070660_100134075 Ga0070660_1001340752 144
343 3300005344 Ga0070661_100222700 Ga0070661_1002227001 144
344 3300005354 Ga0070675_100383110 Ga0070675_1003831102 144
345 3300005355 Ga0070671_100001020 Ga0070671_10000102020 144
346 3300005366 Ga0070659_100010337 Ga0070659_1000103377 144
347 3300005366 Ga0070659_101142249 Ga0070659_1011422491 144
348 3300005435 Ga0070714_100270392 Ga0070714_1002703922 144
349 3300005455 Ga0070663_100046729 Ga0070663_1000467294 144
350 3300005455 Ga0070663_100079185 Ga0070663_1000791852 144
351 3300005455 Ga0070663_100318968 Ga0070663_1003189681 144
352 3300005458 Ga0070681_10334243 Ga0070681_103342433 144
353 3300005458 Ga0070681_10826020 Ga0070681_108260202 144
354 3300005530 Ga0070679_100006064 Ga0070679_1000060644 144
355 3300005535 Ga0070684_100110235 Ga0070684_1001102352 144
356 3300005539 Ga0068853_100000174 Ga0068853_10000017444 144
357 3300005539 Ga0068853_100058163 Ga0068853_1000581632 144
358 3300005539 Ga0068853_100841656 Ga0068853_1008416561 144
359 3300005543 Ga0070672_100727709 Ga0070672_1007277092 144
360 3300005548 Ga0070665_100004995 Ga0070665_1000049953 144
361 3300005564 Ga0070664_100057304 Ga0070664_1000573044 144
362 3300005577 Ga0068857_100052519 Ga0068857_1000525192 144
363 3300005578 Ga0068854_100000186 Ga0068854_10000018642 144
364 3300005578 Ga0068854_100473915 Ga0068854_1004739152 144
365 3300005616 Ga0068852_100064951 Ga0068852_1000649511 144
366 3300005618 Ga0068864_100009360 Ga0068864_1000093609 144
367 3300005841 Ga0068863_100004076 Ga0068863_1000040764 144
368 3300005843 Ga0068860_100481533 Ga0068860_1004815331 144
369 3300006163 Ga0070715_10432069 Ga0070715_104320692 144
370 3300006237 Ga0097621_100662576 Ga0097621_1006625762 144
371 3300006358 Ga0068871_100346660 Ga0068871_1003466602 144
372 3300009093 Ga0105240_10018617 Ga0105240_100186171 144
373 3300009093 Ga0105240_10108808 Ga0105240_101088082 144
374 3300009093 Ga0105240_10152842 Ga0105240_101528423 144
375 3300009101 Ga0105247_10207684 Ga0105247_102076841 144
376 3300009174 Ga0105241_10316100 Ga0105241_103161001 144
377 3300009177 Ga0105248_10347645 Ga0105248_103476453 144
378 3300009545 Ga0105237_10068357 Ga0105237_100683573 144
379 3300009545 Ga0105237_11438114 Ga0105237_114381141 144
380 3300009551 Ga0105238_10005301 Ga0105238_100053015 144
381 3300013100 Ga0157373_10454492 Ga0157373_104544921 144
382 3300013102 Ga0157371_10174405 Ga0157371_101744051 144
383 3300013102 Ga0157371_10301745 Ga0157371_103017451 144
384 3300013104 Ga0157370_10012273 Ga0157370_100122733 144
385 3300013104 Ga0157370_10051672 Ga0157370_100516724 144
386 3300013104 Ga0157370_10113995 Ga0157370_101139953 144
387 3300013104 Ga0157370_10188281 Ga0157370_101882812 144
388 3300013104 Ga0157370_11457419 Ga0157370_114574191 144
389 3300013105 Ga0157369_10013690 Ga0157369_100136908 144
390 3300013105 Ga0157369_10068261 Ga0157369_100682611 144
391 3300013105 Ga0157369_10075191 Ga0157369_100751915 144
392 3300013105 Ga0157369_10116262 Ga0157369_101162623 144
393 3300013105 Ga0157369_10469038 Ga0157369_104690381 144
394 3300013105 Ga0157369_10510624 Ga0157369_105106242 144
395 3300013296 Ga0157374_10088179 Ga0157374_100881792 144
396 3300013296 Ga0157374_10104913 Ga0157374_101049134 144
397 3300013297 Ga0157378_10358353 Ga0157378_103583532 144
398 3300013306 Ga0163162_10007900 Ga0163162_1000790011 144
399 3300013306 Ga0163162_10876899 Ga0163162_108768991 144
400 3300013307 Ga0157372_10005308 Ga0157372_100053083 144
401 3300013307 Ga0157372_10040606 Ga0157372_100406062 144
402 3300013307 Ga0157372_10169742 Ga0157372_101697424 144
403 3300013307 Ga0157372_10691043 Ga0157372_106910432 144
404 3300013308 Ga0157375_11577136 Ga0157375_115771361 144
405 3300014325 Ga0163163_10003334 Ga0163163_100033349 144
406 3300014968 Ga0157379_10094694 Ga0157379_100946943 144
407 3300014968 Ga0157379_11921050 Ga0157379_119210501 144
408 3300014969 Ga0157376_10156139 Ga0157376_101561392 144
409 3300020081 Ga0206354_11100117 Ga0206354_111001171 144
410 3300022467 Ga0224712_10195201 Ga0224712_101952011 144
411 3300025904 Ga0207647_10032975 Ga0207647_100329752 144
412 3300025904 Ga0207647_10177104 Ga0207647_101771042 144
413 3300025909 Ga0207705_10001912 Ga0207705_100019129 144
414 3300025909 Ga0207705_10186418 Ga0207705_101864182 144
415 3300025911 Ga0207654_10273656 Ga0207654_102736561 144
416 3300025912 Ga0207707_10065953 Ga0207707_100659534 144
417 3300025913 Ga0207695_10008216 Ga0207695_100082164 144
418 3300025913 Ga0207695_10084834 Ga0207695_100848342 144
419 3300025914 Ga0207671_11494245 Ga0207671_114942451 144
420 3300025915 Ga0207693_10252561 Ga0207693_102525612 144
421 3300025919 Ga0207657_10001507 Ga0207657_1000150712 144
422 3300025919 Ga0207657_10017115 Ga0207657_100171157 144
423 3300025919 Ga0207657_10194237 Ga0207657_101942372 144
424 3300025920 Ga0207649_10112141 Ga0207649_101121413 144
425 3300025920 Ga0207649_11410316 Ga0207649_114103161 144
426 3300025925 Ga0207650_10030159 Ga0207650_100301595 144
427 3300025929 Ga0207664_10256876 Ga0207664_102568763 144
428 3300025929 Ga0207664_10260763 Ga0207664_102607631 144
429 3300025931 Ga0207644_10030504 Ga0207644_100305044 144
430 3300025932 Ga0207690_10002265 Ga0207690_1000226511 144
431 3300025932 Ga0207690_10030551 Ga0207690_100305513 144
432 3300025933 Ga0207706_10064861 Ga0207706_100648612 144
433 3300025938 Ga0207704_11529824 Ga0207704_115298241 144
434 3300025941 Ga0207711_10062364 Ga0207711_100623642 144
435 3300025941 Ga0207711_10077219 Ga0207711_100772194 144
436 3300025941 Ga0207711_10290489 Ga0207711_102904892 144
437 3300025944 Ga0207661_10207245 Ga0207661_102072451 144
438 3300025949 Ga0207667_10088266 Ga0207667_100882664 144
439 3300025949 Ga0207667_10281503 Ga0207667_102815033 144
440 3300025981 Ga0207640_10000034 Ga0207640_100000342 144
441 3300025986 Ga0207658_10388602 Ga0207658_103886022 144
442 3300026041 Ga0207639_10000115 Ga0207639_1000011547 144
443 3300026041 Ga0207639_10203754 Ga0207639_102037541 144
444 3300026041 Ga0207639_11272835 Ga0207639_112728351 144
445 3300026067 Ga0207678_10003556 Ga0207678_100035561 144
446 3300026067 Ga0207678_10014956 Ga0207678_100149563 144
447 3300026067 Ga0207678_10324846 Ga0207678_103248463 144
448 3300026067 Ga0207678_11091962 Ga0207678_110919622 144
449 3300026088 Ga0207641_10175274 Ga0207641_101752742 144
450 3300026095 Ga0207676_10160989 Ga0207676_101609892 144
451 3300026116 Ga0207674_10005050 Ga0207674_100050508 144
452 3300026121 Ga0207683_10375192 Ga0207683_103751922 144
453 3300026142 Ga0207698_10961420 Ga0207698_109614202 144
454 3300037418 Ga0395900_0158442 Ga0395900_0158442_1088_1522 144
455 3300042436 Ga0439435_0007548 Ga0439435_0007548_309_755 144
456 3300042461 Ga0439460_0059828 Ga0439460_0059828_465_923 144
457 3300046452 Ga0495617_016219 Ga0495617_016219_487_921 144
458 3300046454 Ga0495592_0097621 Ga0495592_0097621_1529_1963 144
459 3300046455 Ga0495603_0137902 Ga0495603_0137902_581_1015 144
460 3300046471 Ga0495650_0000038 Ga0495650_0000038_161046_161480 144
461 3300046472 Ga0495580_0169549 Ga0495580_0169549_510_944 144
462 3300046491 Ga0495584_0123430 Ga0495584_0123430_535_969 144
463 3300046492 Ga0495585_0050871 Ga0495585_0050871_49_483 144
464 3300046499 Ga0495594_0007770 Ga0495594_0007770_264_698 144
465 3300046500 Ga0495596_0058708 Ga0495596_0058708_943_1377 144
466 3300046506 Ga0495583_0022127 Ga0495583_0022127_1088_1522 144
467 3300046507 Ga0495606_0021082 Ga0495606_0021082_576_1010 144
468 3300046511 Ga0495608_0433230 Ga0495608_0433230_117_551 144
469 3300046523 Ga0495644_0000044 Ga0495644_0000044_32894_33328 144
470 3300046525 Ga0495663_0084669 Ga0495663_0084669_497_931 144
471 3300046538 Ga0495609_0002185 Ga0495609_0002185_9641_10075 144
472 3300046616 Ga0495668_0015530 Ga0495668_0015530_1697_2131 144
473 3300046648 Ga0495611_0016130 Ga0495611_0016130_2543_2977 144
474 3300046660 Ga0495625_0000580 Ga0495625_0000580_146_580 144
475 3300046660 Ga0495625_0020612 Ga0495625_0020612_1754_2188 144
476 3300046660 Ga0495625_0538152 Ga0495625_0538152_168_602 144
477 3300046664 Ga0495659_0137665 Ga0495659_0137665_320_754 144
478 3300046674 Ga0495588_0096100 Ga0495588_0096100_655_1089 144
479 3300046679 Ga0495623_0203974 Ga0495623_0203974_210_644 144
480 3300046684 Ga0495669_0003780 Ga0495669_0003780_1749_2183 144
481 3300046691 Ga0495670_0027481 Ga0495670_0027481_1430_1864 144
482 3300046694 Ga0495649_0208212 Ga0495649_0208212_398_832 144
483 3300047317 Ga0495604_0016650 Ga0495604_0016650_3319_3753 144
484 3300047318 Ga0495636_0105372 Ga0495636_0105372_501_935 144
485 3300047320 Ga0495672_0001831 Ga0495672_0001831_15797_16231 144
486 3300047323 Ga0495683_0089671 Ga0495683_0089671_580_1014 144
487 3300047445 Ga0495677_0088244 Ga0495677_0088244_77_511 144
488 3300047447 Ga0495685_043165 Ga0495685_043165_652_1086 144
489 3300047471 Ga0495684_0620968 Ga0495684_0620968_108_584 144
490 3300047472 Ga0495686_0038629 Ga0495686_0038629_2272_2706 144
491 3300047472 Ga0495686_0314621 Ga0495686_0314621_239_673 144
492 3300048903 Ga0496100_1342214 Ga0496100_1342214_43_477 144
493 3300048903 Ga0496100_1610996 Ga0496100_1610996_56_490 144
494 3300048905 Ga0496102_1448066 Ga0496102_1448066_128_562 144
495 3300048907 Ga0496104_1286548 Ga0496104_1286548_62_496 144
496 3300048908 Ga0496105_0377580 Ga0496105_0377580_544_978 144
497 3300048908 Ga0496105_0541996 Ga0496105_0541996_399_833 144
498 3300048915 Ga0496112_1215692 Ga0496112_1215692_20_454 144
499 3300048917 Ga0496114_0032760 Ga0496114_0032760_2373_2807 144
500 3300049568 Ga0501031_0019586 Ga0501031_0019586_1221_1655 144
501 3300049569 Ga0501032_0002284 Ga0501032_0002284_3120_3554 144
502 3300049570 Ga0501033_0000659 Ga0501033_0000659_24094_24528 144
503 3300049571 Ga0501034_0001806 Ga0501034_0001806_13494_13928 144
504 3300049572 Ga0501036_0010731 Ga0501036_0010731_355_789 144
505 3300049573 Ga0501037_0012094 Ga0501037_0012094_1528_1962 144
506 3300049573 Ga0501037_0050021 Ga0501037_0050021_2329_2763 144
507 3300049574 Ga0501038_0018000 Ga0501038_0018000_269_703 144
508 3300049574 Ga0501038_0725129 Ga0501038_0725129_16_450 144
509 3300049575 Ga0501039_0108274 Ga0501039_0108274_238_672 144
510 3300049579 Ga0501043_0002589 Ga0501043_0002589_9924_10358 144
511 3300049580 Ga0501046_0000056 Ga0501046_0000056_85901_86335 144
512 3300049581 Ga0501047_0051099 Ga0501047_0051099_1083_1517 144
513 3300049581 Ga0501047_0484092 Ga0501047_0484092_86_520 144
514 3300049585 Ga0501069_0103712 Ga0501069_0103712_411_845 144
515 3300049586 Ga0501070_0112578 Ga0501070_0112578_1446_1880 144
516 3300049589 Ga0501073_0010311 Ga0501073_0010311_2967_3401 144
517 3300049589 Ga0501073_0019909 Ga0501073_0019909_872_1306 144
518 3300049590 Ga0501074_0245205 Ga0501074_0245205_787_1221 144
519 3300049742 Ga0501080_0033309 Ga0501080_0033309_2508_2942 144
520 3300049742 Ga0501080_0635639 Ga0501080_0635639_41_475 144
521 3300049822 Ga0501035_0001253 Ga0501035_0001253_6986_7420 144
522 3300049823 Ga0501044_0007868 Ga0501044_0007868_9029_9463 144
523 3300049823 Ga0501044_0520600 Ga0501044_0520600_548_982 144
524 3300050507 nmdc:mga05p37_85593_c1 nmdc:mga05p37_85593_c1_2322_2756 144
525 3300053087 Ga0500643_053056 Ga0500643_053056_506_940 144
526 3300053119 Ga0500595_045224 Ga0500595_045224_315_749 144
527 3300003320 rootH2_10021145 rootH2_100211452 145
528 3300005327 Ga0070658_10000006 Ga0070658_10000006169 145
529 3300005327 Ga0070658_10039592 Ga0070658_100395923 145
530 3300005327 Ga0070658_10134911 Ga0070658_101349111 145
531 3300005330 Ga0070690_100365598 Ga0070690_1003655981 145
532 3300005336 Ga0070680_100651889 Ga0070680_1006518891 145
533 3300005340 Ga0070689_100144210 Ga0070689_1001442102 145
534 3300005364 Ga0070673_100020375 Ga0070673_1000203753 145
535 3300005365 Ga0070688_100061220 Ga0070688_1000612203 145
536 3300005365 Ga0070688_100350705 Ga0070688_1003507051 145
537 3300005440 Ga0070705_100793432 Ga0070705_1007934322 145
538 3300005455 Ga0070663_100013088 Ga0070663_1000130883 145
539 3300005455 Ga0070663_100179349 Ga0070663_1001793492 145
540 3300005458 Ga0070681_10399810 Ga0070681_103998102 145
541 3300005459 Ga0068867_100791107 Ga0068867_1007911072 145
542 3300005543 Ga0070672_100240086 Ga0070672_1002400863 145
543 3300005549 Ga0070704_100578349 Ga0070704_1005783492 145
544 3300005563 Ga0068855_100007178 Ga0068855_10000717815 145
545 3300005563 Ga0068855_100174182 Ga0068855_1001741822 145
546 3300005563 Ga0068855_100291926 Ga0068855_1002919263 145
547 3300005564 Ga0070664_100299054 Ga0070664_1002990542 145
548 3300005578 Ga0068854_100218723 Ga0068854_1002187233 145
549 3300005614 Ga0068856_100850196 Ga0068856_1008501961 145
550 3300005617 Ga0068859_100018092 Ga0068859_1000180927 145
551 3300005618 Ga0068864_100090822 Ga0068864_1000908223 145
552 3300005719 Ga0068861_100326568 Ga0068861_1003265682 145
553 3300005842 Ga0068858_100570505 Ga0068858_1005705051 145
554 3300005843 Ga0068860_101084191 Ga0068860_1010841912 145
555 3300006844 Ga0075428_100025549 Ga0075428_1000255498 145
556 3300006852 Ga0075433_10076442 Ga0075433_100764424 145
557 3300006871 Ga0075434_100110513 Ga0075434_1001105134 145
558 3300006880 Ga0075429_100013415 Ga0075429_1000134157 145
559 3300006931 Ga0097620_100018092 Ga0097620_1000180924 145
560 3300007076 Ga0075435_100286507 Ga0075435_1002865072 145
561 3300009036 Ga0105244_10053379 Ga0105244_100533792 145
562 3300009093 Ga0105240_10094503 Ga0105240_100945033 145
563 3300009094 Ga0111539_10949297 Ga0111539_109492972 145
564 3300009098 Ga0105245_10006935 Ga0105245_100069354 145
565 3300009147 Ga0114129_10104725 Ga0114129_101047252 145
566 3300009177 Ga0105248_10256222 Ga0105248_102562223 145
567 3300009551 Ga0105238_10320094 Ga0105238_103200942 145
568 3300009553 Ga0105249_10163025 Ga0105249_101630252 145
569 3300013104 Ga0157370_10103328 Ga0157370_101033283 145
570 3300013104 Ga0157370_11074699 Ga0157370_110746992 145
571 3300013105 Ga0157369_11710280 Ga0157369_117102801 145
572 3300013296 Ga0157374_10271103 Ga0157374_102711031 145
573 3300013308 Ga0157375_10059475 Ga0157375_100594753 145
574 3300014745 Ga0157377_10646896 Ga0157377_106468961 145
575 3300019166 Ga0184595_107919 Ga0184595_1079192 145
576 3300020069 Ga0197907_10738779 Ga0197907_107387791 145
577 3300020076 Ga0206355_1537879 Ga0206355_15378791 145
578 3300025903 Ga0207680_10414009 Ga0207680_104140092 145
579 3300025909 Ga0207705_10000012 Ga0207705_10000012176 145
580 3300025909 Ga0207705_10076147 Ga0207705_100761473 145
581 3300025909 Ga0207705_10151788 Ga0207705_101517882 145
582 3300025912 Ga0207707_10023728 Ga0207707_100237282 145
583 3300025913 Ga0207695_10192236 Ga0207695_101922363 145
584 3300025913 Ga0207695_10234786 Ga0207695_102347861 145
585 3300025923 Ga0207681_10289314 Ga0207681_102893142 145
586 3300025927 Ga0207687_10391695 Ga0207687_103916951 145
587 3300025936 Ga0207670_10033206 Ga0207670_100332065 145
588 3300025941 Ga0207711_10165572 Ga0207711_101655722 145
589 3300025942 Ga0207689_10061204 Ga0207689_100612042 145
590 3300025945 Ga0207679_10015483 Ga0207679_100154837 145
591 3300025949 Ga0207667_10016157 Ga0207667_100161573 145
592 3300025949 Ga0207667_10050332 Ga0207667_100503323 145
593 3300025949 Ga0207667_11381590 Ga0207667_113815901 145
594 3300025960 Ga0207651_10006568 Ga0207651_100065687 145
595 3300026035 Ga0207703_10291778 Ga0207703_102917782 145
596 3300026035 Ga0207703_10494871 Ga0207703_104948711 145
597 3300026067 Ga0207678_10021612 Ga0207678_100216125 145
598 3300026078 Ga0207702_11261545 Ga0207702_112615451 145
599 3300026095 Ga0207676_10154705 Ga0207676_101547053 145
600 3300026116 Ga0207674_10398721 Ga0207674_103987213 145
601 3300026118 Ga0207675_100095349 Ga0207675_1000953494 145
602 3300028800 Ga0265338_10176577 Ga0265338_101765771 145
603 3300032120 Ga0316053_103404 Ga0316053_1034042 145
604 3300036401 Ga0373937_1041203 Ga0373937_1041203_172_687 145
605 3300044658 Ga0466972_0304243 Ga0466972_0304243_53_493 145
606 3300044694 Ga0466963_0555421 Ga0466963_0555421_165_614 145
607 3300048905 Ga0496102_0382754 Ga0496102_0382754_73_516 145
608 3300048908 Ga0496105_1370255 Ga0496105_1370255_22_459 145
609 3300048910 Ga0496107_0466959 Ga0496107_0466959_286_729 145
610 3300048916 Ga0496113_1309957 Ga0496113_1309957_96_539 145
611 3300049460 Ga0495682_0031856 Ga0495682_0031856_174_614 145
612 3300050507 nmdc:mga05p37_553621_c1 nmdc:mga05p37_553621_c1_372_818 145
613 3300050512 nmdc:mga0n895_1245337_c1 nmdc:mga0n895_1245337_c1_164_610 145
614 3300050513 nmdc:mga0rr50_62289_c1 nmdc:mga0rr50_62289_c1_1555_2001 145
615 3300059510 Ga0587090_034126 Ga0587090_034126_284_727 145
616 3300060344 Ga0587071_040397 Ga0587071_040397_320_763 145
617 3300003322 rootL2_10015203 rootL2_100152032 146
618 3300004799 Ga0058863_11594059 Ga0058863_115940591 146
619 3300004800 Ga0058861_11268347 Ga0058861_112683471 146
620 3300004803 Ga0058862_12433139 Ga0058862_124331391 146
621 3300005337 Ga0070682_100373030 Ga0070682_1003730302 146
622 3300005343 Ga0070687_100555500 Ga0070687_1005555001 146
623 3300005364 Ga0070673_100223203 Ga0070673_1002232032 146
624 3300005437 Ga0070710_10232429 Ga0070710_102324292 146
625 3300005530 Ga0070679_100000607 Ga0070679_10000060720 146
626 3300005544 Ga0070686_100313514 Ga0070686_1003135142 146
627 3300005840 Ga0068870_10501858 Ga0068870_105018582 146
628 3300006163 Ga0070715_10404038 Ga0070715_104040381 146
629 3300009093 Ga0105240_10000001 Ga0105240_100000012067 146
630 3300009093 Ga0105240_10411545 Ga0105240_104115451 146
631 3300013104 Ga0157370_10758244 Ga0157370_107582442 146
632 3300013296 Ga0157374_10168865 Ga0157374_101688652 146
633 3300025898 Ga0207692_10212724 Ga0207692_102127241 146
634 3300025913 Ga0207695_10000001 Ga0207695_100000012070 146
635 3300025918 Ga0207662_10555980 Ga0207662_105559801 146
636 3300025921 Ga0207652_10011368 Ga0207652_100113684 146
637 3300025960 Ga0207651_10191582 Ga0207651_101915823 146
638 3300031239 Ga0265328_10127024 Ga0265328_101270242 146
639 3300031616 Ga0307508_10057810 Ga0307508_100578103 146
640 3300031665 Ga0316575_10172676 Ga0316575_101726762 146
641 3300035241 Ga0373961_0000560 Ga0373961_0000560_2628_3068 146
642 3300035398 Ga0316574_0001659 Ga0316574_0001659_1893_2333 146
643 3300035692 Ga0373935_0002837 Ga0373935_0002837_4211_4654 146
644 3300042007 Ga0439449_0158714 Ga0439449_0158714_325_792 146
645 3300047472 Ga0495686_0351057 Ga0495686_0351057_79_537 146
646 3300048090 Ga0495615_0041972 Ga0495615_0041972_426_875 146
647 3300048917 Ga0496114_0000036 Ga0496114_0000036_42036_42485 146
648 3300049460 Ga0495682_0061520 Ga0495682_0061520_317_775 146
649 3300049583 Ga0501067_0024525 Ga0501067_0024525_1262_1708 146
650 3300049584 Ga0501068_0065117 Ga0501068_0065117_113_559 146
651 3300049584 Ga0501068_0488041 Ga0501068_0488041_324_767 146
652 3300049591 Ga0501075_0000962 Ga0501075_0000962_17244_17690 146
653 3300049593 Ga0501077_0002393 Ga0501077_0002393_759_1205 146
654 3300049742 Ga0501080_0008888 Ga0501080_0008888_676_1122 146
655 3300050511 nmdc:mga08y16_587749_c1 nmdc:mga08y16_587749_c1_505_993 146
656 3300050513 nmdc:mga0rr50_1489417_c1 nmdc:mga0rr50_1489417_c1_13_477 146
657 3300053083 Ga0495655_0063826 Ga0495655_0063826_57_503 146
658 3300059623 Ga0587101_013343 Ga0587101_013343_586_1029 146
659 3300060353 Ga0501082_0000072 Ga0501082_0000072_10054_10503 146
660 3300060353 Ga0501082_0626769 Ga0501082_0626769_424_882 146
661 3300002239 JGI24034J26672_10081659 JGI24034J26672_100816591 147
662 3300004785 Ga0058858_1410928 Ga0058858_14109282 147
663 3300005327 Ga0070658_10038379 Ga0070658_100383795 147
664 3300005335 Ga0070666_10127318 Ga0070666_101273183 147
665 3300005338 Ga0068868_100825760 Ga0068868_1008257601 147
666 3300005364 Ga0070673_102027871 Ga0070673_1020278711 147
667 3300005434 Ga0070709_10272640 Ga0070709_102726403 147
668 3300005434 Ga0070709_10281533 Ga0070709_102815332 147
669 3300005471 Ga0070698_100551473 Ga0070698_1005514732 147
670 3300005539 Ga0068853_102204399 Ga0068853_1022043991 147
671 3300005544 Ga0070686_100078006 Ga0070686_1000780061 147
672 3300006871 Ga0075434_100051793 Ga0075434_1000517935 147
673 3300006871 Ga0075434_100134374 Ga0075434_1001343744 147
674 3300006871 Ga0075434_100287013 Ga0075434_1002870133 147
675 3300006881 Ga0068865_100316941 Ga0068865_1003169412 147
676 3300006914 Ga0075436_100019506 Ga0075436_1000195065 147
677 3300007076 Ga0075435_100032075 Ga0075435_1000320752 147
678 3300009553 Ga0105249_10100341 Ga0105249_101003412 147
679 3300025906 Ga0207699_10228473 Ga0207699_102284731 147
680 3300025907 Ga0207645_10013115 Ga0207645_100131156 147
681 3300025909 Ga0207705_10019852 Ga0207705_100198524 147
682 3300025961 Ga0207712_10146032 Ga0207712_101460323 147
683 3300032002 Ga0307416_101899730 Ga0307416_1018997301 147
684 3300041444 Ga0451790_48433 Ga0451790_48433_74_520 147
685 3300041496 Ga0451839_1488214 Ga0451839_1488214_403_849 147
686 3300041509 Ga0451843_1648800 Ga0451843_1648800_209_655 147
687 3300044694 Ga0466963_0305858 Ga0466963_0305858_625_1071 147
688 3300049744 Ga0501083_0002132 Ga0501083_0002132_8547_8993 147
689 3300050512 nmdc:mga0n895_246885_c1 nmdc:mga0n895_246885_c1_1329_1775 147
690 3300050513 nmdc:mga0rr50_43944_c1 nmdc:mga0rr50_43944_c1_595_1041 147
691 3300050514 nmdc:mga08x19_243258_c1 nmdc:mga08x19_243258_c1_741_1187 147
692 3300050514 nmdc:mga08x19_6642_c1 nmdc:mga08x19_6642_c1_4071_4556 147
693 3300050515 nmdc:mga0a205_174267_c1 nmdc:mga0a205_174267_c1_344_790 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

24

142

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4w-assembly1.cif.gz_I a. baumannii ribosome-eravacycline complex: empty 70s 0.9637 8 142
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9635 8 142
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9593 12 142
7nhn-assembly1.cif.gz_M vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9575 11 141
7asn-assembly1.cif.gz_H staphylococcus aureus 50s after 30 minutes incubation a 37c 0.9573 11 141
ID Description Score Start End Superfamily
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9606 12 141 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9604 14 144 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9579 14 144 3.90.1180.10
af_Q554U7_3_170_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9508 13 136 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9397 11 141 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A6A5L5J7-F1-model_v4 deleted 0.9857 8 141
AF-A0A7C2HIC1-F1-model_v4 Large ribosomal subunit protein uL13 0.9809 8 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A7W0YEG7-F1-model_v4 Large ribosomal subunit protein uL13 0.9788 12 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A101F7L1-F1-model_v4 Large ribosomal subunit protein uL13 0.9776 8 144 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A3B4X4E0-F1-model_v4 50S ribosomal protein L13 0.9773 14 141 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Feature Viewer

pLDDT pTM Quality
87.04 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map