F475684

General Info

Members Datasets Scaffolds Average Seq Length
693 334 1386 211

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_074680|Ga0500643_074680_63_860
Length 242
Sequence LAARLEVGNGRQEAGMLNEQDRARISAAIAQVESKTAGEIFCVLAKDVSRYREVPLLWAAVAAFIVPPLLVVVGLHRLALASIFSSWTDESAHAMEGLILRALSTFELVQAGIFLIVAVLVAMPGVRRAVTPGALKTYRVRQAARRHFVAVGARLSDAEPHILIYASLADRRVELVAHDKIHKAVGEGPWNQSVAAVIDGMQSGKPADGFVKAIEICGTALAQHFPPSGTPANRLPNTILET

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 8.95
Rhizosphere 86.44
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_074680 3300053087 Unclassified 938
2 JGI24746J21847_1007809 3300001977 Bacteria 1627
3 JGI24743J22301_10006434 3300001991 Bacteria 2003
4 JGI24750J21931_1001938 3300002070 Bacteria 2527
5 JGI24745J21846_1001757 3300002073 Bacteria 2137
6 JGI24738J21930_10014202 3300002075 Bacteria 1712
7 JGI24749J21850_1008317 3300002076 Bacteria 1445
8 JGI24744J21845_10000406 3300002077 Bacteria 7457
9 JGI24742J22300_10001904 3300002244 Bacteria 3319
10 JGI25406J46586_10001759 3300003203 Bacteria 10189
11 JGI25153J46596_10006977 3300003215 Bacteria 5628
12 JGI25404J52841_10002770 3300003659 Bacteria 3373
13 Ga0070676_10310741 3300005328 Bacteria 1072
14 Ga0070690_100281039 3300005330 Unclassified 1187
15 Ga0070670_100019601 3300005331 Bacteria 5806
16 Ga0070677_10007226 3300005333 Bacteria 3702
17 Ga0070677_10172119 3300005333 Bacteria 1024
18 Ga0068869_100018551 3300005334 Bacteria 4737
19 Ga0068869_100930773 3300005334 Bacteria 753
20 Ga0070666_10016334 3300005335 Bacteria 4747
21 Ga0070666_10218196 3300005335 Bacteria 1345
22 Ga0070666_10320437 3300005335 Bacteria 1106
23 Ga0070680_100376706 3300005336 Bacteria 1208
24 Ga0070682_100001556 3300005337 Bacteria 12840
25 Ga0070682_100010810 3300005337 Bacteria 5193
26 Ga0070682_100694673 3300005337 Bacteria 815
27 Ga0068868_100010355 3300005338 Bacteria 6746
28 Ga0068868_100346087 3300005338 Bacteria 1272
29 Ga0068868_100531176 3300005338 Unclassified 1034
30 Ga0070660_100043079 3300005339 Bacteria 3448
31 Ga0070660_100097872 3300005339 Bacteria 2322
32 Ga0070689_100124521 3300005340 Bacteria 2061
33 Ga0070689_100365883 3300005340 Bacteria 1212
34 Ga0070691_10041216 3300005341 Bacteria 2183
35 Ga0070687_100310669 3300005343 Bacteria 1004
36 Ga0070661_100000071 3300005344 Bacteria 82723
37 Ga0070692_10114576 3300005345 Bacteria 1495
38 Ga0070668_100003443 3300005347 Bacteria 11685
39 Ga0070668_100004096 3300005347 Bacteria 10796
40 Ga0070668_100075925 3300005347 Bacteria 2624
41 Ga0070669_100103425 3300005353 Bacteria 2152
42 Ga0070669_100184306 3300005353 Bacteria 1635
43 Ga0070669_100456341 3300005353 Bacteria 1054
44 Ga0070675_100078289 3300005354 Bacteria 2753
45 Ga0070671_100003476 3300005355 Bacteria 12288
46 Ga0070671_100076539 3300005355 Bacteria 2795
47 Ga0070674_100007703 3300005356 Bacteria 6361
48 Ga0070674_100042735 3300005356 Bacteria 3080
49 Ga0070673_100012560 3300005364 Bacteria 5819
50 Ga0070673_100013937 3300005364 Bacteria 5582
51 Ga0070673_100698000 3300005364 Bacteria 932
52 Ga0070688_100049175 3300005365 Bacteria 2623
53 Ga0070688_100057908 3300005365 Bacteria 2438
54 Ga0070688_100193467 3300005365 Bacteria 1418
55 Ga0070659_100009307 3300005366 Bacteria 7214
56 Ga0070659_100104161 3300005366 Bacteria 2285
57 Ga0070659_101160990 3300005366 Unclassified 682
58 Ga0070667_100011828 3300005367 Bacteria 7214
59 Ga0070667_100873381 3300005367 Bacteria 836
60 Ga0070667_101030747 3300005367 Bacteria 768
61 Ga0070713_100161785 3300005436 Bacteria 1999
62 Ga0070713_100175301 3300005436 Bacteria 1924
63 Ga0070713_100296663 3300005436 Bacteria 1487
64 Ga0070710_10348158 3300005437 Bacteria 980
65 Ga0070701_10005829 3300005438 Bacteria 5131
66 Ga0070701_10082252 3300005438 Bacteria 1746
67 Ga0070701_10236131 3300005438 Bacteria 1097
68 Ga0070711_100116747 3300005439 Bacteria 1967
69 Ga0070711_100123025 3300005439 Bacteria 1922
70 Ga0070705_100387009 3300005440 Bacteria 1031
71 Ga0070700_100003371 3300005441 Bacteria 8238
72 Ga0070708_100257117 3300005445 Bacteria 1641
73 Ga0070663_100166853 3300005455 Unclassified 1699
74 Ga0070663_100647865 3300005455 Bacteria 893
75 Ga0070678_100005894 3300005456 Bacteria 7126
76 Ga0070678_100164216 3300005456 Bacteria 1802
77 Ga0070678_100734975 3300005456 Unclassified 892
78 Ga0070662_100008277 3300005457 Bacteria 6773
79 Ga0070662_100456139 3300005457 Bacteria 1062
80 Ga0070681_10473516 3300005458 Unclassified 1165
81 Ga0068867_100026540 3300005459 Bacteria 4160
82 Ga0068867_100088507 3300005459 Bacteria 2347
83 Ga0068867_100137146 3300005459 Bacteria 1909
84 Ga0070685_10023342 3300005466 Bacteria 3386
85 Ga0070685_10328629 3300005466 Bacteria 1039
86 Ga0070706_100189788 3300005467 Bacteria 1920
87 Ga0070698_100450669 3300005471 Bacteria 1222
88 Ga0070699_100005212 3300005518 Bacteria 11425
89 Ga0070697_100002109 3300005536 Bacteria 15231
90 Ga0070697_100246294 3300005536 Bacteria 1527
91 Ga0068853_100158380 3300005539 Bacteria 2041
92 Ga0068853_100395293 3300005539 Bacteria 1293
93 Ga0068853_101417466 3300005539 Archaea 672
94 Ga0070672_100015823 3300005543 Bacteria 5385
95 Ga0070672_100555546 3300005543 Bacteria 997
96 Ga0070672_100706927 3300005543 Bacteria 883
97 Ga0070686_100078608 3300005544 Bacteria 2179
98 Ga0070686_100263172 3300005544 Bacteria 1265
99 Ga0070686_100750294 3300005544 Bacteria 783
100 Ga0070695_100014840 3300005545 Bacteria 4700
101 Ga0070695_100464231 3300005545 Bacteria 973
102 Ga0070693_100031441 3300005547 Bacteria 2909
103 Ga0070693_100340603 3300005547 Bacteria 1023
104 Ga0070665_100007652 3300005548 Bacteria 10983
105 Ga0070665_100126088 3300005548 Bacteria 2562
106 Ga0070665_100163572 3300005548 Bacteria 2227
107 Ga0070665_100220929 3300005548 Bacteria 1895
108 Ga0070665_100256853 3300005548 Bacteria 1748
109 Ga0070704_100038731 3300005549 Bacteria 3268
110 Ga0068855_100034384 3300005563 Bacteria 6046
111 Ga0070664_100108510 3300005564 Bacteria 2421
112 Ga0068857_100072289 3300005577 Bacteria 3073
113 Ga0068857_100439879 3300005577 Bacteria 1218
114 Ga0068857_100659911 3300005577 Unclassified 992
115 Ga0068856_100216260 3300005614 Bacteria 1932
116 Ga0068856_100779655 3300005614 Bacteria 976
117 Ga0070702_100016894 3300005615 Bacteria 3755
118 Ga0070702_100137375 3300005615 Bacteria 1553
119 Ga0068852_100065766 3300005616 Bacteria 3165
120 Ga0068859_100006386 3300005617 Bacteria 11960
121 Ga0068859_100120749 3300005617 Bacteria 2687
122 Ga0068864_100001978 3300005618 Bacteria 16866
123 Ga0068864_100064299 3300005618 Bacteria 3181
124 Ga0068864_100076319 3300005618 Bacteria 2928
125 Ga0068866_10024482 3300005718 Bacteria 2823
126 Ga0068866_10042587 3300005718 Bacteria 2260
127 Ga0068866_10045488 3300005718 Bacteria 2202
128 Ga0068861_100018551 3300005719 Bacteria 4956
129 Ga0068851_10056896 3300005834 Bacteria 1996
130 Ga0068870_10003152 3300005840 Bacteria 6953
131 Ga0068870_10086818 3300005840 Bacteria 1741
132 Ga0068863_100002977 3300005841 Bacteria 16752
133 Ga0068863_100013950 3300005841 Bacteria 7746
134 Ga0068863_100545543 3300005841 Bacteria 1144
135 Ga0068858_100046689 3300005842 Bacteria 4014
136 Ga0068858_100135578 3300005842 Bacteria 2310
137 Ga0068858_100245783 3300005842 Bacteria 1699
138 Ga0068858_100366326 3300005842 Bacteria 1382
139 Ga0068860_100000109 3300005843 Bacteria 132169
140 Ga0068860_100018969 3300005843 Bacteria 6681
141 Ga0068860_100266218 3300005843 Bacteria 1672
142 Ga0068862_100003711 3300005844 Bacteria 13037
143 Ga0068862_100073243 3300005844 Bacteria 2960
144 Ga0068862_100139865 3300005844 Bacteria 2148
145 Ga0068862_100701197 3300005844 Bacteria 981
146 Ga0081455_10016680 3300005937 Bacteria 7075
147 Ga0081455_10068364 3300005937 Bacteria 2957
148 Ga0081455_10087507 3300005937 Bacteria 2534
149 Ga0081455_10138944 3300005937 Bacteria 1889
150 Ga0081455_10179887 3300005937 Bacteria 1602
151 Ga0081455_10217491 3300005937 Bacteria 1419
152 Ga0081538_10006350 3300005981 Bacteria 10426
153 Ga0081538_10073205 3300005981 Bacteria 1874
154 Ga0081540_1005049 3300005983 Bacteria 9903
155 Ga0081540_1074935 3300005983 Bacteria 1548
156 Ga0081539_10003504 3300005985 Bacteria 19185
157 Ga0070717_10493952 3300006028 Bacteria 1106
158 Ga0070717_10610656 3300006028 Bacteria 989
159 Ga0075365_10024636 3300006038 Bacteria 3799
160 Ga0075365_10041919 3300006038 Bacteria 2991
161 Ga0075368_10237893 3300006042 Unclassified 776
162 Ga0075363_100021892 3300006048 Bacteria 3227
163 Ga0070715_10009553 3300006163 Bacteria 3424
164 Ga0070716_100381338 3300006173 Unclassified 1008
165 Ga0070712_100063109 3300006175 Bacteria 2621
166 Ga0070712_100458031 3300006175 Bacteria 1063
167 Ga0097621_100002409 3300006237 Bacteria 12810
168 Ga0097621_100008767 3300006237 Bacteria 7306
169 Ga0097621_100018773 3300006237 Bacteria 5291
170 Ga0097621_100083545 3300006237 Bacteria 2661
171 Ga0097621_100145515 3300006237 Bacteria 2028
172 Ga0097621_100370978 3300006237 Bacteria 1277
173 Ga0097621_100679909 3300006237 Bacteria 946
174 Ga0068871_100000749 3300006358 Bacteria 21966
175 Ga0068871_100003422 3300006358 Bacteria 10912
176 Ga0068871_100024191 3300006358 Bacteria 4706
177 Ga0068871_100117304 3300006358 Unclassified 2245
178 Ga0068871_100280697 3300006358 Bacteria 1457
179 Ga0068871_100672160 3300006358 Bacteria 947
180 Ga0075428_100040886 3300006844 Bacteria 5099
181 Ga0075428_100043831 3300006844 Bacteria 4918
182 Ga0075428_100054314 3300006844 Bacteria 4390
183 Ga0075430_100146936 3300006846 Bacteria 1963
184 Ga0075430_100162727 3300006846 Bacteria 1858
185 Ga0075431_100008575 3300006847 Bacteria 10234
186 Ga0075431_100221581 3300006847 Bacteria 1929
187 Ga0075429_100260356 3300006880 Unclassified 1519
188 Ga0075429_100373876 3300006880 Unclassified 1248
189 Ga0068865_100004897 3300006881 Bacteria 8092
190 Ga0068865_100231895 3300006881 Bacteria 1449
191 Ga0068865_100303705 3300006881 Unclassified 1278
192 Ga0075436_100413100 3300006914 Unclassified 979
193 Ga0097620_100006386 3300006931 Bacteria 11960
194 Ga0097620_100120748 3300006931 Bacteria 2687
195 Ga0075435_100337470 3300007076 Bacteria 1291
196 Ga0075435_100381688 3300007076 Bacteria 1210
197 Ga0099795_10000246 3300007788 Bacteria 9648
198 Ga0105251_10324974 3300009011 Bacteria 699
199 Ga0105250_10027852 3300009092 Bacteria 2277
200 Ga0105240_10006316 3300009093 Bacteria 17442
201 Ga0105240_10117189 3300009093 Bacteria 3212
202 Ga0105240_10252743 3300009093 Bacteria 2037
203 Ga0111539_10020959 3300009094 Bacteria 8048
204 Ga0111539_10148446 3300009094 Bacteria 2745
205 Ga0111539_10458923 3300009094 Bacteria 1484
206 Ga0111539_11754466 3300009094 Bacteria 720
207 Ga0105245_10042889 3300009098 Bacteria 4035
208 Ga0105245_10047799 3300009098 Bacteria 3826
209 Ga0105245_10164740 3300009098 Bacteria 2106
210 Ga0105245_10347592 3300009098 Bacteria 1468
211 Ga0105245_10426984 3300009098 Bacteria 1329
212 Ga0105247_10044362 3300009101 Bacteria 2726
213 Ga0114129_10018158 3300009147 Bacteria 10016
214 Ga0114129_10036305 3300009147 Bacteria 6960
215 Ga0105243_10075142 3300009148 Bacteria 2742
216 Ga0105243_10510922 3300009148 Bacteria 1141
217 Ga0105241_10035562 3300009174 Bacteria 3746
218 Ga0105241_10060330 3300009174 Unclassified 2918
219 Ga0105241_10213953 3300009174 Bacteria 1616
220 Ga0105241_10733954 3300009174 Bacteria 904
221 Ga0105242_10114466 3300009176 Bacteria 2305
222 Ga0105242_10281456 3300009176 Bacteria 1511
223 Ga0105242_10520350 3300009176 Bacteria 1135
224 Ga0105248_10038158 3300009177 Bacteria 5376
225 Ga0105248_10285851 3300009177 Bacteria 1857
226 Ga0105248_10404428 3300009177 Bacteria 1537
227 Ga0105237_10173242 3300009545 Bacteria 2158
228 Ga0105237_10294971 3300009545 Unclassified 1624
229 Ga0105237_10427516 3300009545 Bacteria 1330
230 Ga0105238_10036048 3300009551 Bacteria 5028
231 Ga0105238_10285725 3300009551 Bacteria 1631
232 Ga0105238_10787308 3300009551 Bacteria 966
233 Ga0105238_10941389 3300009551 Bacteria 883
234 Ga0105238_11088877 3300009551 Unclassified 821
235 Ga0105249_10003588 3300009553 Bacteria 13424
236 Ga0105249_10010741 3300009553 Bacteria 8044
237 Ga0105249_10059935 3300009553 Bacteria 3491
238 Ga0105249_10526139 3300009553 Bacteria 1230
239 Ga0105249_10898455 3300009553 Unclassified 953
240 Ga0105249_11074169 3300009553 Bacteria 875
241 Ga0105249_11151709 3300009553 Unclassified 846
242 Ga0099796_10003697 3300010159 Bacteria 3592
243 Ga0105239_10044072 3300010375 Bacteria 4891
244 Ga0105239_10089941 3300010375 Bacteria 3386
245 Ga0105239_10114964 3300010375 Unclassified 2985
246 Ga0105239_10338725 3300010375 Bacteria 1697
247 Ga0105239_10760741 3300010375 Unclassified 1109
248 Ga0105239_10948715 3300010375 Bacteria 988
249 Ga0105246_10063778 3300011119 Bacteria 2571
250 Ga0105246_10099082 3300011119 Bacteria 2118
251 Ga0105246_10123036 3300011119 Bacteria 1925
252 Ga0105246_10303258 3300011119 Bacteria 1291
253 Ga0105246_10317020 3300011119 Bacteria 1265
254 Ga0157373_10065900 3300013100 Bacteria 2563
255 Ga0157378_10064315 3300013297 Bacteria 3281
256 Ga0157378_10146601 3300013297 Bacteria 2196
257 Ga0157378_10169067 3300013297 Bacteria 2049
258 Ga0157378_10747482 3300013297 Unclassified 1001
259 Ga0163162_10016763 3300013306 Bacteria 7161
260 Ga0163162_10433011 3300013306 Unclassified 1447
261 Ga0163162_10674390 3300013306 Bacteria 1157
262 Ga0157372_11093655 3300013307 Bacteria 922
263 Ga0157375_10031834 3300013308 Bacteria 4995
264 Ga0157375_10081237 3300013308 Bacteria 3281
265 Ga0157375_10363560 3300013308 Bacteria 1613
266 Ga0163163_10000002 3300014325 Bacteria 609846
267 Ga0163163_10029488 3300014325 Bacteria 5278
268 Ga0163163_10061400 3300014325 Bacteria 3724
269 Ga0163163_10148602 3300014325 Bacteria 2387
270 Ga0163163_10199498 3300014325 Bacteria 2049
271 Ga0157380_10038167 3300014326 Bacteria 3728
272 Ga0157380_10104563 3300014326 Bacteria 2365
273 Ga0157380_10236348 3300014326 Unclassified 1645
274 Ga0157377_10017371 3300014745 Bacteria 3719
275 Ga0157379_10017446 3300014968 Bacteria 6321
276 Ga0157379_10049285 3300014968 Bacteria 3760
277 Ga0157379_10721528 3300014968 Bacteria 937
278 Ga0157376_10067168 3300014969 Bacteria 3032
279 Ga0157376_10069687 3300014969 Bacteria 2982
280 Ga0157376_11084894 3300014969 Bacteria 826
281 Ga0157376_11241954 3300014969 Bacteria 774
282 Ga0163161_10088184 3300017792 Bacteria 2293
283 Ga0163161_10193625 3300017792 Bacteria 1564
284 Ga0163161_10263267 3300017792 Unclassified 1347
285 Ga0213876_10239066 3300021384 Bacteria 965
286 Ga0209233_1000015 3300025261 Bacteria 980563
287 Ga0209758_1000013 3300025297 Bacteria 873003
288 Ga0209758_1103827 3300025297 Bacteria 801
289 Ga0207656_10024585 3300025321 Bacteria 2437
290 Ga0207682_10002454 3300025893 Bacteria 8304
291 Ga0207692_10082028 3300025898 Bacteria 1727
292 Ga0207642_10073502 3300025899 Bacteria 1635
293 Ga0207710_10011767 3300025900 Bacteria 3680
294 Ga0207688_10001561 3300025901 Bacteria 12070
295 Ga0207680_10047854 3300025903 Bacteria 2536
296 Ga0207680_10205662 3300025903 Bacteria 1344
297 Ga0207647_10014113 3300025904 Bacteria 5518
298 Ga0207647_10305977 3300025904 Bacteria 904
299 Ga0207685_10096642 3300025905 Unclassified 1255
300 Ga0207645_10137569 3300025907 Bacteria 1591
301 Ga0207643_10000591 3300025908 Bacteria 23005
302 Ga0207643_10021255 3300025908 Bacteria 3563
303 Ga0207705_10082076 3300025909 Bacteria 2350
304 Ga0207705_10517522 3300025909 Bacteria 927
305 Ga0207684_10198564 3300025910 Bacteria 1730
306 Ga0207684_10847429 3300025910 Unclassified 771
307 Ga0207654_10169474 3300025911 Bacteria 1417
308 Ga0207707_10270457 3300025912 Bacteria 1473
309 Ga0207695_10007385 3300025913 Bacteria 14020
310 Ga0207695_10101228 3300025913 Bacteria 2876
311 Ga0207695_10226385 3300025913 Unclassified 1776
312 Ga0207693_10008486 3300025915 Bacteria 8410
313 Ga0207693_10403275 3300025915 Bacteria 1069
314 Ga0207660_10070641 3300025917 Bacteria 2539
315 Ga0207662_10082374 3300025918 Bacteria 1965
316 Ga0207662_10082931 3300025918 Bacteria 1959
317 Ga0207662_10172906 3300025918 Unclassified 1386
318 Ga0207657_10043092 3300025919 Bacteria 3978
319 Ga0207657_10171922 3300025919 Bacteria 1755
320 Ga0207657_10280084 3300025919 Bacteria 1324
321 Ga0207649_10000175 3300025920 Bacteria 52525
322 Ga0207649_10030643 3300025920 Bacteria 3188
323 Ga0207649_10551305 3300025920 Bacteria 882
324 Ga0207652_10102896 3300025921 Bacteria 2524
325 Ga0207652_10904975 3300025921 Bacteria 779
326 Ga0207681_10141331 3300025923 Bacteria 1793
327 Ga0207681_10708607 3300025923 Bacteria 837
328 Ga0207694_10350231 3300025924 Bacteria 1222
329 Ga0207694_10433331 3300025924 Bacteria 1096
330 Ga0207659_10091162 3300025926 Bacteria 2276
331 Ga0207659_10546539 3300025926 Bacteria 984
332 Ga0207687_10012644 3300025927 Bacteria 5514
333 Ga0207687_10144860 3300025927 Bacteria 1806
334 Ga0207700_10215255 3300025928 Bacteria 1626
335 Ga0207700_10324434 3300025928 Bacteria 1335
336 Ga0207644_10012355 3300025931 Bacteria 5669
337 Ga0207644_10184853 3300025931 Bacteria 1636
338 Ga0207690_10109465 3300025932 Bacteria 1987
339 Ga0207706_10001103 3300025933 Bacteria 27497
340 Ga0207706_10107628 3300025933 Unclassified 2453
341 Ga0207706_10767071 3300025933 Bacteria 821
342 Ga0207686_10024854 3300025934 Bacteria 3477
343 Ga0207709_10038896 3300025935 Bacteria 2837
344 Ga0207709_10371222 3300025935 Bacteria 1086
345 Ga0207670_10034012 3300025936 Bacteria 3289
346 Ga0207670_10264696 3300025936 Bacteria 1334
347 Ga0207670_10328578 3300025936 Bacteria 1205
348 Ga0207670_10620206 3300025936 Bacteria 889
349 Ga0207669_10010624 3300025937 Bacteria 4438
350 Ga0207669_10057730 3300025937 Bacteria 2364
351 Ga0207704_10427489 3300025938 Bacteria 1052
352 Ga0207691_10001292 3300025940 Bacteria 24983
353 Ga0207691_10001627 3300025940 Bacteria 22294
354 Ga0207691_10244410 3300025940 Bacteria 1551
355 Ga0207711_10044806 3300025941 Bacteria 3778
356 Ga0207711_10356880 3300025941 Bacteria 1354
357 Ga0207689_10003872 3300025942 Bacteria 13632
358 Ga0207689_10007002 3300025942 Bacteria 9914
359 Ga0207689_10387107 3300025942 Bacteria 1165
360 Ga0207689_10619325 3300025942 Bacteria 911
361 Ga0207661_10021586 3300025944 Bacteria 4827
362 Ga0207679_10240879 3300025945 Bacteria 1532
363 Ga0207679_10299446 3300025945 Bacteria 1386
364 Ga0207651_10018327 3300025960 Bacteria 4162
365 Ga0207651_10031156 3300025960 Bacteria 3405
366 Ga0207651_10265777 3300025960 Bacteria 1411
367 Ga0207651_10601867 3300025960 Unclassified 961
368 Ga0207712_10010489 3300025961 Bacteria 5882
369 Ga0207712_10053294 3300025961 Bacteria 2837
370 Ga0207712_10295183 3300025961 Unclassified 1328
371 Ga0207668_10010533 3300025972 Bacteria 5590
372 Ga0207668_10029820 3300025972 Bacteria 3579
373 Ga0207640_10017964 3300025981 Bacteria 4147
374 Ga0207640_10423110 3300025981 Bacteria 1091
375 Ga0207640_10437322 3300025981 Unclassified 1075
376 Ga0207658_10112977 3300025986 Bacteria 2151
377 Ga0207658_11079153 3300025986 Bacteria 733
378 Ga0207677_10141797 3300026023 Bacteria 1841
379 Ga0207677_10322733 3300026023 Bacteria 1284
380 Ga0207677_10423514 3300026023 Bacteria 1134
381 Ga0207703_10035780 3300026035 Bacteria 3947
382 Ga0207703_10116313 3300026035 Bacteria 2289
383 Ga0207703_10392422 3300026035 Bacteria 1286
384 Ga0207703_10658090 3300026035 Bacteria 994
385 Ga0207639_10050588 3300026041 Bacteria 3156
386 Ga0207639_10254316 3300026041 Bacteria 1533
387 Ga0207639_10417333 3300026041 Bacteria 1212
388 Ga0207639_10535874 3300026041 Bacteria 1073
389 Ga0207678_10006265 3300026067 Bacteria 10566
390 Ga0207708_10000620 3300026075 Bacteria 27264
391 Ga0207702_10255077 3300026078 Bacteria 1649
392 Ga0207702_10558471 3300026078 Bacteria 1120
393 Ga0207641_10115840 3300026088 Bacteria 2383
394 Ga0207641_10438611 3300026088 Unclassified 1260
395 Ga0207648_10002122 3300026089 Bacteria 21569
396 Ga0207648_10010029 3300026089 Bacteria 9010
397 Ga0207648_10027675 3300026089 Bacteria 5031
398 Ga0207648_10049679 3300026089 Bacteria 3669
399 Ga0207648_10988665 3300026089 Unclassified 788
400 Ga0207676_10053395 3300026095 Bacteria 3163
401 Ga0207676_11168283 3300026095 Bacteria 762
402 Ga0207674_10034599 3300026116 Bacteria 5280
403 Ga0207674_10122408 3300026116 Bacteria 2568
404 Ga0207674_10197966 3300026116 Bacteria 1959
405 Ga0207674_10245581 3300026116 Bacteria 1737
406 Ga0207674_10396984 3300026116 Unclassified 1333
407 Ga0207675_100002342 3300026118 Bacteria 18784
408 Ga0207675_100150368 3300026118 Bacteria 2216
409 Ga0207675_100479267 3300026118 Unclassified 1236
410 Ga0207675_100834633 3300026118 Bacteria 936
411 Ga0207675_100871870 3300026118 Bacteria 916
412 Ga0207675_100953798 3300026118 Bacteria 875
413 Ga0207683_10001466 3300026121 Bacteria 21270
414 Ga0207683_10019897 3300026121 Bacteria 5736
415 Ga0207683_10027226 3300026121 Bacteria 4940
416 Ga0207698_10030872 3300026142 Bacteria 3860
417 Ga0207428_10059653 3300027907 Bacteria 3024
418 Ga0207428_10593217 3300027907 Unclassified 799
419 Ga0268266_10030897 3300028379 Bacteria 4548
420 Ga0268266_10060428 3300028379 Bacteria 3267
421 Ga0268266_10085736 3300028379 Unclassified 2752
422 Ga0268266_10096077 3300028379 Bacteria 2603
423 Ga0268266_10190657 3300028379 Bacteria 1871
424 Ga0268265_10003847 3300028380 Bacteria 10619
425 Ga0268265_10008498 3300028380 Bacteria 6939
426 Ga0268265_10113362 3300028380 Bacteria 2218
427 Ga0268265_10177336 3300028380 Bacteria 1828
428 Ga0268265_10698879 3300028380 Bacteria 979
429 Ga0268264_10000002 3300028381 Bacteria 1153045
430 Ga0268264_10010088 3300028381 Bacteria 7820
431 Ga0268264_10013565 3300028381 Bacteria 6708
432 Ga0268264_10273338 3300028381 Bacteria 1579
433 Ga0265325_10005662 3300031241 Bacteria 7686
434 Ga0265340_10020750 3300031247 Bacteria 3373
435 Ga0265331_10000006 3300031250 Bacteria 418907
436 Ga0265331_10002206 3300031250 Bacteria 13370
437 Ga0265327_10000052 3300031251 Bacteria 256602
438 Ga0265316_10164396 3300031344 Bacteria 1658
439 Ga0265316_10389836 3300031344 Bacteria 1004
440 Ga0307508_10122717 3300031616 Bacteria 2201
441 Ga0265314_10033657 3300031711 Bacteria 3753
442 Ga0265314_10037316 3300031711 Bacteria 3522
443 Ga0265314_10060762 3300031711 Bacteria 2578
444 Ga0307516_10065689 3300031730 Bacteria 3502
445 Ga0307516_10309005 3300031730 Bacteria 1255
446 Ga0373934_0111171 3300035086 Unclassified 1111
447 Ga0373952_0076400 3300035092 Bacteria 847
448 Ga0373936_0061946 3300035113 Bacteria 1529
449 Ga0373936_0070730 3300035113 Bacteria 1438
450 Ga0373945_0008188 3300035116 Bacteria 3400
451 Ga0373953_0094553 3300035117 Bacteria 1253
452 Ga0373954_0328388 3300035118 Bacteria 755
453 Ga0373943_0020649 3300035170 Bacteria 3038
454 Ga0373943_0083043 3300035170 Bacteria 1646
455 Ga0373946_0029455 3300035171 Bacteria 2185
456 Ga0373955_0009688 3300035172 Bacteria 4524
457 Ga0373955_0115161 3300035172 Bacteria 1558
458 Ga0373924_0196336 3300035410 Unclassified 889
459 Ga0373935_0080626 3300035692 Bacteria 2114
460 Ga0373935_0107535 3300035692 Unclassified 1847
461 Ga0373927_0101168 3300035695 Bacteria 1874
462 Ga0373927_0150214 3300035695 Bacteria 1526
463 Ga0373927_0381062 3300035695 Unclassified 930
464 Ga0373947_0043711 3300035725 Bacteria 2676
465 Ga0373947_0060763 3300035725 Bacteria 2295
466 Ga0373947_0118568 3300035725 Bacteria 1679
467 Ga0373937_0000808 3300036401 Bacteria 26768
468 Ga0373925_0075547 3300037068 Bacteria 2553
469 Ga0395900_0493295 3300037418 Bacteria 1176
470 Ga0395898_0046313 3300037466 Bacteria 4272
471 Ga0395905_0189188 3300037471 Bacteria 1931
472 Ga0395905_0606632 3300037471 Bacteria 996
473 Ga0395905_0671457 3300037471 Bacteria 938
474 Ga0395901_0009330 3300038443 Bacteria 9947
475 Ga0436365_0198822 3300039437 Bacteria 12072
476 Ga0436360_0786743 3300039438 Bacteria 2158
477 Ga0436361_0402180 3300039447 Bacteria 4326
478 Ga0466963_0101694 3300044694 Bacteria 1968
479 Ga0495603_0025190 3300046455 Bacteria 3597
480 Ga0495603_0281545 3300046455 Bacteria 956
481 Ga0495638_0017859 3300046460 Bacteria 4721
482 Ga0495580_0091521 3300046472 Bacteria 2117
483 Ga0495582_0039945 3300046473 Bacteria 2583
484 Ga0495605_0026817 3300046474 Bacteria 2991
485 Ga0495605_0041262 3300046474 Bacteria 2299
486 Ga0495605_0192347 3300046474 Unclassified 892
487 Ga0495639_0024031 3300046475 Bacteria 2680
488 Ga0495662_0240447 3300046476 Unclassified 892
489 Ga0495584_0368425 3300046491 Bacteria 730
490 Ga0495585_0038603 3300046492 Bacteria 2687
491 Ga0495585_0057456 3300046492 Bacteria 2147
492 Ga0495594_0114706 3300046499 Bacteria 1520
493 Ga0495596_0088368 3300046500 Bacteria 1203
494 Ga0495607_0053639 3300046501 Bacteria 2328
495 Ga0495607_0138720 3300046501 Bacteria 1257
496 Ga0495608_0320943 3300046511 Unclassified 957
497 Ga0495628_0417019 3300046516 Unclassified 979
498 Ga0495628_0625119 3300046516 Bacteria 767
499 Ga0495630_0105281 3300046517 Bacteria 2136
500 Ga0495644_0059861 3300046523 Bacteria 1432
501 Ga0495648_0170503 3300046524 Unclassified 1116
502 Ga0495663_0005060 3300046525 Bacteria 3684
503 Ga0495663_0112773 3300046525 Bacteria 905
504 Ga0495654_0045497 3300046530 Bacteria 2165
505 Ga0495640_0066787 3300046533 Unclassified 2425
506 Ga0495640_0321109 3300046533 Bacteria 959
507 Ga0495609_0072852 3300046538 Bacteria 1508
508 Ga0495621_0034236 3300046539 Bacteria 1754
509 Ga0495621_0057120 3300046539 Bacteria 1409
510 Ga0495633_0200147 3300046558 Bacteria 917
511 Ga0495667_0220698 3300046559 Bacteria 1210
512 Ga0495656_0028459 3300046615 Bacteria 2242
513 Ga0495656_0085517 3300046615 Bacteria 1432
514 Ga0495668_0056659 3300046616 Bacteria 2163
515 Ga0495634_0063089 3300046642 Bacteria 2460
516 Ga0495659_0060026 3300046664 Bacteria 1402
517 Ga0495659_0259433 3300046664 Bacteria 726
518 Ga0495661_0054985 3300046665 Bacteria 2388
519 Ga0495588_0065970 3300046674 Bacteria 1878
520 Ga0495588_0124324 3300046674 Bacteria 1360
521 Ga0495647_0123894 3300046681 Bacteria 1090
522 Ga0495658_0008659 3300046683 Bacteria 5049
523 Ga0495658_0132021 3300046683 Bacteria 1521
524 Ga0495669_0030683 3300046684 Bacteria 2360
525 Ga0495613_0125834 3300046689 Bacteria 1838
526 Ga0495624_0331798 3300046690 Bacteria 915
527 Ga0495670_0019806 3300046691 Bacteria 3315
528 Ga0495671_0202001 3300046692 Bacteria 964
529 Ga0495649_0115228 3300046694 Bacteria 1423
530 Ga0495581_0185301 3300047315 Bacteria 1217
531 Ga0495676_0031293 3300047321 Bacteria 4502
532 Ga0495676_0418903 3300047321 Bacteria 887
533 Ga0495679_009202 3300047446 Bacteria 3970
534 Ga0495685_084819 3300047447 Bacteria 1053
535 Ga0495684_0163033 3300047471 Unclassified 1662
536 Ga0495602_0351830 3300048088 Bacteria 1063
537 Ga0495614_0308871 3300048089 Bacteria 732
538 Ga0495615_0009836 3300048090 Bacteria 1893
539 Ga0496100_0052828 3300048903 Bacteria 2643
540 Ga0496100_0112909 3300048903 Bacteria 1890
541 Ga0496100_0212877 3300048903 Bacteria 1414
542 Ga0496101_0006039 3300048904 Bacteria 7771
543 Ga0496101_0022942 3300048904 Bacteria 4303
544 Ga0496101_0213854 3300048904 Bacteria 1494
545 Ga0496102_0030424 3300048905 Bacteria 4832
546 Ga0496102_0038590 3300048905 Bacteria 4311
547 Ga0496103_0007690 3300048906 Bacteria 6407
548 Ga0496103_0207773 3300048906 Bacteria 1259
549 Ga0496104_0000671 3300048907 Bacteria 29392
550 Ga0496104_0013106 3300048907 Bacteria 7471
551 Ga0496104_0014367 3300048907 Bacteria 7153
552 Ga0496104_0175951 3300048907 Bacteria 2050
553 Ga0496104_0184912 3300048907 Bacteria 1994
554 Ga0496105_0009471 3300048908 Bacteria 7621
555 Ga0496105_0010252 3300048908 Bacteria 7367
556 Ga0496105_0263459 3300048908 Bacteria 1393
557 Ga0496106_0003496 3300048909 Bacteria 11703
558 Ga0496106_0006990 3300048909 Bacteria 8335
559 Ga0496106_0173641 3300048909 Bacteria 1709
560 Ga0496107_0016347 3300048910 Bacteria 5208
561 Ga0496107_0016379 3300048910 Bacteria 5204
562 Ga0496108_0000347 3300048911 Bacteria 39108
563 Ga0496108_0001531 3300048911 Bacteria 18306
564 Ga0496108_0009690 3300048911 Bacteria 7804
565 Ga0496108_0049755 3300048911 Bacteria 3505
566 Ga0496108_0512843 3300048911 Bacteria 1047
567 Ga0496109_0004728 3300048912 Bacteria 11376
568 Ga0496109_0008070 3300048912 Bacteria 8922
569 Ga0496109_0039283 3300048912 Bacteria 4283
570 Ga0496109_0109428 3300048912 Bacteria 2568
571 Ga0496109_0413601 3300048912 Bacteria 1274
572 Ga0496109_0793474 3300048912 Bacteria 885
573 Ga0496110_0000339 3300048913 Bacteria 31235
574 Ga0496110_0001978 3300048913 Bacteria 15238
575 Ga0496110_0019355 3300048913 Bacteria 5726
576 Ga0496110_0057939 3300048913 Bacteria 3411
577 Ga0496110_0102781 3300048913 Bacteria 2563
578 Ga0496110_0264651 3300048913 Bacteria 1565
579 Ga0496110_1188369 3300048913 Unclassified 671
580 Ga0496111_0001676 3300048914 Bacteria 12899
581 Ga0496111_0012805 3300048914 Bacteria 5690
582 Ga0496111_0016270 3300048914 Bacteria 5123
583 Ga0496111_0082411 3300048914 Bacteria 2349
584 Ga0496112_0001338 3300048915 Bacteria 18736
585 Ga0496112_0004698 3300048915 Bacteria 11628
586 Ga0496112_0011100 3300048915 Bacteria 8209
587 Ga0496112_0129944 3300048915 Bacteria 2490
588 Ga0496112_0165213 3300048915 Bacteria 2179
589 Ga0496112_0467015 3300048915 Bacteria 1199
590 Ga0496113_0000331 3300048916 Bacteria 22477
591 Ga0496113_0008812 3300048916 Bacteria 6589
592 Ga0496113_0144162 3300048916 Bacteria 1875
593 Ga0496114_0030874 3300048917 Bacteria 4407
594 Ga0496114_0333346 3300048917 Bacteria 1341
595 Ga0496114_0892541 3300048917 Bacteria 770
596 Ga0496114_1242492 3300048917 Bacteria 631
597 Ga0496115_0036354 3300048918 Bacteria 3899
598 Ga0496115_0047038 3300048918 Bacteria 3449
599 Ga0496115_0103894 3300048918 Bacteria 2331
600 Ga0496115_0273950 3300048918 Bacteria 1386
601 Ga0496121_0000913 3300048924 Bacteria 53289
602 Ga0496126_0216097 3300048929 Bacteria 1612
603 Ga0501032_0267280 3300049569 Unclassified 1108
604 Ga0501033_0025950 3300049570 Bacteria 4412
605 Ga0501033_0086795 3300049570 Bacteria 2290
606 Ga0501033_0276946 3300049570 Bacteria 1185
607 Ga0501033_0737133 3300049570 Archaea 669
608 Ga0501034_0015949 3300049571 Bacteria 7711
609 Ga0501036_0036722 3300049572 Bacteria 4147
610 Ga0501037_0007536 3300049573 Bacteria 7969
611 Ga0501037_0128768 3300049573 Bacteria 1816
612 Ga0501038_0095310 3300049574 Bacteria 2486
613 Ga0501043_0058645 3300049579 Bacteria 3021
614 Ga0501046_0021675 3300049580 Bacteria 5300
615 Ga0501046_0082042 3300049580 Bacteria 2491
616 Ga0501047_0006741 3300049581 Bacteria 10795
617 Ga0501047_0015028 3300049581 Bacteria 7368
618 Ga0501047_0072211 3300049581 Bacteria 3322
619 Ga0501047_0090486 3300049581 Bacteria 2937
620 Ga0501047_0110036 3300049581 Bacteria 2638
621 Ga0501047_0156437 3300049581 Bacteria 2153
622 Ga0501047_0547428 3300049581 Unclassified 982
623 Ga0501048_0162337 3300049582 Bacteria 1582
624 Ga0501068_0017115 3300049584 Bacteria 4189
625 Ga0501069_0187862 3300049585 Bacteria 1195
626 Ga0501070_0131921 3300049586 Bacteria 2063
627 Ga0501072_0392977 3300049588 Bacteria 1100
628 Ga0501073_0026353 3300049589 Bacteria 4166
629 Ga0501073_0126980 3300049589 Bacteria 1768
630 Ga0501073_0237454 3300049589 Bacteria 1259
631 Ga0501073_0465259 3300049589 Unclassified 874
632 Ga0501074_0088247 3300049590 Bacteria 2221
633 Ga0501075_0399341 3300049591 Bacteria 1048
634 Ga0501076_0435345 3300049592 Bacteria 1079
635 Ga0501083_0050476 3300049744 Bacteria 2800
636 Ga0501083_0143271 3300049744 Bacteria 1565
637 Ga0501083_0345837 3300049744 Bacteria 967
638 Ga0501035_0005667 3300049822 Bacteria 11792
639 Ga0501035_0047019 3300049822 Bacteria 3877
640 Ga0501035_0107410 3300049822 Bacteria 2447
641 Ga0501035_0122134 3300049822 Bacteria 2276
642 Ga0501044_0001467 3300049823 Bacteria 27692
643 Ga0501044_0002022 3300049823 Bacteria 23376
644 Ga0501044_0448684 3300049823 Bacteria 1197
645 Ga0501045_0177915 3300049824 Bacteria 1585
646 nmdc:mga0yw44_49284_c1 3300050492 Bacteria 2542
647 nmdc:mga06z11_110086_c1 3300050494 Bacteria 1524
648 nmdc:mga06z11_367188_c1 3300050494 Unclassified 863
649 nmdc:mga04h51_205716_c1 3300050495 Unclassified 775
650 nmdc:mga07m45_81351_c1 3300050496 Bacteria 1849
651 nmdc:mga05p37_136974_c1 3300050507 Bacteria 3001
652 nmdc:mga05p37_17333_c1 3300050507 Bacteria 8689
653 nmdc:mga05p37_46172_c1 3300050507 Bacteria 5356
654 nmdc:mga05p37_532395_c1 3300050507 Bacteria 1341
655 nmdc:mga09592_502414_c1 3300050508 Unclassified 1044
656 nmdc:mga09592_727214_c1 3300050508 Unclassified 843
657 nmdc:mga0qj67_345665_c1 3300050509 Bacteria 1203
658 nmdc:mga06r32_108563_c1 3300050510 Bacteria 2728
659 nmdc:mga06r32_1264791_c1 3300050510 Unclassified 683
660 nmdc:mga06r32_1271946_c1 3300050510 Bacteria 680
661 nmdc:mga06r32_48157_c1 3300050510 Bacteria 4074
662 nmdc:mga06r32_487534_c1 3300050510 Unclassified 1210
663 nmdc:mga08y16_39967_c1 3300050511 Bacteria 4920
664 nmdc:mga08y16_87901_c1 3300050511 Bacteria 3238
665 nmdc:mga08y16_97049_c1 3300050511 Bacteria 3069
666 nmdc:mga0n895_1105057_c1 3300050512 Bacteria 770
667 nmdc:mga0n895_215953_c2 3300050512 Bacteria 1042
668 nmdc:mga0rr50_738155_c1 3300050513 Bacteria 840
669 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
670 nmdc:mga08x19_338883_c1 3300050514 Unclassified 1048
671 nmdc:mga0a205_261691_c1 3300050515 Bacteria 1607
672 Ga0495601_0035347 3300053077 Bacteria 3118
673 Ga0495655_0000668 3300053083 Bacteria 5508
674 Ga0495619_0009907 3300053085 Bacteria 6003
675 Ga0495619_0065055 3300053085 Bacteria 2432
676 Ga0495619_0098107 3300053085 Bacteria 1992
677 Ga0500643_000003 3300053087 Bacteria 876659
678 Ga0500643_001292 3300053087 Bacteria 14753
679 Ga0500646_0060895 3300053090 Unclassified 1111
680 Ga0500641_0000846 3300053096 Bacteria 11006
681 Ga0500641_0018330 3300053096 Bacteria 2632
682 Ga0500595_016745 3300053119 Bacteria 2724
683 Ga0500568_0025794 3300053139 Bacteria 2474
684 Ga0500568_0071634 3300053139 Bacteria 1326
685 Ga0500573_0000008 3300053140 Bacteria 237795
686 Ga0500577_0106815 3300053142 Bacteria 1151
687 Ga0500639_036474 3300053163 Unclassified 2593
688 Ga0501084_0020727 3300054114 Bacteria 5483
689 Ga0501082_0063296 3300060353 Bacteria 3185
690 Ga0501082_0318909 3300060353 Bacteria 1354
691 Ga0530510_0264563 3300061734 Bacteria 1283
692 Ga0530510_0380697 3300061734 Unclassified 1062
693 Ga0530510_0625729 3300061734 Unclassified 819
694 Ga0500643_074680
695 JGI24746J21847_1007809
696 JGI24743J22301_10006434
697 JGI24750J21931_1001938
698 JGI24745J21846_1001757
699 JGI24738J21930_10014202
700 JGI24749J21850_1008317
701 JGI24744J21845_10000406
702 JGI24742J22300_10001904
703 JGI25406J46586_10001759
704 JGI25153J46596_10006977
705 JGI25404J52841_10002770
706 Ga0070676_10310741
707 Ga0070690_100281039
708 Ga0070670_100019601
709 Ga0070677_10007226
710 Ga0070677_10172119
711 Ga0068869_100018551
712 Ga0068869_100930773
713 Ga0070666_10016334
714 Ga0070666_10218196
715 Ga0070666_10320437
716 Ga0070680_100376706
717 Ga0070682_100001556
718 Ga0070682_100010810
719 Ga0070682_100694673
720 Ga0068868_100010355
721 Ga0068868_100346087
722 Ga0068868_100531176
723 Ga0070660_100043079
724 Ga0070660_100097872
725 Ga0070689_100124521
726 Ga0070689_100365883
727 Ga0070691_10041216
728 Ga0070687_100310669
729 Ga0070661_100000071
730 Ga0070692_10114576
731 Ga0070668_100003443
732 Ga0070668_100004096
733 Ga0070668_100075925
734 Ga0070669_100103425
735 Ga0070669_100184306
736 Ga0070669_100456341
737 Ga0070675_100078289
738 Ga0070671_100003476
739 Ga0070671_100076539
740 Ga0070674_100007703
741 Ga0070674_100042735
742 Ga0070673_100012560
743 Ga0070673_100013937
744 Ga0070673_100698000
745 Ga0070688_100049175
746 Ga0070688_100057908
747 Ga0070688_100193467
748 Ga0070659_100009307
749 Ga0070659_100104161
750 Ga0070659_101160990
751 Ga0070667_100011828
752 Ga0070667_100873381
753 Ga0070667_101030747
754 Ga0070713_100161785
755 Ga0070713_100175301
756 Ga0070713_100296663
757 Ga0070710_10348158
758 Ga0070701_10005829
759 Ga0070701_10082252
760 Ga0070701_10236131
761 Ga0070711_100116747
762 Ga0070711_100123025
763 Ga0070705_100387009
764 Ga0070700_100003371
765 Ga0070708_100257117
766 Ga0070663_100166853
767 Ga0070663_100647865
768 Ga0070678_100005894
769 Ga0070678_100164216
770 Ga0070678_100734975
771 Ga0070662_100008277
772 Ga0070662_100456139
773 Ga0070681_10473516
774 Ga0068867_100026540
775 Ga0068867_100088507
776 Ga0068867_100137146
777 Ga0070685_10023342
778 Ga0070685_10328629
779 Ga0070706_100189788
780 Ga0070698_100450669
781 Ga0070699_100005212
782 Ga0070697_100002109
783 Ga0070697_100246294
784 Ga0068853_100158380
785 Ga0068853_100395293
786 Ga0068853_101417466
787 Ga0070672_100015823
788 Ga0070672_100555546
789 Ga0070672_100706927
790 Ga0070686_100078608
791 Ga0070686_100263172
792 Ga0070686_100750294
793 Ga0070695_100014840
794 Ga0070695_100464231
795 Ga0070693_100031441
796 Ga0070693_100340603
797 Ga0070665_100007652
798 Ga0070665_100126088
799 Ga0070665_100163572
800 Ga0070665_100220929
801 Ga0070665_100256853
802 Ga0070704_100038731
803 Ga0068855_100034384
804 Ga0070664_100108510
805 Ga0068857_100072289
806 Ga0068857_100439879
807 Ga0068857_100659911
808 Ga0068856_100216260
809 Ga0068856_100779655
810 Ga0070702_100016894
811 Ga0070702_100137375
812 Ga0068852_100065766
813 Ga0068859_100006386
814 Ga0068859_100120749
815 Ga0068864_100001978
816 Ga0068864_100064299
817 Ga0068864_100076319
818 Ga0068866_10024482
819 Ga0068866_10042587
820 Ga0068866_10045488
821 Ga0068861_100018551
822 Ga0068851_10056896
823 Ga0068870_10003152
824 Ga0068870_10086818
825 Ga0068863_100002977
826 Ga0068863_100013950
827 Ga0068863_100545543
828 Ga0068858_100046689
829 Ga0068858_100135578
830 Ga0068858_100245783
831 Ga0068858_100366326
832 Ga0068860_100000109
833 Ga0068860_100018969
834 Ga0068860_100266218
835 Ga0068862_100003711
836 Ga0068862_100073243
837 Ga0068862_100139865
838 Ga0068862_100701197
839 Ga0081455_10016680
840 Ga0081455_10068364
841 Ga0081455_10087507
842 Ga0081455_10138944
843 Ga0081455_10179887
844 Ga0081455_10217491
845 Ga0081538_10006350
846 Ga0081538_10073205
847 Ga0081540_1005049
848 Ga0081540_1074935
849 Ga0081539_10003504
850 Ga0070717_10493952
851 Ga0070717_10610656
852 Ga0075365_10024636
853 Ga0075365_10041919
854 Ga0075368_10237893
855 Ga0075363_100021892
856 Ga0070715_10009553
857 Ga0070716_100381338
858 Ga0070712_100063109
859 Ga0070712_100458031
860 Ga0097621_100002409
861 Ga0097621_100008767
862 Ga0097621_100018773
863 Ga0097621_100083545
864 Ga0097621_100145515
865 Ga0097621_100370978
866 Ga0097621_100679909
867 Ga0068871_100000749
868 Ga0068871_100003422
869 Ga0068871_100024191
870 Ga0068871_100117304
871 Ga0068871_100280697
872 Ga0068871_100672160
873 Ga0075428_100040886
874 Ga0075428_100043831
875 Ga0075428_100054314
876 Ga0075430_100146936
877 Ga0075430_100162727
878 Ga0075431_100008575
879 Ga0075431_100221581
880 Ga0075429_100260356
881 Ga0075429_100373876
882 Ga0068865_100004897
883 Ga0068865_100231895
884 Ga0068865_100303705
885 Ga0075436_100413100
886 Ga0097620_100006386
887 Ga0097620_100120748
888 Ga0075435_100337470
889 Ga0075435_100381688
890 Ga0099795_10000246
891 Ga0105251_10324974
892 Ga0105250_10027852
893 Ga0105240_10006316
894 Ga0105240_10117189
895 Ga0105240_10252743
896 Ga0111539_10020959
897 Ga0111539_10148446
898 Ga0111539_10458923
899 Ga0111539_11754466
900 Ga0105245_10042889
901 Ga0105245_10047799
902 Ga0105245_10164740
903 Ga0105245_10347592
904 Ga0105245_10426984
905 Ga0105247_10044362
906 Ga0114129_10018158
907 Ga0114129_10036305
908 Ga0105243_10075142
909 Ga0105243_10510922
910 Ga0105241_10035562
911 Ga0105241_10060330
912 Ga0105241_10213953
913 Ga0105241_10733954
914 Ga0105242_10114466
915 Ga0105242_10281456
916 Ga0105242_10520350
917 Ga0105248_10038158
918 Ga0105248_10285851
919 Ga0105248_10404428
920 Ga0105237_10173242
921 Ga0105237_10294971
922 Ga0105237_10427516
923 Ga0105238_10036048
924 Ga0105238_10285725
925 Ga0105238_10787308
926 Ga0105238_10941389
927 Ga0105238_11088877
928 Ga0105249_10003588
929 Ga0105249_10010741
930 Ga0105249_10059935
931 Ga0105249_10526139
932 Ga0105249_10898455
933 Ga0105249_11074169
934 Ga0105249_11151709
935 Ga0099796_10003697
936 Ga0105239_10044072
937 Ga0105239_10089941
938 Ga0105239_10114964
939 Ga0105239_10338725
940 Ga0105239_10760741
941 Ga0105239_10948715
942 Ga0105246_10063778
943 Ga0105246_10099082
944 Ga0105246_10123036
945 Ga0105246_10303258
946 Ga0105246_10317020
947 Ga0157373_10065900
948 Ga0157378_10064315
949 Ga0157378_10146601
950 Ga0157378_10169067
951 Ga0157378_10747482
952 Ga0163162_10016763
953 Ga0163162_10433011
954 Ga0163162_10674390
955 Ga0157372_11093655
956 Ga0157375_10031834
957 Ga0157375_10081237
958 Ga0157375_10363560
959 Ga0163163_10000002
960 Ga0163163_10029488
961 Ga0163163_10061400
962 Ga0163163_10148602
963 Ga0163163_10199498
964 Ga0157380_10038167
965 Ga0157380_10104563
966 Ga0157380_10236348
967 Ga0157377_10017371
968 Ga0157379_10017446
969 Ga0157379_10049285
970 Ga0157379_10721528
971 Ga0157376_10067168
972 Ga0157376_10069687
973 Ga0157376_11084894
974 Ga0157376_11241954
975 Ga0163161_10088184
976 Ga0163161_10193625
977 Ga0163161_10263267
978 Ga0213876_10239066
979 Ga0209233_1000015
980 Ga0209758_1000013
981 Ga0209758_1103827
982 Ga0207656_10024585
983 Ga0207682_10002454
984 Ga0207692_10082028
985 Ga0207642_10073502
986 Ga0207710_10011767
987 Ga0207688_10001561
988 Ga0207680_10047854
989 Ga0207680_10205662
990 Ga0207647_10014113
991 Ga0207647_10305977
992 Ga0207685_10096642
993 Ga0207645_10137569
994 Ga0207643_10000591
995 Ga0207643_10021255
996 Ga0207705_10082076
997 Ga0207705_10517522
998 Ga0207684_10198564
999 Ga0207684_10847429
1000 Ga0207654_10169474
1001 Ga0207707_10270457
1002 Ga0207695_10007385
1003 Ga0207695_10101228
1004 Ga0207695_10226385
1005 Ga0207693_10008486
1006 Ga0207693_10403275
1007 Ga0207660_10070641
1008 Ga0207662_10082374
1009 Ga0207662_10082931
1010 Ga0207662_10172906
1011 Ga0207657_10043092
1012 Ga0207657_10171922
1013 Ga0207657_10280084
1014 Ga0207649_10000175
1015 Ga0207649_10030643
1016 Ga0207649_10551305
1017 Ga0207652_10102896
1018 Ga0207652_10904975
1019 Ga0207681_10141331
1020 Ga0207681_10708607
1021 Ga0207694_10350231
1022 Ga0207694_10433331
1023 Ga0207659_10091162
1024 Ga0207659_10546539
1025 Ga0207687_10012644
1026 Ga0207687_10144860
1027 Ga0207700_10215255
1028 Ga0207700_10324434
1029 Ga0207644_10012355
1030 Ga0207644_10184853
1031 Ga0207690_10109465
1032 Ga0207706_10001103
1033 Ga0207706_10107628
1034 Ga0207706_10767071
1035 Ga0207686_10024854
1036 Ga0207709_10038896
1037 Ga0207709_10371222
1038 Ga0207670_10034012
1039 Ga0207670_10264696
1040 Ga0207670_10328578
1041 Ga0207670_10620206
1042 Ga0207669_10010624
1043 Ga0207669_10057730
1044 Ga0207704_10427489
1045 Ga0207691_10001292
1046 Ga0207691_10001627
1047 Ga0207691_10244410
1048 Ga0207711_10044806
1049 Ga0207711_10356880
1050 Ga0207689_10003872
1051 Ga0207689_10007002
1052 Ga0207689_10387107
1053 Ga0207689_10619325
1054 Ga0207661_10021586
1055 Ga0207679_10240879
1056 Ga0207679_10299446
1057 Ga0207651_10018327
1058 Ga0207651_10031156
1059 Ga0207651_10265777
1060 Ga0207651_10601867
1061 Ga0207712_10010489
1062 Ga0207712_10053294
1063 Ga0207712_10295183
1064 Ga0207668_10010533
1065 Ga0207668_10029820
1066 Ga0207640_10017964
1067 Ga0207640_10423110
1068 Ga0207640_10437322
1069 Ga0207658_10112977
1070 Ga0207658_11079153
1071 Ga0207677_10141797
1072 Ga0207677_10322733
1073 Ga0207677_10423514
1074 Ga0207703_10035780
1075 Ga0207703_10116313
1076 Ga0207703_10392422
1077 Ga0207703_10658090
1078 Ga0207639_10050588
1079 Ga0207639_10254316
1080 Ga0207639_10417333
1081 Ga0207639_10535874
1082 Ga0207678_10006265
1083 Ga0207708_10000620
1084 Ga0207702_10255077
1085 Ga0207702_10558471
1086 Ga0207641_10115840
1087 Ga0207641_10438611
1088 Ga0207648_10002122
1089 Ga0207648_10010029
1090 Ga0207648_10027675
1091 Ga0207648_10049679
1092 Ga0207648_10988665
1093 Ga0207676_10053395
1094 Ga0207676_11168283
1095 Ga0207674_10034599
1096 Ga0207674_10122408
1097 Ga0207674_10197966
1098 Ga0207674_10245581
1099 Ga0207674_10396984
1100 Ga0207675_100002342
1101 Ga0207675_100150368
1102 Ga0207675_100479267
1103 Ga0207675_100834633
1104 Ga0207675_100871870
1105 Ga0207675_100953798
1106 Ga0207683_10001466
1107 Ga0207683_10019897
1108 Ga0207683_10027226
1109 Ga0207698_10030872
1110 Ga0207428_10059653
1111 Ga0207428_10593217
1112 Ga0268266_10030897
1113 Ga0268266_10060428
1114 Ga0268266_10085736
1115 Ga0268266_10096077
1116 Ga0268266_10190657
1117 Ga0268265_10003847
1118 Ga0268265_10008498
1119 Ga0268265_10113362
1120 Ga0268265_10177336
1121 Ga0268265_10698879
1122 Ga0268264_10000002
1123 Ga0268264_10010088
1124 Ga0268264_10013565
1125 Ga0268264_10273338
1126 Ga0265325_10005662
1127 Ga0265340_10020750
1128 Ga0265331_10000006
1129 Ga0265331_10002206
1130 Ga0265327_10000052
1131 Ga0265316_10164396
1132 Ga0265316_10389836
1133 Ga0307508_10122717
1134 Ga0265314_10033657
1135 Ga0265314_10037316
1136 Ga0265314_10060762
1137 Ga0307516_10065689
1138 Ga0307516_10309005
1139 Ga0373934_0111171
1140 Ga0373952_0076400
1141 Ga0373936_0061946
1142 Ga0373936_0070730
1143 Ga0373945_0008188
1144 Ga0373953_0094553
1145 Ga0373954_0328388
1146 Ga0373943_0020649
1147 Ga0373943_0083043
1148 Ga0373946_0029455
1149 Ga0373955_0009688
1150 Ga0373955_0115161
1151 Ga0373924_0196336
1152 Ga0373935_0080626
1153 Ga0373935_0107535
1154 Ga0373927_0101168
1155 Ga0373927_0150214
1156 Ga0373927_0381062
1157 Ga0373947_0043711
1158 Ga0373947_0060763
1159 Ga0373947_0118568
1160 Ga0373937_0000808
1161 Ga0373925_0075547
1162 Ga0395900_0493295
1163 Ga0395898_0046313
1164 Ga0395905_0189188
1165 Ga0395905_0606632
1166 Ga0395905_0671457
1167 Ga0395901_0009330
1168 Ga0436365_0198822
1169 Ga0436360_0786743
1170 Ga0436361_0402180
1171 Ga0466963_0101694
1172 Ga0495603_0025190
1173 Ga0495603_0281545
1174 Ga0495638_0017859
1175 Ga0495580_0091521
1176 Ga0495582_0039945
1177 Ga0495605_0026817
1178 Ga0495605_0041262
1179 Ga0495605_0192347
1180 Ga0495639_0024031
1181 Ga0495662_0240447
1182 Ga0495584_0368425
1183 Ga0495585_0038603
1184 Ga0495585_0057456
1185 Ga0495594_0114706
1186 Ga0495596_0088368
1187 Ga0495607_0053639
1188 Ga0495607_0138720
1189 Ga0495608_0320943
1190 Ga0495628_0417019
1191 Ga0495628_0625119
1192 Ga0495630_0105281
1193 Ga0495644_0059861
1194 Ga0495648_0170503
1195 Ga0495663_0005060
1196 Ga0495663_0112773
1197 Ga0495654_0045497
1198 Ga0495640_0066787
1199 Ga0495640_0321109
1200 Ga0495609_0072852
1201 Ga0495621_0034236
1202 Ga0495621_0057120
1203 Ga0495633_0200147
1204 Ga0495667_0220698
1205 Ga0495656_0028459
1206 Ga0495656_0085517
1207 Ga0495668_0056659
1208 Ga0495634_0063089
1209 Ga0495659_0060026
1210 Ga0495659_0259433
1211 Ga0495661_0054985
1212 Ga0495588_0065970
1213 Ga0495588_0124324
1214 Ga0495647_0123894
1215 Ga0495658_0008659
1216 Ga0495658_0132021
1217 Ga0495669_0030683
1218 Ga0495613_0125834
1219 Ga0495624_0331798
1220 Ga0495670_0019806
1221 Ga0495671_0202001
1222 Ga0495649_0115228
1223 Ga0495581_0185301
1224 Ga0495676_0031293
1225 Ga0495676_0418903
1226 Ga0495679_009202
1227 Ga0495685_084819
1228 Ga0495684_0163033
1229 Ga0495602_0351830
1230 Ga0495614_0308871
1231 Ga0495615_0009836
1232 Ga0496100_0052828
1233 Ga0496100_0112909
1234 Ga0496100_0212877
1235 Ga0496101_0006039
1236 Ga0496101_0022942
1237 Ga0496101_0213854
1238 Ga0496102_0030424
1239 Ga0496102_0038590
1240 Ga0496103_0007690
1241 Ga0496103_0207773
1242 Ga0496104_0000671
1243 Ga0496104_0013106
1244 Ga0496104_0014367
1245 Ga0496104_0175951
1246 Ga0496104_0184912
1247 Ga0496105_0009471
1248 Ga0496105_0010252
1249 Ga0496105_0263459
1250 Ga0496106_0003496
1251 Ga0496106_0006990
1252 Ga0496106_0173641
1253 Ga0496107_0016347
1254 Ga0496107_0016379
1255 Ga0496108_0000347
1256 Ga0496108_0001531
1257 Ga0496108_0009690
1258 Ga0496108_0049755
1259 Ga0496108_0512843
1260 Ga0496109_0004728
1261 Ga0496109_0008070
1262 Ga0496109_0039283
1263 Ga0496109_0109428
1264 Ga0496109_0413601
1265 Ga0496109_0793474
1266 Ga0496110_0000339
1267 Ga0496110_0001978
1268 Ga0496110_0019355
1269 Ga0496110_0057939
1270 Ga0496110_0102781
1271 Ga0496110_0264651
1272 Ga0496110_1188369
1273 Ga0496111_0001676
1274 Ga0496111_0012805
1275 Ga0496111_0016270
1276 Ga0496111_0082411
1277 Ga0496112_0001338
1278 Ga0496112_0004698
1279 Ga0496112_0011100
1280 Ga0496112_0129944
1281 Ga0496112_0165213
1282 Ga0496112_0467015
1283 Ga0496113_0000331
1284 Ga0496113_0008812
1285 Ga0496113_0144162
1286 Ga0496114_0030874
1287 Ga0496114_0333346
1288 Ga0496114_0892541
1289 Ga0496114_1242492
1290 Ga0496115_0036354
1291 Ga0496115_0047038
1292 Ga0496115_0103894
1293 Ga0496115_0273950
1294 Ga0496121_0000913
1295 Ga0496126_0216097
1296 Ga0501032_0267280
1297 Ga0501033_0025950
1298 Ga0501033_0086795
1299 Ga0501033_0276946
1300 Ga0501033_0737133
1301 Ga0501034_0015949
1302 Ga0501036_0036722
1303 Ga0501037_0007536
1304 Ga0501037_0128768
1305 Ga0501038_0095310
1306 Ga0501043_0058645
1307 Ga0501046_0021675
1308 Ga0501046_0082042
1309 Ga0501047_0006741
1310 Ga0501047_0015028
1311 Ga0501047_0072211
1312 Ga0501047_0090486
1313 Ga0501047_0110036
1314 Ga0501047_0156437
1315 Ga0501047_0547428
1316 Ga0501048_0162337
1317 Ga0501068_0017115
1318 Ga0501069_0187862
1319 Ga0501070_0131921
1320 Ga0501072_0392977
1321 Ga0501073_0026353
1322 Ga0501073_0126980
1323 Ga0501073_0237454
1324 Ga0501073_0465259
1325 Ga0501074_0088247
1326 Ga0501075_0399341
1327 Ga0501076_0435345
1328 Ga0501083_0050476
1329 Ga0501083_0143271
1330 Ga0501083_0345837
1331 Ga0501035_0005667
1332 Ga0501035_0047019
1333 Ga0501035_0107410
1334 Ga0501035_0122134
1335 Ga0501044_0001467
1336 Ga0501044_0002022
1337 Ga0501044_0448684
1338 Ga0501045_0177915
1339 nmdc:mga0yw44_49284_c1
1340 nmdc:mga06z11_110086_c1
1341 nmdc:mga06z11_367188_c1
1342 nmdc:mga04h51_205716_c1
1343 nmdc:mga07m45_81351_c1
1344 nmdc:mga05p37_136974_c1
1345 nmdc:mga05p37_17333_c1
1346 nmdc:mga05p37_46172_c1
1347 nmdc:mga05p37_532395_c1
1348 nmdc:mga09592_502414_c1
1349 nmdc:mga09592_727214_c1
1350 nmdc:mga0qj67_345665_c1
1351 nmdc:mga06r32_108563_c1
1352 nmdc:mga06r32_1264791_c1
1353 nmdc:mga06r32_1271946_c1
1354 nmdc:mga06r32_48157_c1
1355 nmdc:mga06r32_487534_c1
1356 nmdc:mga08y16_39967_c1
1357 nmdc:mga08y16_87901_c1
1358 nmdc:mga08y16_97049_c1
1359 nmdc:mga0n895_1105057_c1
1360 nmdc:mga0n895_215953_c2
1361 nmdc:mga0rr50_738155_c1
1362 nmdc:mga08x19_18_c1
1363 nmdc:mga08x19_338883_c1
1364 nmdc:mga0a205_261691_c1
1365 Ga0495601_0035347
1366 Ga0495655_0000668
1367 Ga0495619_0009907
1368 Ga0495619_0065055
1369 Ga0495619_0098107
1370 Ga0500643_000003
1371 Ga0500643_001292
1372 Ga0500646_0060895
1373 Ga0500641_0000846
1374 Ga0500641_0018330
1375 Ga0500595_016745
1376 Ga0500568_0025794
1377 Ga0500568_0071634
1378 Ga0500573_0000008
1379 Ga0500577_0106815
1380 Ga0500639_036474
1381 Ga0501084_0020727
1382 Ga0501082_0063296
1383 Ga0501082_0318909
1384 Ga0530510_0264563
1385 Ga0530510_0380697
1386 Ga0530510_0625729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8666 1 201
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8233 1 201
3ptj-assembly1.cif.gz_A structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3 0.7657 2 188
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.7489 1 185
7e1v-assembly1.cif.gz_J cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.7415 2 181
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8666 1 201 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8233 1 201 3.10.310.50
af_P55140_17_164_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8164 2 188 3.10.310.50
3ptjA00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7691 2 188 3.10.310.50
af_P9WLA7_26_161_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7454 2 176 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A3A9VYL9-F1-model_v4 Uncharacterized protein 0.9284 120 182
AF-F8JGA9-F1-model_v4 TPM domain-containing protein 0.9237 2 202 GO:0016020
AF-F8JGA9-F1-model_v4 TPM domain-containing protein 0.915 2 202 GO:0016020
AF-A0A0B0Q7C9-F1-model_v4 TPM domain-containing protein 0.9098 1 202 GO:0016020
AF-A0A1M3NQU2-F1-model_v4 TPM domain-containing protein 0.9087 1 202 GO:0016020

Map