F475694
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 349 | 1388 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300002459|JGI24751J29686_10000251|JGI24751J29686_100002512 |
| Length | 347 |
| Sequence | MTPFDEAQDVLRQASGRPGIGVVGAGAWGTALAQAMASDGSEVLIWAREPELVTEINQQRTNSLFLPGASLAPTIRATGDLAELXXXXVLLVVVPAQFLASVVGGLPHGERDLVLCAKGIEAGTGRLMADVARDAAPEATLAVLSGPTFAHEVAAGLPTAVTLACGGGETQWARLAPAISRPMLRPYYSDDVIGAEIGGSVKNVLAIACGVVDGLKLGQNARAALIARGYAEMLRFGAARGARAETLAGLCGLGDLVLTCSSTSSRNFSLGKALGEGLSAAEALAGKSSVAEGAHTAPVLAELAEKAGIAMPIVAAVNRLLKGEASAGAMVAELLARPLRAEQGNSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 92 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 175 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 176 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 177 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 180 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 181 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 182 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 183 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 184 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 287 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 289 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 291 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 292 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 293 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 294 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 296 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 298 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 299 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 305 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 306 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 308 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 309 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 310 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 311 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 312 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 313 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 314 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 315 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 316 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 317 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 318 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 319 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 320 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 321 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 322 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 323 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 324 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 325 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 326 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 327 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 328 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 329 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 330 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 331 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 332 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 333 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 334 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 335 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 336 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 337 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 338 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 339 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 340 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 341 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 342 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 343 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 344 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 345 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 346 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 347 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 348 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 349 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.09 |
| Metatranscriptomes | 0.43 |
| Isolates | 5.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 14.7 |
| Nodule | 0.14 |
| Rhizoplane | 4.18 |
| Rhizosphere | 69.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000251 | 3300002459 | Bacteria | 21182 |
| 2 | SwRhRL2b_contig_2665226 | 2162886007 | Bacteria | 37318 |
| 3 | JGI24741J21665_1006549 | 3300001915 | Bacteria | 2330 |
| 4 | JGI24752J21851_1001195 | 3300001976 | Bacteria | 3523 |
| 5 | JGI24737J22298_10003866 | 3300001990 | Bacteria | 5266 |
| 6 | JGI24737J22298_10045823 | 3300001990 | Bacteria | 1335 |
| 7 | JGI24034J26672_10003557 | 3300002239 | Bacteria | 2179 |
| 8 | JGI24751J29686_10012926 | 3300002459 | Bacteria | 1723 |
| 9 | JGI25150J39212_1000189 | 3300002774 | Bacteria | 34828 |
| 10 | JGI25153J46596_10000125 | 3300003215 | Bacteria | 86065 |
| 11 | Ga0055536_1000358 | 3300003781 | Bacteria | 33927 |
| 12 | Ga0055536_1000785 | 3300003781 | Bacteria | 21171 |
| 13 | Ga0055536_1001881 | 3300003781 | Bacteria | 12207 |
| 14 | Ga0055536_1004888 | 3300003781 | Bacteria | 6689 |
| 15 | Ga0055536_1027487 | 3300003781 | Bacteria | 1571 |
| 16 | Ga0055530_10000054 | 3300003791 | Bacteria | 102159 |
| 17 | Ga0055530_10006284 | 3300003791 | Bacteria | 5343 |
| 18 | Ga0055530_10008250 | 3300003791 | Bacteria | 4208 |
| 19 | Ga0055530_10016343 | 3300003791 | Bacteria | 2376 |
| 20 | Ga0055540_1004110 | 3300003792 | Bacteria | 6737 |
| 21 | Ga0055531_10000492 | 3300003794 | Bacteria | 36203 |
| 22 | Ga0055531_10002269 | 3300003794 | Bacteria | 13015 |
| 23 | Ga0055531_10003200 | 3300003794 | Bacteria | 10516 |
| 24 | Ga0055531_10010446 | 3300003794 | Bacteria | 4611 |
| 25 | Ga0055531_10014634 | 3300003794 | Bacteria | 3519 |
| 26 | Ga0055531_10014636 | 3300003794 | Bacteria | 3519 |
| 27 | Ga0055531_10043756 | 3300003794 | Bacteria | 1264 |
| 28 | Ga0065704_10070228 | 3300005289 | Bacteria | 56935 |
| 29 | Ga0065704_10095011 | 3300005289 | Bacteria | 2511 |
| 30 | Ga0065712_10074966 | 3300005290 | Bacteria | 3967 |
| 31 | Ga0065707_10133605 | 3300005295 | Bacteria | 1878 |
| 32 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 33 | Ga0070658_10029030 | 3300005327 | Bacteria | 4442 |
| 34 | Ga0070658_10090437 | 3300005327 | Bacteria | 2522 |
| 35 | Ga0070683_100095498 | 3300005329 | Bacteria | 2795 |
| 36 | Ga0070690_100022933 | 3300005330 | Bacteria | 3823 |
| 37 | Ga0070670_100043018 | 3300005331 | Bacteria | 3884 |
| 38 | Ga0070670_100057555 | 3300005331 | Bacteria | 3337 |
| 39 | Ga0070670_100082303 | 3300005331 | Bacteria | 2766 |
| 40 | Ga0070670_100251458 | 3300005331 | Bacteria | 1540 |
| 41 | Ga0070670_100456444 | 3300005331 | Bacteria | 1133 |
| 42 | Ga0070677_10001169 | 3300005333 | Bacteria | 8423 |
| 43 | Ga0070666_10053003 | 3300005335 | Bacteria | 2735 |
| 44 | Ga0070680_100010757 | 3300005336 | Bacteria | 7062 |
| 45 | Ga0070660_100000348 | 3300005339 | Bacteria | 30900 |
| 46 | Ga0070660_100030302 | 3300005339 | Bacteria | 4058 |
| 47 | Ga0070661_100000003 | 3300005344 | Bacteria | 254653 |
| 48 | Ga0070661_100132126 | 3300005344 | Bacteria | 1876 |
| 49 | Ga0070668_100091686 | 3300005347 | Bacteria | 2396 |
| 50 | Ga0070668_100131383 | 3300005347 | Bacteria | 2010 |
| 51 | Ga0070668_100331185 | 3300005347 | Bacteria | 1284 |
| 52 | Ga0070669_100000080 | 3300005353 | Bacteria | 92960 |
| 53 | Ga0070669_100000213 | 3300005353 | Bacteria | 48609 |
| 54 | Ga0070669_100000799 | 3300005353 | Bacteria | 22862 |
| 55 | Ga0070669_100027094 | 3300005353 | Bacteria | 4125 |
| 56 | Ga0070669_100108800 | 3300005353 | Bacteria | 2101 |
| 57 | Ga0070675_100095502 | 3300005354 | Bacteria | 2496 |
| 58 | Ga0070671_100000003 | 3300005355 | Bacteria | 270186 |
| 59 | Ga0070671_100002229 | 3300005355 | Bacteria | 14965 |
| 60 | Ga0070671_100007726 | 3300005355 | Bacteria | 8592 |
| 61 | Ga0070671_100016176 | 3300005355 | Bacteria | 6033 |
| 62 | Ga0070671_100034930 | 3300005355 | Bacteria | 4163 |
| 63 | Ga0070671_100048717 | 3300005355 | Bacteria | 3524 |
| 64 | Ga0070674_100269432 | 3300005356 | Bacteria | 1345 |
| 65 | Ga0070659_100000790 | 3300005366 | Bacteria | 23055 |
| 66 | Ga0070659_100009534 | 3300005366 | Bacteria | 7135 |
| 67 | Ga0070667_100000098 | 3300005367 | Bacteria | 108706 |
| 68 | Ga0070667_100003111 | 3300005367 | Bacteria | 14270 |
| 69 | Ga0070667_100005092 | 3300005367 | Bacteria | 11004 |
| 70 | Ga0070667_100241650 | 3300005367 | Bacteria | 1612 |
| 71 | Ga0070709_10009356 | 3300005434 | Bacteria | 5402 |
| 72 | Ga0070714_100000291 | 3300005435 | Bacteria | 38289 |
| 73 | Ga0070714_100003701 | 3300005435 | Bacteria | 11449 |
| 74 | Ga0070714_100013819 | 3300005435 | Bacteria | 6473 |
| 75 | Ga0070713_100042029 | 3300005436 | Bacteria | 3727 |
| 76 | Ga0070710_10000958 | 3300005437 | Bacteria | 13673 |
| 77 | Ga0070705_100142265 | 3300005440 | Bacteria | 1580 |
| 78 | Ga0070694_100057785 | 3300005444 | Bacteria | 2638 |
| 79 | Ga0070663_100006846 | 3300005455 | Bacteria | 6896 |
| 80 | Ga0070663_100020995 | 3300005455 | Bacteria | 4334 |
| 81 | Ga0070662_100003086 | 3300005457 | Bacteria | 10338 |
| 82 | Ga0070662_100090392 | 3300005457 | Bacteria | 2298 |
| 83 | Ga0070662_100136764 | 3300005457 | Bacteria | 1895 |
| 84 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 85 | Ga0070679_100024739 | 3300005530 | Bacteria | 5885 |
| 86 | Ga0070679_100117226 | 3300005530 | Bacteria | 2648 |
| 87 | Ga0070679_100154450 | 3300005530 | Bacteria | 2271 |
| 88 | Ga0070679_100182635 | 3300005530 | Bacteria | 2070 |
| 89 | Ga0068853_100009279 | 3300005539 | Bacteria | 7933 |
| 90 | Ga0068853_100089814 | 3300005539 | Bacteria | 2699 |
| 91 | Ga0068853_100138544 | 3300005539 | Bacteria | 2183 |
| 92 | Ga0068853_100218510 | 3300005539 | Bacteria | 1740 |
| 93 | Ga0070695_100127152 | 3300005545 | Bacteria | 1751 |
| 94 | Ga0070696_100000325 | 3300005546 | Bacteria | 28995 |
| 95 | Ga0070693_100056116 | 3300005547 | Bacteria | 2272 |
| 96 | Ga0070665_100000070 | 3300005548 | Bacteria | 200681 |
| 97 | Ga0070665_100007023 | 3300005548 | Bacteria | 11441 |
| 98 | Ga0070665_100039812 | 3300005548 | Bacteria | 4725 |
| 99 | Ga0070665_100042179 | 3300005548 | Bacteria | 4586 |
| 100 | Ga0070665_100054556 | 3300005548 | Bacteria | 4008 |
| 101 | Ga0070704_100363138 | 3300005549 | Bacteria | 1225 |
| 102 | Ga0068855_100001523 | 3300005563 | Bacteria | 29042 |
| 103 | Ga0068855_100226884 | 3300005563 | Bacteria | 2093 |
| 104 | Ga0068855_100311135 | 3300005563 | Bacteria | 1743 |
| 105 | Ga0070664_100005465 | 3300005564 | Bacteria | 10201 |
| 106 | Ga0070664_100181604 | 3300005564 | Bacteria | 1870 |
| 107 | Ga0070664_100209377 | 3300005564 | Bacteria | 1742 |
| 108 | Ga0068854_100001419 | 3300005578 | Bacteria | 14478 |
| 109 | Ga0068854_100224046 | 3300005578 | Bacteria | 1489 |
| 110 | Ga0068852_100123369 | 3300005616 | Bacteria | 2375 |
| 111 | Ga0068859_100025512 | 3300005617 | Bacteria | 5929 |
| 112 | Ga0068864_100003096 | 3300005618 | Bacteria | 13743 |
| 113 | Ga0068864_100014967 | 3300005618 | Bacteria | 6446 |
| 114 | Ga0068864_100017649 | 3300005618 | Bacteria | 5951 |
| 115 | Ga0068864_100032103 | 3300005618 | Bacteria | 4460 |
| 116 | Ga0068863_100000081 | 3300005841 | Bacteria | 106186 |
| 117 | Ga0068863_100030180 | 3300005841 | Bacteria | 5179 |
| 118 | Ga0068863_100040042 | 3300005841 | Bacteria | 4456 |
| 119 | Ga0068858_100000723 | 3300005842 | Bacteria | 34436 |
| 120 | Ga0068858_100017428 | 3300005842 | Bacteria | 6737 |
| 121 | Ga0068858_100024766 | 3300005842 | Bacteria | 5589 |
| 122 | Ga0068858_100039905 | 3300005842 | Bacteria | 4352 |
| 123 | Ga0068858_100062894 | 3300005842 | Bacteria | 3433 |
| 124 | Ga0068858_100079107 | 3300005842 | Bacteria | 3055 |
| 125 | Ga0068860_100000108 | 3300005843 | Bacteria | 132230 |
| 126 | Ga0068860_100000164 | 3300005843 | Bacteria | 108706 |
| 127 | Ga0068860_100004656 | 3300005843 | Bacteria | 14008 |
| 128 | Ga0068860_100028825 | 3300005843 | Bacteria | 5342 |
| 129 | Ga0068860_100034974 | 3300005843 | Bacteria | 4820 |
| 130 | Ga0068860_100065405 | 3300005843 | Bacteria | 3453 |
| 131 | Ga0068860_100210296 | 3300005843 | Bacteria | 1887 |
| 132 | Ga0068862_100027216 | 3300005844 | Bacteria | 4812 |
| 133 | Ga0068862_100048465 | 3300005844 | Bacteria | 3627 |
| 134 | Ga0081455_10000088 | 3300005937 | Bacteria | 98815 |
| 135 | Ga0081455_10002477 | 3300005937 | Bacteria | 21952 |
| 136 | Ga0081455_10042235 | 3300005937 | Bacteria | 4002 |
| 137 | Ga0075368_10008957 | 3300006042 | Bacteria | 3589 |
| 138 | Ga0075368_10016620 | 3300006042 | Bacteria | 2744 |
| 139 | Ga0075363_100061679 | 3300006048 | Bacteria | 2021 |
| 140 | Ga0075364_10131989 | 3300006051 | Bacteria | 1677 |
| 141 | Ga0075432_10004893 | 3300006058 | Bacteria | 4562 |
| 142 | Ga0070712_100008055 | 3300006175 | Bacteria | 6612 |
| 143 | Ga0075362_10000167 | 3300006177 | Bacteria | 17986 |
| 144 | Ga0075367_10012146 | 3300006178 | Bacteria | 4581 |
| 145 | Ga0075366_10015348 | 3300006195 | Bacteria | 4388 |
| 146 | Ga0075366_10053492 | 3300006195 | Bacteria | 2398 |
| 147 | Ga0075370_10014378 | 3300006353 | Bacteria | 4221 |
| 148 | Ga0075428_100120369 | 3300006844 | Bacteria | 2858 |
| 149 | Ga0075428_100272269 | 3300006844 | Bacteria | 1822 |
| 150 | Ga0075431_100004319 | 3300006847 | Bacteria | 13927 |
| 151 | Ga0097620_100025512 | 3300006931 | Bacteria | 5929 |
| 152 | Ga0079104_1020607 | 3300006946 | Bacteria | 1813 |
| 153 | Ga0105251_10000334 | 3300009011 | Bacteria | 47275 |
| 154 | Ga0105251_10011293 | 3300009011 | Bacteria | 5110 |
| 155 | Ga0111539_10166398 | 3300009094 | Bacteria | 2578 |
| 156 | Ga0105245_10121461 | 3300009098 | Bacteria | 2441 |
| 157 | Ga0105242_10089297 | 3300009176 | Bacteria | 2590 |
| 158 | Ga0105248_10000626 | 3300009177 | Bacteria | 40130 |
| 159 | Ga0105248_10023914 | 3300009177 | Bacteria | 6792 |
| 160 | Ga0105248_10065721 | 3300009177 | Bacteria | 4072 |
| 161 | Ga0105248_10067601 | 3300009177 | Bacteria | 4012 |
| 162 | Ga0105248_10107466 | 3300009177 | Bacteria | 3146 |
| 163 | Ga0105248_10201351 | 3300009177 | Bacteria | 2243 |
| 164 | Ga0105248_10211680 | 3300009177 | Bacteria | 2184 |
| 165 | Ga0105238_10029528 | 3300009551 | Bacteria | 5585 |
| 166 | Ga0105238_10378625 | 3300009551 | Bacteria | 1406 |
| 167 | Ga0105249_10017211 | 3300009553 | Bacteria | 6418 |
| 168 | Ga0105246_10000847 | 3300011119 | Bacteria | 17492 |
| 169 | Ga0157373_10049060 | 3300013100 | Bacteria | 3009 |
| 170 | Ga0157371_10020876 | 3300013102 | Bacteria | 4817 |
| 171 | Ga0157371_10152227 | 3300013102 | Bacteria | 1650 |
| 172 | Ga0157369_10004697 | 3300013105 | Bacteria | 16061 |
| 173 | Ga0157378_10005257 | 3300013297 | Bacteria | 11373 |
| 174 | Ga0163162_10014044 | 3300013306 | Bacteria | 7827 |
| 175 | Ga0163162_10029740 | 3300013306 | Bacteria | 5407 |
| 176 | Ga0163162_10087572 | 3300013306 | Bacteria | 3193 |
| 177 | Ga0163163_10168627 | 3300014325 | Bacteria | 2236 |
| 178 | Ga0163163_10251818 | 3300014325 | Bacteria | 1817 |
| 179 | Ga0157380_10012559 | 3300014326 | Bacteria | 6146 |
| 180 | Ga0163161_10002367 | 3300017792 | Bacteria | 13509 |
| 181 | Ga0163161_10013528 | 3300017792 | Bacteria | 5682 |
| 182 | Ga0163161_10056425 | 3300017792 | Bacteria | 2852 |
| 183 | Ga0163161_10472333 | 3300017792 | Bacteria | 1017 |
| 184 | Ga0206356_10400983 | 3300020070 | Bacteria | 1447 |
| 185 | Ga0206354_10564923 | 3300020081 | Bacteria | 6741 |
| 186 | Ga0206353_10226904 | 3300020082 | Bacteria | 16427 |
| 187 | Ga0213876_10000250 | 3300021384 | Bacteria | 51059 |
| 188 | Ga0213875_10000636 | 3300021388 | Bacteria | 28040 |
| 189 | Ga0209147_102039 | 3300025229 | Bacteria | 5791 |
| 190 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 191 | Ga0209129_1000345 | 3300025258 | Bacteria | 39677 |
| 192 | Ga0209675_1000131 | 3300025291 | Bacteria | 102409 |
| 193 | Ga0209676_1000084 | 3300025292 | Bacteria | 274330 |
| 194 | Ga0209676_1000563 | 3300025292 | Bacteria | 55979 |
| 195 | Ga0209676_1000729 | 3300025292 | Bacteria | 45044 |
| 196 | Ga0209676_1000746 | 3300025292 | Bacteria | 44094 |
| 197 | Ga0209676_1003606 | 3300025292 | Bacteria | 9320 |
| 198 | Ga0209676_1005902 | 3300025292 | Bacteria | 6217 |
| 199 | Ga0209676_1007451 | 3300025292 | Bacteria | 5135 |
| 200 | Ga0209676_1024915 | 3300025292 | Bacteria | 1928 |
| 201 | Ga0209025_1000855 | 3300025294 | Bacteria | 48253 |
| 202 | Ga0209025_1006315 | 3300025294 | Bacteria | 9254 |
| 203 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 204 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 205 | Ga0209050_1000113 | 3300025298 | Bacteria | 209222 |
| 206 | Ga0209050_1000127 | 3300025298 | Bacteria | 187951 |
| 207 | Ga0209050_1001889 | 3300025298 | Bacteria | 20097 |
| 208 | Ga0209050_1017377 | 3300025298 | Bacteria | 2873 |
| 209 | Ga0209051_1000297 | 3300025303 | Bacteria | 79062 |
| 210 | Ga0209257_1000083 | 3300025304 | Bacteria | 296207 |
| 211 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 212 | Ga0209257_1000126 | 3300025304 | Bacteria | 215705 |
| 213 | Ga0209257_1000330 | 3300025304 | Bacteria | 99167 |
| 214 | Ga0209257_1002675 | 3300025304 | Bacteria | 17088 |
| 215 | Ga0209257_1002709 | 3300025304 | Bacteria | 16888 |
| 216 | Ga0209257_1011185 | 3300025304 | Bacteria | 4365 |
| 217 | Ga0207697_10044592 | 3300025315 | Bacteria | 1825 |
| 218 | Ga0207713_1000987 | 3300025735 | Bacteria | 24987 |
| 219 | Ga0207692_10003524 | 3300025898 | Bacteria | 6122 |
| 220 | Ga0207688_10312704 | 3300025901 | Bacteria | 962 |
| 221 | Ga0207647_10105058 | 3300025904 | Bacteria | 1673 |
| 222 | Ga0207699_10001263 | 3300025906 | Bacteria | 12028 |
| 223 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 224 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 225 | Ga0207705_10002096 | 3300025909 | Bacteria | 15503 |
| 226 | Ga0207705_10035024 | 3300025909 | Bacteria | 3591 |
| 227 | Ga0207705_10041008 | 3300025909 | Bacteria | 3321 |
| 228 | Ga0207707_10022373 | 3300025912 | Bacteria | 5527 |
| 229 | Ga0207693_10000563 | 3300025915 | Bacteria | 33538 |
| 230 | Ga0207660_10074130 | 3300025917 | Bacteria | 2483 |
| 231 | Ga0207657_10003426 | 3300025919 | Bacteria | 16933 |
| 232 | Ga0207657_10128246 | 3300025919 | Bacteria | 2081 |
| 233 | Ga0207649_10000016 | 3300025920 | Bacteria | 243843 |
| 234 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 235 | Ga0207652_10042502 | 3300025921 | Bacteria | 3869 |
| 236 | Ga0207652_10108590 | 3300025921 | Bacteria | 2459 |
| 237 | Ga0207652_10115415 | 3300025921 | Bacteria | 2385 |
| 238 | Ga0207646_10280474 | 3300025922 | Bacteria | 1506 |
| 239 | Ga0207681_10000037 | 3300025923 | Bacteria | 154417 |
| 240 | Ga0207681_10000049 | 3300025923 | Bacteria | 120296 |
| 241 | Ga0207681_10000490 | 3300025923 | Bacteria | 27651 |
| 242 | Ga0207681_10161455 | 3300025923 | Bacteria | 1690 |
| 243 | Ga0207681_10360815 | 3300025923 | Bacteria | 1165 |
| 244 | Ga0207694_10057217 | 3300025924 | Bacteria | 3031 |
| 245 | Ga0207650_10055502 | 3300025925 | Bacteria | 2941 |
| 246 | Ga0207650_10129271 | 3300025925 | Bacteria | 1975 |
| 247 | Ga0207664_10000306 | 3300025929 | Bacteria | 36504 |
| 248 | Ga0207664_10017649 | 3300025929 | Bacteria | 5237 |
| 249 | Ga0207664_10077257 | 3300025929 | Bacteria | 2697 |
| 250 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 251 | Ga0207644_10000052 | 3300025931 | Bacteria | 91473 |
| 252 | Ga0207644_10000327 | 3300025931 | Bacteria | 30858 |
| 253 | Ga0207644_10019022 | 3300025931 | Bacteria | 4656 |
| 254 | Ga0207644_10135939 | 3300025931 | Bacteria | 1887 |
| 255 | Ga0207690_10003688 | 3300025932 | Bacteria | 9113 |
| 256 | Ga0207690_10056969 | 3300025932 | Bacteria | 2639 |
| 257 | Ga0207706_10003818 | 3300025933 | Bacteria | 14362 |
| 258 | Ga0207706_10109535 | 3300025933 | Bacteria | 2430 |
| 259 | Ga0207686_10100089 | 3300025934 | Bacteria | 1933 |
| 260 | Ga0207670_10095231 | 3300025936 | Bacteria | 2114 |
| 261 | Ga0207665_10069002 | 3300025939 | Bacteria | 2409 |
| 262 | Ga0207711_10002900 | 3300025941 | Bacteria | 15023 |
| 263 | Ga0207711_10011668 | 3300025941 | Bacteria | 7300 |
| 264 | Ga0207711_10159687 | 3300025941 | Bacteria | 2039 |
| 265 | Ga0207711_10176355 | 3300025941 | Bacteria | 1942 |
| 266 | Ga0207679_10023064 | 3300025945 | Bacteria | 4249 |
| 267 | Ga0207679_10143572 | 3300025945 | Bacteria | 1933 |
| 268 | Ga0207679_10146155 | 3300025945 | Bacteria | 1918 |
| 269 | Ga0207667_10001114 | 3300025949 | Bacteria | 33871 |
| 270 | Ga0207667_10176845 | 3300025949 | Bacteria | 2192 |
| 271 | Ga0207667_10181945 | 3300025949 | Bacteria | 2158 |
| 272 | Ga0207667_10205597 | 3300025949 | Bacteria | 2019 |
| 273 | Ga0207712_10074955 | 3300025961 | Bacteria | 2444 |
| 274 | Ga0207668_10301368 | 3300025972 | Bacteria | 1323 |
| 275 | Ga0207640_10010814 | 3300025981 | Bacteria | 5151 |
| 276 | Ga0207640_10161344 | 3300025981 | Bacteria | 1659 |
| 277 | Ga0207658_10000359 | 3300025986 | Bacteria | 44920 |
| 278 | Ga0207658_10008019 | 3300025986 | Bacteria | 7194 |
| 279 | Ga0207658_10016310 | 3300025986 | Bacteria | 5109 |
| 280 | Ga0207658_10017616 | 3300025986 | Bacteria | 4925 |
| 281 | Ga0207658_10252926 | 3300025986 | Bacteria | 1498 |
| 282 | Ga0207703_10004091 | 3300026035 | Bacteria | 12030 |
| 283 | Ga0207703_10017501 | 3300026035 | Bacteria | 5593 |
| 284 | Ga0207703_10035845 | 3300026035 | Bacteria | 3945 |
| 285 | Ga0207703_10060315 | 3300026035 | Bacteria | 3102 |
| 286 | Ga0207639_10067320 | 3300026041 | Bacteria | 2786 |
| 287 | Ga0207639_10292338 | 3300026041 | Bacteria | 1437 |
| 288 | Ga0207678_10121781 | 3300026067 | Bacteria | 2226 |
| 289 | Ga0207641_10000182 | 3300026088 | Bacteria | 87316 |
| 290 | Ga0207641_10004589 | 3300026088 | Bacteria | 11931 |
| 291 | Ga0207641_10004606 | 3300026088 | Bacteria | 11904 |
| 292 | Ga0207641_10018961 | 3300026088 | Bacteria | 5644 |
| 293 | Ga0207641_10051708 | 3300026088 | Bacteria | 3479 |
| 294 | Ga0207676_10001834 | 3300026095 | Bacteria | 15561 |
| 295 | Ga0207676_10006981 | 3300026095 | Bacteria | 8003 |
| 296 | Ga0207676_10030235 | 3300026095 | Bacteria | 4063 |
| 297 | Ga0207676_10093111 | 3300026095 | Bacteria | 2480 |
| 298 | Ga0207674_10333943 | 3300026116 | Bacteria | 1466 |
| 299 | Ga0207675_100217217 | 3300026118 | Bacteria | 1841 |
| 300 | Ga0207683_10373898 | 3300026121 | Bacteria | 1309 |
| 301 | Ga0207698_10252813 | 3300026142 | Bacteria | 1614 |
| 302 | Ga0209983_1021833 | 3300027665 | Bacteria | 1340 |
| 303 | Ga0209813_10000014 | 3300027866 | Bacteria | 87712 |
| 304 | Ga0209974_10002253 | 3300027876 | Bacteria | 7016 |
| 305 | Ga0268266_10002260 | 3300028379 | Bacteria | 20954 |
| 306 | Ga0268266_10003129 | 3300028379 | Bacteria | 16835 |
| 307 | Ga0268266_10072060 | 3300028379 | Bacteria | 2995 |
| 308 | Ga0268265_10029030 | 3300028380 | Bacteria | 3966 |
| 309 | Ga0268264_10000126 | 3300028381 | Bacteria | 186138 |
| 310 | Ga0268264_10000228 | 3300028381 | Bacteria | 108722 |
| 311 | Ga0268264_10008642 | 3300028381 | Bacteria | 8461 |
| 312 | Ga0268264_10086744 | 3300028381 | Bacteria | 2690 |
| 313 | Ga0268264_10144596 | 3300028381 | Bacteria | 2125 |
| 314 | Ga0268264_10169872 | 3300028381 | Bacteria | 1971 |
| 315 | Ga0265327_10021805 | 3300031251 | Bacteria | 3854 |
| 316 | Ga0307513_10021142 | 3300031456 | Bacteria | 7688 |
| 317 | Ga0307513_10363304 | 3300031456 | Bacteria | 1192 |
| 318 | Ga0307408_100038304 | 3300031548 | Bacteria | 3382 |
| 319 | Ga0307408_100210822 | 3300031548 | Bacteria | 1579 |
| 320 | Ga0265314_10071008 | 3300031711 | Bacteria | 2331 |
| 321 | Ga0307405_10059522 | 3300031731 | Bacteria | 2407 |
| 322 | Ga0307413_10002717 | 3300031824 | Bacteria | 7258 |
| 323 | Ga0307413_10027374 | 3300031824 | Bacteria | 3158 |
| 324 | Ga0307413_10080056 | 3300031824 | Bacteria | 2090 |
| 325 | Ga0307413_10201270 | 3300031824 | Bacteria | 1438 |
| 326 | Ga0307410_10013851 | 3300031852 | Bacteria | 4721 |
| 327 | Ga0307410_10069597 | 3300031852 | Bacteria | 2435 |
| 328 | Ga0307406_10002460 | 3300031901 | Bacteria | 10086 |
| 329 | Ga0307406_10067956 | 3300031901 | Bacteria | 2325 |
| 330 | Ga0307406_10104692 | 3300031901 | Bacteria | 1935 |
| 331 | Ga0307406_10193563 | 3300031901 | Bacteria | 1491 |
| 332 | Ga0307412_10001006 | 3300031911 | Bacteria | 16124 |
| 333 | Ga0307412_10003087 | 3300031911 | Bacteria | 9240 |
| 334 | Ga0307412_10005482 | 3300031911 | Bacteria | 7125 |
| 335 | Ga0307412_10006239 | 3300031911 | Bacteria | 6729 |
| 336 | Ga0307412_10008763 | 3300031911 | Bacteria | 5790 |
| 337 | Ga0307412_10013499 | 3300031911 | Bacteria | 4792 |
| 338 | Ga0307412_10122392 | 3300031911 | Bacteria | 1875 |
| 339 | Ga0307409_100003480 | 3300031995 | Bacteria | 8560 |
| 340 | Ga0307409_100042233 | 3300031995 | Bacteria | 3413 |
| 341 | Ga0307409_100050221 | 3300031995 | Bacteria | 3184 |
| 342 | Ga0307409_100122051 | 3300031995 | Bacteria | 2209 |
| 343 | Ga0307416_100009876 | 3300032002 | Bacteria | 6276 |
| 344 | Ga0307416_100119210 | 3300032002 | Bacteria | 2347 |
| 345 | Ga0307416_100284140 | 3300032002 | Bacteria | 1633 |
| 346 | Ga0307414_10000212 | 3300032004 | Bacteria | 38895 |
| 347 | Ga0307414_10000463 | 3300032004 | Bacteria | 21300 |
| 348 | Ga0307414_10000704 | 3300032004 | Bacteria | 17134 |
| 349 | Ga0307414_10013269 | 3300032004 | Bacteria | 4902 |
| 350 | Ga0307414_10039212 | 3300032004 | Bacteria | 3189 |
| 351 | Ga0307414_10041487 | 3300032004 | Bacteria | 3118 |
| 352 | Ga0307414_10053962 | 3300032004 | Bacteria | 2806 |
| 353 | Ga0307414_10189068 | 3300032004 | Bacteria | 1664 |
| 354 | Ga0307414_10220676 | 3300032004 | Bacteria | 1556 |
| 355 | Ga0307414_10414689 | 3300032004 | Bacteria | 1173 |
| 356 | Ga0307411_10010239 | 3300032005 | Bacteria | 4985 |
| 357 | Ga0307411_10011224 | 3300032005 | Bacteria | 4822 |
| 358 | Ga0307411_10432026 | 3300032005 | Bacteria | 1097 |
| 359 | Ga0307415_100037173 | 3300032126 | Bacteria | 3198 |
| 360 | Ga0307415_100056249 | 3300032126 | Bacteria | 2696 |
| 361 | Ga0307415_100142495 | 3300032126 | Bacteria | 1833 |
| 362 | Ga0307510_10000248 | 3300033180 | Bacteria | 48764 |
| 363 | Ga0307510_10183926 | 3300033180 | Bacteria | 1648 |
| 364 | Ga0395899_0028519 | 3300037312 | Bacteria | 4203 |
| 365 | Ga0395899_0043223 | 3300037312 | Bacteria | 3362 |
| 366 | Ga0395899_0084496 | 3300037312 | Bacteria | 2307 |
| 367 | Ga0395900_0000731 | 3300037418 | Bacteria | 43691 |
| 368 | Ga0395900_0011469 | 3300037418 | Bacteria | 9071 |
| 369 | Ga0395900_0069109 | 3300037418 | Bacteria | 3630 |
| 370 | Ga0395900_0076589 | 3300037418 | Bacteria | 3437 |
| 371 | Ga0395900_0102837 | 3300037418 | Bacteria | 2935 |
| 372 | Ga0395900_0237892 | 3300037418 | Bacteria | 1828 |
| 373 | Ga0395898_0081109 | 3300037466 | Bacteria | 3128 |
| 374 | Ga0395898_0102815 | 3300037466 | Bacteria | 2742 |
| 375 | Ga0395905_0000383 | 3300037471 | Bacteria | 63049 |
| 376 | Ga0395905_0001767 | 3300037471 | Bacteria | 25119 |
| 377 | Ga0395905_0008418 | 3300037471 | Bacteria | 10172 |
| 378 | Ga0395905_0030404 | 3300037471 | Bacteria | 5088 |
| 379 | Ga0395905_0042471 | 3300037471 | Bacteria | 4267 |
| 380 | Ga0395905_0092502 | 3300037471 | Bacteria | 2836 |
| 381 | Ga0395905_0136742 | 3300037471 | Bacteria | 2305 |
| 382 | Ga0395905_0372652 | 3300037471 | Bacteria | 1321 |
| 383 | Ga0436364_0762641 | 3300037853 | Bacteria | 4483 |
| 384 | Ga0395901_0000677 | 3300038443 | Bacteria | 39201 |
| 385 | Ga0395901_0009378 | 3300038443 | Bacteria | 9929 |
| 386 | Ga0395901_0019875 | 3300038443 | Bacteria | 6871 |
| 387 | Ga0395901_0034177 | 3300038443 | Bacteria | 5250 |
| 388 | Ga0395901_0189112 | 3300038443 | Bacteria | 2159 |
| 389 | Ga0436365_0062931 | 3300039437 | Bacteria | 52276 |
| 390 | Ga0436365_1930349 | 3300039437 | Bacteria | 1877 |
| 391 | Ga0436360_1073470 | 3300039438 | Bacteria | 1198 |
| 392 | Ga0436361_0104300 | 3300039447 | Bacteria | 1850 |
| 393 | Ga0436361_0948160 | 3300039447 | Bacteria | 2283 |
| 394 | Ga0436363_0952301 | 3300039450 | Bacteria | 1863 |
| 395 | Ga0436363_1380449 | 3300039450 | Bacteria | 2250 |
| 396 | Ga0436362_1100432 | 3300039453 | Bacteria | 3053 |
| 397 | Ga0439439_0015276 | 3300041406 | Bacteria | 1873 |
| 398 | Ga0439465_0001389 | 3300041413 | Bacteria | 7815 |
| 399 | Ga0439431_0029890 | 3300041997 | Bacteria | 1347 |
| 400 | Ga0439443_009042 | 3300042003 | Bacteria | 1420 |
| 401 | Ga0439462_0000040 | 3300042015 | Bacteria | 18378 |
| 402 | Ga0450912_000279 | 3300042116 | Bacteria | 2298 |
| 403 | Ga0450890_002346 | 3300042127 | Bacteria | 2612 |
| 404 | Ga0450905_001489 | 3300042142 | Bacteria | 2984 |
| 405 | Ga0450889_000118 | 3300042144 | Bacteria | 7702 |
| 406 | Ga0439458_0039404 | 3300042157 | Bacteria | 1143 |
| 407 | Ga0450916_014631 | 3300042530 | Bacteria | 1024 |
| 408 | Ga0451577_0563933 | 3300042876 | Bacteria | 1034 |
| 409 | Ga0466969_0048896 | 3300044656 | Bacteria | 2089 |
| 410 | Ga0466966_0050738 | 3300044684 | Bacteria | 2638 |
| 411 | Ga0466966_0058910 | 3300044684 | Bacteria | 2426 |
| 412 | Ga0466961_0060231 | 3300044693 | Bacteria | 2414 |
| 413 | Ga0466963_0036969 | 3300044694 | Bacteria | 3187 |
| 414 | Ga0466964_0016713 | 3300044706 | Bacteria | 2803 |
| 415 | Ga0453684_0095603 | 3300044712 | Bacteria | 3651 |
| 416 | Ga0466968_0037641 | 3300044735 | Bacteria | 2030 |
| 417 | Ga0466960_0009474 | 3300044901 | Bacteria | 4015 |
| 418 | Ga0466959_0097897 | 3300045049 | Bacteria | 2101 |
| 419 | Ga0466959_0161958 | 3300045049 | Bacteria | 1572 |
| 420 | Ga0451576_0000165 | 3300045051 | Bacteria | 168085 |
| 421 | Ga0466967_0152540 | 3300045976 | Bacteria | 2161 |
| 422 | Ga0466967_0173868 | 3300045976 | Bacteria | 2028 |
| 423 | Ga0495617_009535 | 3300046452 | Bacteria | 3334 |
| 424 | Ga0495627_000343 | 3300046453 | Bacteria | 43819 |
| 425 | Ga0495627_000758 | 3300046453 | Bacteria | 24030 |
| 426 | Ga0495627_000866 | 3300046453 | Bacteria | 21479 |
| 427 | Ga0495638_0071013 | 3300046460 | Bacteria | 2130 |
| 428 | Ga0495638_0161132 | 3300046460 | Bacteria | 1294 |
| 429 | Ga0495650_0001475 | 3300046471 | Bacteria | 22567 |
| 430 | Ga0495585_0015400 | 3300046492 | Bacteria | 4445 |
| 431 | Ga0495585_0046074 | 3300046492 | Bacteria | 2433 |
| 432 | Ga0495596_0000008 | 3300046500 | Bacteria | 150860 |
| 433 | Ga0495596_0000327 | 3300046500 | Bacteria | 31040 |
| 434 | Ga0495583_0006140 | 3300046506 | Bacteria | 7920 |
| 435 | Ga0495583_0012582 | 3300046506 | Bacteria | 4778 |
| 436 | Ga0495606_0004417 | 3300046507 | Bacteria | 14070 |
| 437 | Ga0495606_0063080 | 3300046507 | Bacteria | 2363 |
| 438 | Ga0495610_0000033 | 3300046512 | Bacteria | 204151 |
| 439 | Ga0495610_0000102 | 3300046512 | Bacteria | 98985 |
| 440 | Ga0495610_0003683 | 3300046512 | Bacteria | 11767 |
| 441 | Ga0495610_0030999 | 3300046512 | Bacteria | 2794 |
| 442 | Ga0495610_0042164 | 3300046512 | Bacteria | 2285 |
| 443 | Ga0495620_0003606 | 3300046515 | Bacteria | 8843 |
| 444 | Ga0495620_0004429 | 3300046515 | Bacteria | 7921 |
| 445 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 446 | Ga0495632_0000309 | 3300046519 | Bacteria | 47211 |
| 447 | Ga0495632_0019364 | 3300046519 | Bacteria | 3710 |
| 448 | Ga0495632_0030860 | 3300046519 | Bacteria | 2777 |
| 449 | Ga0495637_0000336 | 3300046520 | Bacteria | 36345 |
| 450 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 451 | Ga0495643_0036528 | 3300046522 | Bacteria | 2698 |
| 452 | Ga0495648_0001966 | 3300046524 | Bacteria | 19538 |
| 453 | Ga0495648_0115966 | 3300046524 | Bacteria | 1448 |
| 454 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 455 | Ga0495663_0001279 | 3300046525 | Bacteria | 7996 |
| 456 | Ga0495663_0076834 | 3300046525 | Bacteria | 1070 |
| 457 | Ga0495663_0081609 | 3300046525 | Bacteria | 1042 |
| 458 | Ga0495642_0020513 | 3300046528 | Bacteria | 2596 |
| 459 | Ga0495654_0000338 | 3300046530 | Bacteria | 40946 |
| 460 | Ga0495654_0013829 | 3300046530 | Bacteria | 4308 |
| 461 | Ga0495598_0000389 | 3300046537 | Bacteria | 7879 |
| 462 | Ga0495609_0001350 | 3300046538 | Bacteria | 16547 |
| 463 | Ga0495621_0000046 | 3300046539 | Bacteria | 24616 |
| 464 | Ga0495621_0000155 | 3300046539 | Bacteria | 15073 |
| 465 | Ga0495622_0004163 | 3300046557 | Bacteria | 6749 |
| 466 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 467 | Ga0495633_0001239 | 3300046558 | Bacteria | 20410 |
| 468 | Ga0495633_0036004 | 3300046558 | Bacteria | 2373 |
| 469 | Ga0495633_0040131 | 3300046558 | Bacteria | 2232 |
| 470 | Ga0495633_0040597 | 3300046558 | Bacteria | 2216 |
| 471 | Ga0495633_0041511 | 3300046558 | Bacteria | 2187 |
| 472 | Ga0495668_0000234 | 3300046616 | Bacteria | 79147 |
| 473 | Ga0495668_0034103 | 3300046616 | Bacteria | 2857 |
| 474 | Ga0495668_0067204 | 3300046616 | Bacteria | 1972 |
| 475 | Ga0495668_0101325 | 3300046616 | Bacteria | 1575 |
| 476 | Ga0495625_0000195 | 3300046660 | Bacteria | 96493 |
| 477 | Ga0495625_0003997 | 3300046660 | Bacteria | 14120 |
| 478 | Ga0495625_0089771 | 3300046660 | Bacteria | 2127 |
| 479 | Ga0495625_0116751 | 3300046660 | Bacteria | 1820 |
| 480 | Ga0495625_0234944 | 3300046660 | Bacteria | 1196 |
| 481 | Ga0495661_0057940 | 3300046665 | Bacteria | 2310 |
| 482 | Ga0495661_0099521 | 3300046665 | Bacteria | 1639 |
| 483 | Ga0495669_0001507 | 3300046684 | Bacteria | 9603 |
| 484 | Ga0495669_0012075 | 3300046684 | Bacteria | 3671 |
| 485 | Ga0495670_0001100 | 3300046691 | Bacteria | 13127 |
| 486 | Ga0495670_0001709 | 3300046691 | Bacteria | 10800 |
| 487 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 488 | Ga0495649_0000048 | 3300046694 | Bacteria | 118180 |
| 489 | Ga0495672_0038836 | 3300047320 | Bacteria | 2900 |
| 490 | Ga0495677_0000666 | 3300047445 | Bacteria | 13874 |
| 491 | Ga0495677_0002552 | 3300047445 | Bacteria | 7121 |
| 492 | Ga0495677_0017188 | 3300047445 | Bacteria | 2622 |
| 493 | Ga0495673_0015339 | 3300047469 | Bacteria | 3950 |
| 494 | Ga0495673_0015686 | 3300047469 | Bacteria | 3897 |
| 495 | Ga0495681_0000046 | 3300047470 | Bacteria | 111547 |
| 496 | Ga0495681_0000822 | 3300047470 | Bacteria | 23924 |
| 497 | Ga0495681_0001754 | 3300047470 | Bacteria | 15983 |
| 498 | Ga0495686_0000074 | 3300047472 | Bacteria | 208094 |
| 499 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 500 | Ga0495686_0000300 | 3300047472 | Bacteria | 85146 |
| 501 | Ga0495615_0000232 | 3300048090 | Bacteria | 11661 |
| 502 | Ga0496100_0291857 | 3300048903 | Bacteria | 1218 |
| 503 | Ga0496101_0073764 | 3300048904 | Bacteria | 2507 |
| 504 | Ga0496102_0000372 | 3300048905 | Bacteria | 53776 |
| 505 | Ga0496102_0166786 | 3300048905 | Bacteria | 2072 |
| 506 | Ga0496102_0224540 | 3300048905 | Bacteria | 1771 |
| 507 | Ga0496103_0000021 | 3300048906 | Bacteria | 229062 |
| 508 | Ga0496103_0018538 | 3300048906 | Bacteria | 4175 |
| 509 | Ga0496104_0000128 | 3300048907 | Bacteria | 70094 |
| 510 | Ga0496104_0016430 | 3300048907 | Bacteria | 6723 |
| 511 | Ga0496105_0000064 | 3300048908 | Bacteria | 83935 |
| 512 | Ga0496105_0002811 | 3300048908 | Bacteria | 12727 |
| 513 | Ga0496105_0103444 | 3300048908 | Bacteria | 2352 |
| 514 | Ga0496106_0005351 | 3300048909 | Bacteria | 9498 |
| 515 | Ga0496107_0016462 | 3300048910 | Bacteria | 5193 |
| 516 | Ga0496107_0046884 | 3300048910 | Bacteria | 3111 |
| 517 | Ga0496108_0013648 | 3300048911 | Bacteria | 6632 |
| 518 | Ga0496109_0012198 | 3300048912 | Bacteria | 7413 |
| 519 | Ga0496110_0069594 | 3300048913 | Bacteria | 3117 |
| 520 | Ga0496110_0183383 | 3300048913 | Bacteria | 1900 |
| 521 | Ga0496111_0021321 | 3300048914 | Bacteria | 4523 |
| 522 | Ga0496112_0011063 | 3300048915 | Bacteria | 8223 |
| 523 | Ga0496112_0024945 | 3300048915 | Bacteria | 5736 |
| 524 | Ga0496112_0087781 | 3300048915 | Bacteria | 3077 |
| 525 | Ga0496113_0000044 | 3300048916 | Bacteria | 51909 |
| 526 | Ga0496113_0001381 | 3300048916 | Bacteria | 13469 |
| 527 | Ga0496113_0001779 | 3300048916 | Bacteria | 12227 |
| 528 | Ga0496114_0010243 | 3300048917 | Bacteria | 7460 |
| 529 | Ga0496115_0062107 | 3300048918 | Bacteria | 3013 |
| 530 | Ga0496116_0000311 | 3300048919 | Bacteria | 81431 |
| 531 | Ga0496116_0011397 | 3300048919 | Bacteria | 7365 |
| 532 | Ga0496116_0036796 | 3300048919 | Bacteria | 3420 |
| 533 | Ga0496117_0001310 | 3300048920 | Bacteria | 36602 |
| 534 | Ga0496117_0034689 | 3300048920 | Bacteria | 3798 |
| 535 | Ga0496117_0072197 | 3300048920 | Bacteria | 2309 |
| 536 | Ga0496118_0003241 | 3300048921 | Bacteria | 20752 |
| 537 | Ga0496118_0039534 | 3300048921 | Bacteria | 3762 |
| 538 | Ga0496118_0057392 | 3300048921 | Bacteria | 2918 |
| 539 | Ga0496119_0000077 | 3300048922 | Bacteria | 143108 |
| 540 | Ga0496119_0061470 | 3300048922 | Bacteria | 2243 |
| 541 | Ga0496120_0001955 | 3300048923 | Bacteria | 22562 |
| 542 | Ga0496120_0009136 | 3300048923 | Bacteria | 7069 |
| 543 | Ga0496120_0108118 | 3300048923 | Bacteria | 1457 |
| 544 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 545 | Ga0496121_0000163 | 3300048924 | Bacteria | 145648 |
| 546 | Ga0496121_0000579 | 3300048924 | Bacteria | 68757 |
| 547 | Ga0496121_0001761 | 3300048924 | Bacteria | 35249 |
| 548 | Ga0496121_0004878 | 3300048924 | Bacteria | 17616 |
| 549 | Ga0496121_0044311 | 3300048924 | Bacteria | 3839 |
| 550 | Ga0496122_0001376 | 3300048925 | Bacteria | 39555 |
| 551 | Ga0496122_0004055 | 3300048925 | Bacteria | 18593 |
| 552 | Ga0496122_0008233 | 3300048925 | Bacteria | 11319 |
| 553 | Ga0496122_0047242 | 3300048925 | Bacteria | 3325 |
| 554 | Ga0496123_0000159 | 3300048926 | Bacteria | 136014 |
| 555 | Ga0496123_0001103 | 3300048926 | Bacteria | 40498 |
| 556 | Ga0496123_0007702 | 3300048926 | Bacteria | 10058 |
| 557 | Ga0496123_0014924 | 3300048926 | Bacteria | 6404 |
| 558 | Ga0496123_0038354 | 3300048926 | Bacteria | 3369 |
| 559 | Ga0496124_0001269 | 3300048927 | Bacteria | 38422 |
| 560 | Ga0496124_0002565 | 3300048927 | Bacteria | 23554 |
| 561 | Ga0496124_0004409 | 3300048927 | Bacteria | 16420 |
| 562 | Ga0496124_0006112 | 3300048927 | Bacteria | 13232 |
| 563 | Ga0496124_0098161 | 3300048927 | Bacteria | 2377 |
| 564 | Ga0496125_0001135 | 3300048928 | Bacteria | 40511 |
| 565 | Ga0496125_0023808 | 3300048928 | Bacteria | 5644 |
| 566 | Ga0496125_0028226 | 3300048928 | Bacteria | 5074 |
| 567 | Ga0496125_0031544 | 3300048928 | Bacteria | 4721 |
| 568 | Ga0496125_0039372 | 3300048928 | Bacteria | 4072 |
| 569 | Ga0496125_0220746 | 3300048928 | Bacteria | 1222 |
| 570 | Ga0496126_0000077 | 3300048929 | Bacteria | 231592 |
| 571 | Ga0496126_0000175 | 3300048929 | Bacteria | 146389 |
| 572 | Ga0496126_0008934 | 3300048929 | Bacteria | 10730 |
| 573 | Ga0496126_0091122 | 3300048929 | Bacteria | 2681 |
| 574 | Ga0496126_0422819 | 3300048929 | Bacteria | 1077 |
| 575 | Ga0501031_0011757 | 3300049568 | Bacteria | 5710 |
| 576 | Ga0501031_0040798 | 3300049568 | Bacteria | 3030 |
| 577 | Ga0501032_0001597 | 3300049569 | Bacteria | 18067 |
| 578 | Ga0501033_0001163 | 3300049570 | Bacteria | 23809 |
| 579 | Ga0501034_0014162 | 3300049571 | Bacteria | 8220 |
| 580 | Ga0501034_0025872 | 3300049571 | Bacteria | 5976 |
| 581 | Ga0501034_0092581 | 3300049571 | Bacteria | 3020 |
| 582 | Ga0501034_0155601 | 3300049571 | Bacteria | 2260 |
| 583 | Ga0501036_0003242 | 3300049572 | Bacteria | 12968 |
| 584 | Ga0501036_0008683 | 3300049572 | Bacteria | 8337 |
| 585 | Ga0501037_0001626 | 3300049573 | Bacteria | 16328 |
| 586 | Ga0501037_0041271 | 3300049573 | Bacteria | 3393 |
| 587 | Ga0501038_0000515 | 3300049574 | Bacteria | 33962 |
| 588 | Ga0501038_0067296 | 3300049574 | Bacteria | 3048 |
| 589 | Ga0501039_0011288 | 3300049575 | Bacteria | 6806 |
| 590 | Ga0501039_0110356 | 3300049575 | Bacteria | 2150 |
| 591 | Ga0501043_0009654 | 3300049579 | Bacteria | 7564 |
| 592 | Ga0501043_0104281 | 3300049579 | Bacteria | 2228 |
| 593 | Ga0501047_0001382 | 3300049581 | Bacteria | 23829 |
| 594 | Ga0501047_0055898 | 3300049581 | Bacteria | 3816 |
| 595 | Ga0501047_0056089 | 3300049581 | Bacteria | 3809 |
| 596 | Ga0501047_0533600 | 3300049581 | Bacteria | 999 |
| 597 | Ga0501223_000111 | 3300049663 | Bacteria | 23444 |
| 598 | Ga0501224_000024 | 3300049664 | Bacteria | 61321 |
| 599 | Ga0501233_000668 | 3300049668 | Bacteria | 5622 |
| 600 | Ga0501225_0000017 | 3300049705 | Bacteria | 61517 |
| 601 | Ga0501225_0006380 | 3300049705 | Bacteria | 3442 |
| 602 | Ga0501234_001620 | 3300049707 | Bacteria | 3518 |
| 603 | Ga0501035_0002229 | 3300049822 | Bacteria | 19222 |
| 604 | Ga0501035_0031345 | 3300049822 | Bacteria | 4842 |
| 605 | Ga0501044_0001187 | 3300049823 | Bacteria | 30876 |
| 606 | Ga0501044_0003356 | 3300049823 | Bacteria | 18054 |
| 607 | Ga0501044_0018017 | 3300049823 | Bacteria | 7572 |
| 608 | Ga0501044_0148934 | 3300049823 | Bacteria | 2323 |
| 609 | Ga0501045_0031297 | 3300049824 | Bacteria | 3854 |
| 610 | Ga0501226_000072 | 3300049853 | Bacteria | 31259 |
| 611 | nmdc:mga03683_1556_c1 | 3300050489 | Bacteria | 6842 |
| 612 | nmdc:mga03683_2_c1 | 3300050489 | Bacteria | 289140 |
| 613 | nmdc:mga03n38_1398_c1 | 3300050490 | Bacteria | 6870 |
| 614 | nmdc:mga0k408_2794_c1 | 3300050493 | Bacteria | 9273 |
| 615 | nmdc:mga06z11_139_c1 | 3300050494 | Bacteria | 28685 |
| 616 | nmdc:mga06z11_47_c1 | 3300050494 | Bacteria | 51206 |
| 617 | nmdc:mga04h51_18_c1 | 3300050495 | Bacteria | 74460 |
| 618 | nmdc:mga04h51_457_c1 | 3300050495 | Bacteria | 9829 |
| 619 | nmdc:mga07m45_29_c1 | 3300050496 | Bacteria | 85597 |
| 620 | nmdc:mga08y16_44274_c1 | 3300050511 | Bacteria | 4663 |
| 621 | nmdc:mga0sz30_1416_c1 | 3300050516 | Bacteria | 7429 |
| 622 | nmdc:mga0sz30_23210_c1 | 3300050516 | Bacteria | 2522 |
| 623 | nmdc:mga0sz30_25665_c1 | 3300050516 | Bacteria | 2410 |
| 624 | Ga0500643_001548 | 3300053087 | Bacteria | 13030 |
| 625 | Ga0500643_001703 | 3300053087 | Bacteria | 12216 |
| 626 | Ga0500643_048207 | 3300053087 | Bacteria | 1226 |
| 627 | Ga0500644_0004795 | 3300053088 | Bacteria | 3397 |
| 628 | Ga0500646_0030201 | 3300053090 | Bacteria | 1486 |
| 629 | Ga0500641_0002791 | 3300053096 | Bacteria | 6185 |
| 630 | Ga0500592_006826 | 3300053116 | Bacteria | 1817 |
| 631 | Ga0500594_0002629 | 3300053118 | Bacteria | 3902 |
| 632 | Ga0500595_001869 | 3300053119 | Bacteria | 10863 |
| 633 | Ga0500607_000009 | 3300053121 | Bacteria | 125590 |
| 634 | Ga0500607_000183 | 3300053121 | Bacteria | 55765 |
| 635 | Ga0500608_000156 | 3300053122 | Bacteria | 28195 |
| 636 | Ga0500614_018666 | 3300053123 | Bacteria | 1580 |
| 637 | Ga0500618_005438 | 3300053125 | Bacteria | 3874 |
| 638 | Ga0500652_119345 | 3300053131 | Bacteria | 1102 |
| 639 | Ga0500559_0000831 | 3300053136 | Bacteria | 20004 |
| 640 | Ga0500559_0005849 | 3300053136 | Bacteria | 5607 |
| 641 | Ga0500559_0026122 | 3300053136 | Bacteria | 2486 |
| 642 | Ga0500564_000699 | 3300053138 | Bacteria | 10473 |
| 643 | Ga0500568_0002081 | 3300053139 | Bacteria | 12128 |
| 644 | Ga0500577_0029757 | 3300053142 | Bacteria | 1894 |
| 645 | Ga0500590_018774 | 3300053148 | Bacteria | 3581 |
| 646 | Ga0500604_0000583 | 3300053151 | Bacteria | 10047 |
| 647 | Ga0500622_0014826 | 3300053156 | Bacteria | 4178 |
| 648 | Ga0500622_0032680 | 3300053156 | Bacteria | 2728 |
| 649 | Ga0500624_000005 | 3300053157 | Bacteria | 187122 |
| 650 | Ga0500627_0000070 | 3300053158 | Bacteria | 41863 |
| 651 | Ga0500630_065682 | 3300053159 | Bacteria | 1726 |
| 652 | Ga0500637_0000610 | 3300053178 | Bacteria | 14099 |
| 653 | Ga0500567_043247 | 3300053723 | Bacteria | 2091 |
| 654 | Ga0500625_000021 | 3300053729 | Bacteria | 83503 |
| 655 | Ga0500645_001022 | 3300053730 | Bacteria | 15681 |
| 656 | Ga0500645_007475 | 3300053730 | Bacteria | 3802 |
| 657 | 2511129171 | 2510917021 | Bacteria | 5705459 |
| 658 | 2512645139 | 2512564014 | Bacteria | 4639632 |
| 659 | 2600203223 | 2599185354 | Bacteria | 4398675 |
| 660 | 2643819254 | 2643221560 | Bacteria | 4801179 |
| 661 | 2643835116 | 2643221563 | Bacteria | 4726935 |
| 662 | 2643948596 | 2643221588 | Bacteria | 3692460 |
| 663 | 2644056043 | 2643221608 | Bacteria | 4724829 |
| 664 | 2738711046 | 2738541275 | Bacteria | 4830863 |
| 665 | 2738849471 | 2738541301 | Bacteria | 4834102 |
| 666 | 2738865200 | 2738541304 | Bacteria | 4833665 |
| 667 | 2739297718 | 2738543022 | Bacteria | 4835059 |
| 668 | 2739359396 | 2738543033 | Bacteria | 4833336 |
| 669 | 2739649155 | 2739367664 | Bacteria | 4114334 |
| 670 | 2740027628 | 2739367865 | Bacteria | 4114482 |
| 671 | 2753766750 | 2751185897 | Bacteria | 5322941 |
| 672 | 2778125836 | 2775507255 | Bacteria | 3945731 |
| 673 | 2809063356 | 2808606401 | Bacteria | 4586670 |
| 674 | 2809079208 | 2808606404 | Bacteria | 4652788 |
| 675 | 2809083418 | 2808606405 | Bacteria | 4586632 |
| 676 | 2819552145 | 2818991438 | Bacteria | 5793701 |
| 677 | 2848297598 | 2848297114 | Bacteria | 3608511 |
| 678 | 2852655930 | 2852653556 | Bacteria | 4050083 |
| 679 | 2852683018 | 2852680915 | Bacteria | 4100189 |
| 680 | 2880520626 | 2880518877 | Bacteria | 5012590 |
| 681 | 2882807188 | 2882806704 | Bacteria | 3007728 |
| 682 | 2885432232 | 2885429604 | Bacteria | 3642894 |
| 683 | 2895885857 | 2895880812 | Bacteria | 11255272 |
| 684 | 2896185405 | 2896184354 | Bacteria | 3258548 |
| 685 | 2896255805 | 2896253425 | Bacteria | 3418029 |
| 686 | 2919712997 | 2919709256 | Bacteria | 4318106 |
| 687 | 2928029407 | 2928027323 | Bacteria | 4382488 |
| 688 | 2928103659 | 2928100450 | Bacteria | 4837635 |
| 689 | 2928961328 | 2928959182 | Bacteria | 4725774 |
| 690 | 2984556604 | 2984555340 | Bacteria | 4247089 |
| 691 | 2984565223 | 2984564862 | Bacteria | 4339992 |
| 692 | 2993356299 | 2993356040 | Bacteria | 4247105 |
| 693 | 3000866938 | 3000865235 | Bacteria | 3106258 |
| 694 | 8057105115 | 8057101203 | Bacteria | 5034064 |
| 695 | JGI24751J29686_10000251 | |||
| 696 | SwRhRL2b_contig_2665226 | |||
| 697 | JGI24741J21665_1006549 | |||
| 698 | JGI24752J21851_1001195 | |||
| 699 | JGI24737J22298_10003866 | |||
| 700 | JGI24737J22298_10045823 | |||
| 701 | JGI24034J26672_10003557 | |||
| 702 | JGI24751J29686_10012926 | |||
| 703 | JGI25150J39212_1000189 | |||
| 704 | JGI25153J46596_10000125 | |||
| 705 | Ga0055536_1000358 | |||
| 706 | Ga0055536_1000785 | |||
| 707 | Ga0055536_1001881 | |||
| 708 | Ga0055536_1004888 | |||
| 709 | Ga0055536_1027487 | |||
| 710 | Ga0055530_10000054 | |||
| 711 | Ga0055530_10006284 | |||
| 712 | Ga0055530_10008250 | |||
| 713 | Ga0055530_10016343 | |||
| 714 | Ga0055540_1004110 | |||
| 715 | Ga0055531_10000492 | |||
| 716 | Ga0055531_10002269 | |||
| 717 | Ga0055531_10003200 | |||
| 718 | Ga0055531_10010446 | |||
| 719 | Ga0055531_10014634 | |||
| 720 | Ga0055531_10014636 | |||
| 721 | Ga0055531_10043756 | |||
| 722 | Ga0065704_10070228 | |||
| 723 | Ga0065704_10095011 | |||
| 724 | Ga0065712_10074966 | |||
| 725 | Ga0065707_10133605 | |||
| 726 | Ga0070658_10000003 | |||
| 727 | Ga0070658_10029030 | |||
| 728 | Ga0070658_10090437 | |||
| 729 | Ga0070683_100095498 | |||
| 730 | Ga0070690_100022933 | |||
| 731 | Ga0070670_100043018 | |||
| 732 | Ga0070670_100057555 | |||
| 733 | Ga0070670_100082303 | |||
| 734 | Ga0070670_100251458 | |||
| 735 | Ga0070670_100456444 | |||
| 736 | Ga0070677_10001169 | |||
| 737 | Ga0070666_10053003 | |||
| 738 | Ga0070680_100010757 | |||
| 739 | Ga0070660_100000348 | |||
| 740 | Ga0070660_100030302 | |||
| 741 | Ga0070661_100000003 | |||
| 742 | Ga0070661_100132126 | |||
| 743 | Ga0070668_100091686 | |||
| 744 | Ga0070668_100131383 | |||
| 745 | Ga0070668_100331185 | |||
| 746 | Ga0070669_100000080 | |||
| 747 | Ga0070669_100000213 | |||
| 748 | Ga0070669_100000799 | |||
| 749 | Ga0070669_100027094 | |||
| 750 | Ga0070669_100108800 | |||
| 751 | Ga0070675_100095502 | |||
| 752 | Ga0070671_100000003 | |||
| 753 | Ga0070671_100002229 | |||
| 754 | Ga0070671_100007726 | |||
| 755 | Ga0070671_100016176 | |||
| 756 | Ga0070671_100034930 | |||
| 757 | Ga0070671_100048717 | |||
| 758 | Ga0070674_100269432 | |||
| 759 | Ga0070659_100000790 | |||
| 760 | Ga0070659_100009534 | |||
| 761 | Ga0070667_100000098 | |||
| 762 | Ga0070667_100003111 | |||
| 763 | Ga0070667_100005092 | |||
| 764 | Ga0070667_100241650 | |||
| 765 | Ga0070709_10009356 | |||
| 766 | Ga0070714_100000291 | |||
| 767 | Ga0070714_100003701 | |||
| 768 | Ga0070714_100013819 | |||
| 769 | Ga0070713_100042029 | |||
| 770 | Ga0070710_10000958 | |||
| 771 | Ga0070705_100142265 | |||
| 772 | Ga0070694_100057785 | |||
| 773 | Ga0070663_100006846 | |||
| 774 | Ga0070663_100020995 | |||
| 775 | Ga0070662_100003086 | |||
| 776 | Ga0070662_100090392 | |||
| 777 | Ga0070662_100136764 | |||
| 778 | Ga0070679_100000001 | |||
| 779 | Ga0070679_100024739 | |||
| 780 | Ga0070679_100117226 | |||
| 781 | Ga0070679_100154450 | |||
| 782 | Ga0070679_100182635 | |||
| 783 | Ga0068853_100009279 | |||
| 784 | Ga0068853_100089814 | |||
| 785 | Ga0068853_100138544 | |||
| 786 | Ga0068853_100218510 | |||
| 787 | Ga0070695_100127152 | |||
| 788 | Ga0070696_100000325 | |||
| 789 | Ga0070693_100056116 | |||
| 790 | Ga0070665_100000070 | |||
| 791 | Ga0070665_100007023 | |||
| 792 | Ga0070665_100039812 | |||
| 793 | Ga0070665_100042179 | |||
| 794 | Ga0070665_100054556 | |||
| 795 | Ga0070704_100363138 | |||
| 796 | Ga0068855_100001523 | |||
| 797 | Ga0068855_100226884 | |||
| 798 | Ga0068855_100311135 | |||
| 799 | Ga0070664_100005465 | |||
| 800 | Ga0070664_100181604 | |||
| 801 | Ga0070664_100209377 | |||
| 802 | Ga0068854_100001419 | |||
| 803 | Ga0068854_100224046 | |||
| 804 | Ga0068852_100123369 | |||
| 805 | Ga0068859_100025512 | |||
| 806 | Ga0068864_100003096 | |||
| 807 | Ga0068864_100014967 | |||
| 808 | Ga0068864_100017649 | |||
| 809 | Ga0068864_100032103 | |||
| 810 | Ga0068863_100000081 | |||
| 811 | Ga0068863_100030180 | |||
| 812 | Ga0068863_100040042 | |||
| 813 | Ga0068858_100000723 | |||
| 814 | Ga0068858_100017428 | |||
| 815 | Ga0068858_100024766 | |||
| 816 | Ga0068858_100039905 | |||
| 817 | Ga0068858_100062894 | |||
| 818 | Ga0068858_100079107 | |||
| 819 | Ga0068860_100000108 | |||
| 820 | Ga0068860_100000164 | |||
| 821 | Ga0068860_100004656 | |||
| 822 | Ga0068860_100028825 | |||
| 823 | Ga0068860_100034974 | |||
| 824 | Ga0068860_100065405 | |||
| 825 | Ga0068860_100210296 | |||
| 826 | Ga0068862_100027216 | |||
| 827 | Ga0068862_100048465 | |||
| 828 | Ga0081455_10000088 | |||
| 829 | Ga0081455_10002477 | |||
| 830 | Ga0081455_10042235 | |||
| 831 | Ga0075368_10008957 | |||
| 832 | Ga0075368_10016620 | |||
| 833 | Ga0075363_100061679 | |||
| 834 | Ga0075364_10131989 | |||
| 835 | Ga0075432_10004893 | |||
| 836 | Ga0070712_100008055 | |||
| 837 | Ga0075362_10000167 | |||
| 838 | Ga0075367_10012146 | |||
| 839 | Ga0075366_10015348 | |||
| 840 | Ga0075366_10053492 | |||
| 841 | Ga0075370_10014378 | |||
| 842 | Ga0075428_100120369 | |||
| 843 | Ga0075428_100272269 | |||
| 844 | Ga0075431_100004319 | |||
| 845 | Ga0097620_100025512 | |||
| 846 | Ga0079104_1020607 | |||
| 847 | Ga0105251_10000334 | |||
| 848 | Ga0105251_10011293 | |||
| 849 | Ga0111539_10166398 | |||
| 850 | Ga0105245_10121461 | |||
| 851 | Ga0105242_10089297 | |||
| 852 | Ga0105248_10000626 | |||
| 853 | Ga0105248_10023914 | |||
| 854 | Ga0105248_10065721 | |||
| 855 | Ga0105248_10067601 | |||
| 856 | Ga0105248_10107466 | |||
| 857 | Ga0105248_10201351 | |||
| 858 | Ga0105248_10211680 | |||
| 859 | Ga0105238_10029528 | |||
| 860 | Ga0105238_10378625 | |||
| 861 | Ga0105249_10017211 | |||
| 862 | Ga0105246_10000847 | |||
| 863 | Ga0157373_10049060 | |||
| 864 | Ga0157371_10020876 | |||
| 865 | Ga0157371_10152227 | |||
| 866 | Ga0157369_10004697 | |||
| 867 | Ga0157378_10005257 | |||
| 868 | Ga0163162_10014044 | |||
| 869 | Ga0163162_10029740 | |||
| 870 | Ga0163162_10087572 | |||
| 871 | Ga0163163_10168627 | |||
| 872 | Ga0163163_10251818 | |||
| 873 | Ga0157380_10012559 | |||
| 874 | Ga0163161_10002367 | |||
| 875 | Ga0163161_10013528 | |||
| 876 | Ga0163161_10056425 | |||
| 877 | Ga0163161_10472333 | |||
| 878 | Ga0206356_10400983 | |||
| 879 | Ga0206354_10564923 | |||
| 880 | Ga0206353_10226904 | |||
| 881 | Ga0213876_10000250 | |||
| 882 | Ga0213875_10000636 | |||
| 883 | Ga0209147_102039 | |||
| 884 | Ga0207425_1000005 | |||
| 885 | Ga0209129_1000345 | |||
| 886 | Ga0209675_1000131 | |||
| 887 | Ga0209676_1000084 | |||
| 888 | Ga0209676_1000563 | |||
| 889 | Ga0209676_1000729 | |||
| 890 | Ga0209676_1000746 | |||
| 891 | Ga0209676_1003606 | |||
| 892 | Ga0209676_1005902 | |||
| 893 | Ga0209676_1007451 | |||
| 894 | Ga0209676_1024915 | |||
| 895 | Ga0209025_1000855 | |||
| 896 | Ga0209025_1006315 | |||
| 897 | Ga0209758_1000002 | |||
| 898 | Ga0209050_1000001 | |||
| 899 | Ga0209050_1000113 | |||
| 900 | Ga0209050_1000127 | |||
| 901 | Ga0209050_1001889 | |||
| 902 | Ga0209050_1017377 | |||
| 903 | Ga0209051_1000297 | |||
| 904 | Ga0209257_1000083 | |||
| 905 | Ga0209257_1000090 | |||
| 906 | Ga0209257_1000126 | |||
| 907 | Ga0209257_1000330 | |||
| 908 | Ga0209257_1002675 | |||
| 909 | Ga0209257_1002709 | |||
| 910 | Ga0209257_1011185 | |||
| 911 | Ga0207697_10044592 | |||
| 912 | Ga0207713_1000987 | |||
| 913 | Ga0207692_10003524 | |||
| 914 | Ga0207688_10312704 | |||
| 915 | Ga0207647_10105058 | |||
| 916 | Ga0207699_10001263 | |||
| 917 | Ga0207705_10000005 | |||
| 918 | Ga0207705_10000009 | |||
| 919 | Ga0207705_10002096 | |||
| 920 | Ga0207705_10035024 | |||
| 921 | Ga0207705_10041008 | |||
| 922 | Ga0207707_10022373 | |||
| 923 | Ga0207693_10000563 | |||
| 924 | Ga0207660_10074130 | |||
| 925 | Ga0207657_10003426 | |||
| 926 | Ga0207657_10128246 | |||
| 927 | Ga0207649_10000016 | |||
| 928 | Ga0207652_10000002 | |||
| 929 | Ga0207652_10042502 | |||
| 930 | Ga0207652_10108590 | |||
| 931 | Ga0207652_10115415 | |||
| 932 | Ga0207646_10280474 | |||
| 933 | Ga0207681_10000037 | |||
| 934 | Ga0207681_10000049 | |||
| 935 | Ga0207681_10000490 | |||
| 936 | Ga0207681_10161455 | |||
| 937 | Ga0207681_10360815 | |||
| 938 | Ga0207694_10057217 | |||
| 939 | Ga0207650_10055502 | |||
| 940 | Ga0207650_10129271 | |||
| 941 | Ga0207664_10000306 | |||
| 942 | Ga0207664_10017649 | |||
| 943 | Ga0207664_10077257 | |||
| 944 | Ga0207644_10000004 | |||
| 945 | Ga0207644_10000052 | |||
| 946 | Ga0207644_10000327 | |||
| 947 | Ga0207644_10019022 | |||
| 948 | Ga0207644_10135939 | |||
| 949 | Ga0207690_10003688 | |||
| 950 | Ga0207690_10056969 | |||
| 951 | Ga0207706_10003818 | |||
| 952 | Ga0207706_10109535 | |||
| 953 | Ga0207686_10100089 | |||
| 954 | Ga0207670_10095231 | |||
| 955 | Ga0207665_10069002 | |||
| 956 | Ga0207711_10002900 | |||
| 957 | Ga0207711_10011668 | |||
| 958 | Ga0207711_10159687 | |||
| 959 | Ga0207711_10176355 | |||
| 960 | Ga0207679_10023064 | |||
| 961 | Ga0207679_10143572 | |||
| 962 | Ga0207679_10146155 | |||
| 963 | Ga0207667_10001114 | |||
| 964 | Ga0207667_10176845 | |||
| 965 | Ga0207667_10181945 | |||
| 966 | Ga0207667_10205597 | |||
| 967 | Ga0207712_10074955 | |||
| 968 | Ga0207668_10301368 | |||
| 969 | Ga0207640_10010814 | |||
| 970 | Ga0207640_10161344 | |||
| 971 | Ga0207658_10000359 | |||
| 972 | Ga0207658_10008019 | |||
| 973 | Ga0207658_10016310 | |||
| 974 | Ga0207658_10017616 | |||
| 975 | Ga0207658_10252926 | |||
| 976 | Ga0207703_10004091 | |||
| 977 | Ga0207703_10017501 | |||
| 978 | Ga0207703_10035845 | |||
| 979 | Ga0207703_10060315 | |||
| 980 | Ga0207639_10067320 | |||
| 981 | Ga0207639_10292338 | |||
| 982 | Ga0207678_10121781 | |||
| 983 | Ga0207641_10000182 | |||
| 984 | Ga0207641_10004589 | |||
| 985 | Ga0207641_10004606 | |||
| 986 | Ga0207641_10018961 | |||
| 987 | Ga0207641_10051708 | |||
| 988 | Ga0207676_10001834 | |||
| 989 | Ga0207676_10006981 | |||
| 990 | Ga0207676_10030235 | |||
| 991 | Ga0207676_10093111 | |||
| 992 | Ga0207674_10333943 | |||
| 993 | Ga0207675_100217217 | |||
| 994 | Ga0207683_10373898 | |||
| 995 | Ga0207698_10252813 | |||
| 996 | Ga0209983_1021833 | |||
| 997 | Ga0209813_10000014 | |||
| 998 | Ga0209974_10002253 | |||
| 999 | Ga0268266_10002260 | |||
| 1000 | Ga0268266_10003129 | |||
| 1001 | Ga0268266_10072060 | |||
| 1002 | Ga0268265_10029030 | |||
| 1003 | Ga0268264_10000126 | |||
| 1004 | Ga0268264_10000228 | |||
| 1005 | Ga0268264_10008642 | |||
| 1006 | Ga0268264_10086744 | |||
| 1007 | Ga0268264_10144596 | |||
| 1008 | Ga0268264_10169872 | |||
| 1009 | Ga0265327_10021805 | |||
| 1010 | Ga0307513_10021142 | |||
| 1011 | Ga0307513_10363304 | |||
| 1012 | Ga0307408_100038304 | |||
| 1013 | Ga0307408_100210822 | |||
| 1014 | Ga0265314_10071008 | |||
| 1015 | Ga0307405_10059522 | |||
| 1016 | Ga0307413_10002717 | |||
| 1017 | Ga0307413_10027374 | |||
| 1018 | Ga0307413_10080056 | |||
| 1019 | Ga0307413_10201270 | |||
| 1020 | Ga0307410_10013851 | |||
| 1021 | Ga0307410_10069597 | |||
| 1022 | Ga0307406_10002460 | |||
| 1023 | Ga0307406_10067956 | |||
| 1024 | Ga0307406_10104692 | |||
| 1025 | Ga0307406_10193563 | |||
| 1026 | Ga0307412_10001006 | |||
| 1027 | Ga0307412_10003087 | |||
| 1028 | Ga0307412_10005482 | |||
| 1029 | Ga0307412_10006239 | |||
| 1030 | Ga0307412_10008763 | |||
| 1031 | Ga0307412_10013499 | |||
| 1032 | Ga0307412_10122392 | |||
| 1033 | Ga0307409_100003480 | |||
| 1034 | Ga0307409_100042233 | |||
| 1035 | Ga0307409_100050221 | |||
| 1036 | Ga0307409_100122051 | |||
| 1037 | Ga0307416_100009876 | |||
| 1038 | Ga0307416_100119210 | |||
| 1039 | Ga0307416_100284140 | |||
| 1040 | Ga0307414_10000212 | |||
| 1041 | Ga0307414_10000463 | |||
| 1042 | Ga0307414_10000704 | |||
| 1043 | Ga0307414_10013269 | |||
| 1044 | Ga0307414_10039212 | |||
| 1045 | Ga0307414_10041487 | |||
| 1046 | Ga0307414_10053962 | |||
| 1047 | Ga0307414_10189068 | |||
| 1048 | Ga0307414_10220676 | |||
| 1049 | Ga0307414_10414689 | |||
| 1050 | Ga0307411_10010239 | |||
| 1051 | Ga0307411_10011224 | |||
| 1052 | Ga0307411_10432026 | |||
| 1053 | Ga0307415_100037173 | |||
| 1054 | Ga0307415_100056249 | |||
| 1055 | Ga0307415_100142495 | |||
| 1056 | Ga0307510_10000248 | |||
| 1057 | Ga0307510_10183926 | |||
| 1058 | Ga0395899_0028519 | |||
| 1059 | Ga0395899_0043223 | |||
| 1060 | Ga0395899_0084496 | |||
| 1061 | Ga0395900_0000731 | |||
| 1062 | Ga0395900_0011469 | |||
| 1063 | Ga0395900_0069109 | |||
| 1064 | Ga0395900_0076589 | |||
| 1065 | Ga0395900_0102837 | |||
| 1066 | Ga0395900_0237892 | |||
| 1067 | Ga0395898_0081109 | |||
| 1068 | Ga0395898_0102815 | |||
| 1069 | Ga0395905_0000383 | |||
| 1070 | Ga0395905_0001767 | |||
| 1071 | Ga0395905_0008418 | |||
| 1072 | Ga0395905_0030404 | |||
| 1073 | Ga0395905_0042471 | |||
| 1074 | Ga0395905_0092502 | |||
| 1075 | Ga0395905_0136742 | |||
| 1076 | Ga0395905_0372652 | |||
| 1077 | Ga0436364_0762641 | |||
| 1078 | Ga0395901_0000677 | |||
| 1079 | Ga0395901_0009378 | |||
| 1080 | Ga0395901_0019875 | |||
| 1081 | Ga0395901_0034177 | |||
| 1082 | Ga0395901_0189112 | |||
| 1083 | Ga0436365_0062931 | |||
| 1084 | Ga0436365_1930349 | |||
| 1085 | Ga0436360_1073470 | |||
| 1086 | Ga0436361_0104300 | |||
| 1087 | Ga0436361_0948160 | |||
| 1088 | Ga0436363_0952301 | |||
| 1089 | Ga0436363_1380449 | |||
| 1090 | Ga0436362_1100432 | |||
| 1091 | Ga0439439_0015276 | |||
| 1092 | Ga0439465_0001389 | |||
| 1093 | Ga0439431_0029890 | |||
| 1094 | Ga0439443_009042 | |||
| 1095 | Ga0439462_0000040 | |||
| 1096 | Ga0450912_000279 | |||
| 1097 | Ga0450890_002346 | |||
| 1098 | Ga0450905_001489 | |||
| 1099 | Ga0450889_000118 | |||
| 1100 | Ga0439458_0039404 | |||
| 1101 | Ga0450916_014631 | |||
| 1102 | Ga0451577_0563933 | |||
| 1103 | Ga0466969_0048896 | |||
| 1104 | Ga0466966_0050738 | |||
| 1105 | Ga0466966_0058910 | |||
| 1106 | Ga0466961_0060231 | |||
| 1107 | Ga0466963_0036969 | |||
| 1108 | Ga0466964_0016713 | |||
| 1109 | Ga0453684_0095603 | |||
| 1110 | Ga0466968_0037641 | |||
| 1111 | Ga0466960_0009474 | |||
| 1112 | Ga0466959_0097897 | |||
| 1113 | Ga0466959_0161958 | |||
| 1114 | Ga0451576_0000165 | |||
| 1115 | Ga0466967_0152540 | |||
| 1116 | Ga0466967_0173868 | |||
| 1117 | Ga0495617_009535 | |||
| 1118 | Ga0495627_000343 | |||
| 1119 | Ga0495627_000758 | |||
| 1120 | Ga0495627_000866 | |||
| 1121 | Ga0495638_0071013 | |||
| 1122 | Ga0495638_0161132 | |||
| 1123 | Ga0495650_0001475 | |||
| 1124 | Ga0495585_0015400 | |||
| 1125 | Ga0495585_0046074 | |||
| 1126 | Ga0495596_0000008 | |||
| 1127 | Ga0495596_0000327 | |||
| 1128 | Ga0495583_0006140 | |||
| 1129 | Ga0495583_0012582 | |||
| 1130 | Ga0495606_0004417 | |||
| 1131 | Ga0495606_0063080 | |||
| 1132 | Ga0495610_0000033 | |||
| 1133 | Ga0495610_0000102 | |||
| 1134 | Ga0495610_0003683 | |||
| 1135 | Ga0495610_0030999 | |||
| 1136 | Ga0495610_0042164 | |||
| 1137 | Ga0495620_0003606 | |||
| 1138 | Ga0495620_0004429 | |||
| 1139 | Ga0495632_0000013 | |||
| 1140 | Ga0495632_0000309 | |||
| 1141 | Ga0495632_0019364 | |||
| 1142 | Ga0495632_0030860 | |||
| 1143 | Ga0495637_0000336 | |||
| 1144 | Ga0495643_0000010 | |||
| 1145 | Ga0495643_0036528 | |||
| 1146 | Ga0495648_0001966 | |||
| 1147 | Ga0495648_0115966 | |||
| 1148 | Ga0495663_0000004 | |||
| 1149 | Ga0495663_0001279 | |||
| 1150 | Ga0495663_0076834 | |||
| 1151 | Ga0495663_0081609 | |||
| 1152 | Ga0495642_0020513 | |||
| 1153 | Ga0495654_0000338 | |||
| 1154 | Ga0495654_0013829 | |||
| 1155 | Ga0495598_0000389 | |||
| 1156 | Ga0495609_0001350 | |||
| 1157 | Ga0495621_0000046 | |||
| 1158 | Ga0495621_0000155 | |||
| 1159 | Ga0495622_0004163 | |||
| 1160 | Ga0495633_0000092 | |||
| 1161 | Ga0495633_0001239 | |||
| 1162 | Ga0495633_0036004 | |||
| 1163 | Ga0495633_0040131 | |||
| 1164 | Ga0495633_0040597 | |||
| 1165 | Ga0495633_0041511 | |||
| 1166 | Ga0495668_0000234 | |||
| 1167 | Ga0495668_0034103 | |||
| 1168 | Ga0495668_0067204 | |||
| 1169 | Ga0495668_0101325 | |||
| 1170 | Ga0495625_0000195 | |||
| 1171 | Ga0495625_0003997 | |||
| 1172 | Ga0495625_0089771 | |||
| 1173 | Ga0495625_0116751 | |||
| 1174 | Ga0495625_0234944 | |||
| 1175 | Ga0495661_0057940 | |||
| 1176 | Ga0495661_0099521 | |||
| 1177 | Ga0495669_0001507 | |||
| 1178 | Ga0495669_0012075 | |||
| 1179 | Ga0495670_0001100 | |||
| 1180 | Ga0495670_0001709 | |||
| 1181 | Ga0495671_0000014 | |||
| 1182 | Ga0495649_0000048 | |||
| 1183 | Ga0495672_0038836 | |||
| 1184 | Ga0495677_0000666 | |||
| 1185 | Ga0495677_0002552 | |||
| 1186 | Ga0495677_0017188 | |||
| 1187 | Ga0495673_0015339 | |||
| 1188 | Ga0495673_0015686 | |||
| 1189 | Ga0495681_0000046 | |||
| 1190 | Ga0495681_0000822 | |||
| 1191 | Ga0495681_0001754 | |||
| 1192 | Ga0495686_0000074 | |||
| 1193 | Ga0495686_0000209 | |||
| 1194 | Ga0495686_0000300 | |||
| 1195 | Ga0495615_0000232 | |||
| 1196 | Ga0496100_0291857 | |||
| 1197 | Ga0496101_0073764 | |||
| 1198 | Ga0496102_0000372 | |||
| 1199 | Ga0496102_0166786 | |||
| 1200 | Ga0496102_0224540 | |||
| 1201 | Ga0496103_0000021 | |||
| 1202 | Ga0496103_0018538 | |||
| 1203 | Ga0496104_0000128 | |||
| 1204 | Ga0496104_0016430 | |||
| 1205 | Ga0496105_0000064 | |||
| 1206 | Ga0496105_0002811 | |||
| 1207 | Ga0496105_0103444 | |||
| 1208 | Ga0496106_0005351 | |||
| 1209 | Ga0496107_0016462 | |||
| 1210 | Ga0496107_0046884 | |||
| 1211 | Ga0496108_0013648 | |||
| 1212 | Ga0496109_0012198 | |||
| 1213 | Ga0496110_0069594 | |||
| 1214 | Ga0496110_0183383 | |||
| 1215 | Ga0496111_0021321 | |||
| 1216 | Ga0496112_0011063 | |||
| 1217 | Ga0496112_0024945 | |||
| 1218 | Ga0496112_0087781 | |||
| 1219 | Ga0496113_0000044 | |||
| 1220 | Ga0496113_0001381 | |||
| 1221 | Ga0496113_0001779 | |||
| 1222 | Ga0496114_0010243 | |||
| 1223 | Ga0496115_0062107 | |||
| 1224 | Ga0496116_0000311 | |||
| 1225 | Ga0496116_0011397 | |||
| 1226 | Ga0496116_0036796 | |||
| 1227 | Ga0496117_0001310 | |||
| 1228 | Ga0496117_0034689 | |||
| 1229 | Ga0496117_0072197 | |||
| 1230 | Ga0496118_0003241 | |||
| 1231 | Ga0496118_0039534 | |||
| 1232 | Ga0496118_0057392 | |||
| 1233 | Ga0496119_0000077 | |||
| 1234 | Ga0496119_0061470 | |||
| 1235 | Ga0496120_0001955 | |||
| 1236 | Ga0496120_0009136 | |||
| 1237 | Ga0496120_0108118 | |||
| 1238 | Ga0496121_0000070 | |||
| 1239 | Ga0496121_0000163 | |||
| 1240 | Ga0496121_0000579 | |||
| 1241 | Ga0496121_0001761 | |||
| 1242 | Ga0496121_0004878 | |||
| 1243 | Ga0496121_0044311 | |||
| 1244 | Ga0496122_0001376 | |||
| 1245 | Ga0496122_0004055 | |||
| 1246 | Ga0496122_0008233 | |||
| 1247 | Ga0496122_0047242 | |||
| 1248 | Ga0496123_0000159 | |||
| 1249 | Ga0496123_0001103 | |||
| 1250 | Ga0496123_0007702 | |||
| 1251 | Ga0496123_0014924 | |||
| 1252 | Ga0496123_0038354 | |||
| 1253 | Ga0496124_0001269 | |||
| 1254 | Ga0496124_0002565 | |||
| 1255 | Ga0496124_0004409 | |||
| 1256 | Ga0496124_0006112 | |||
| 1257 | Ga0496124_0098161 | |||
| 1258 | Ga0496125_0001135 | |||
| 1259 | Ga0496125_0023808 | |||
| 1260 | Ga0496125_0028226 | |||
| 1261 | Ga0496125_0031544 | |||
| 1262 | Ga0496125_0039372 | |||
| 1263 | Ga0496125_0220746 | |||
| 1264 | Ga0496126_0000077 | |||
| 1265 | Ga0496126_0000175 | |||
| 1266 | Ga0496126_0008934 | |||
| 1267 | Ga0496126_0091122 | |||
| 1268 | Ga0496126_0422819 | |||
| 1269 | Ga0501031_0011757 | |||
| 1270 | Ga0501031_0040798 | |||
| 1271 | Ga0501032_0001597 | |||
| 1272 | Ga0501033_0001163 | |||
| 1273 | Ga0501034_0014162 | |||
| 1274 | Ga0501034_0025872 | |||
| 1275 | Ga0501034_0092581 | |||
| 1276 | Ga0501034_0155601 | |||
| 1277 | Ga0501036_0003242 | |||
| 1278 | Ga0501036_0008683 | |||
| 1279 | Ga0501037_0001626 | |||
| 1280 | Ga0501037_0041271 | |||
| 1281 | Ga0501038_0000515 | |||
| 1282 | Ga0501038_0067296 | |||
| 1283 | Ga0501039_0011288 | |||
| 1284 | Ga0501039_0110356 | |||
| 1285 | Ga0501043_0009654 | |||
| 1286 | Ga0501043_0104281 | |||
| 1287 | Ga0501047_0001382 | |||
| 1288 | Ga0501047_0055898 | |||
| 1289 | Ga0501047_0056089 | |||
| 1290 | Ga0501047_0533600 | |||
| 1291 | Ga0501223_000111 | |||
| 1292 | Ga0501224_000024 | |||
| 1293 | Ga0501233_000668 | |||
| 1294 | Ga0501225_0000017 | |||
| 1295 | Ga0501225_0006380 | |||
| 1296 | Ga0501234_001620 | |||
| 1297 | Ga0501035_0002229 | |||
| 1298 | Ga0501035_0031345 | |||
| 1299 | Ga0501044_0001187 | |||
| 1300 | Ga0501044_0003356 | |||
| 1301 | Ga0501044_0018017 | |||
| 1302 | Ga0501044_0148934 | |||
| 1303 | Ga0501045_0031297 | |||
| 1304 | Ga0501226_000072 | |||
| 1305 | nmdc:mga03683_1556_c1 | |||
| 1306 | nmdc:mga03683_2_c1 | |||
| 1307 | nmdc:mga03n38_1398_c1 | |||
| 1308 | nmdc:mga0k408_2794_c1 | |||
| 1309 | nmdc:mga06z11_139_c1 | |||
| 1310 | nmdc:mga06z11_47_c1 | |||
| 1311 | nmdc:mga04h51_18_c1 | |||
| 1312 | nmdc:mga04h51_457_c1 | |||
| 1313 | nmdc:mga07m45_29_c1 | |||
| 1314 | nmdc:mga08y16_44274_c1 | |||
| 1315 | nmdc:mga0sz30_1416_c1 | |||
| 1316 | nmdc:mga0sz30_23210_c1 | |||
| 1317 | nmdc:mga0sz30_25665_c1 | |||
| 1318 | Ga0500643_001548 | |||
| 1319 | Ga0500643_001703 | |||
| 1320 | Ga0500643_048207 | |||
| 1321 | Ga0500644_0004795 | |||
| 1322 | Ga0500646_0030201 | |||
| 1323 | Ga0500641_0002791 | |||
| 1324 | Ga0500592_006826 | |||
| 1325 | Ga0500594_0002629 | |||
| 1326 | Ga0500595_001869 | |||
| 1327 | Ga0500607_000009 | |||
| 1328 | Ga0500607_000183 | |||
| 1329 | Ga0500608_000156 | |||
| 1330 | Ga0500614_018666 | |||
| 1331 | Ga0500618_005438 | |||
| 1332 | Ga0500652_119345 | |||
| 1333 | Ga0500559_0000831 | |||
| 1334 | Ga0500559_0005849 | |||
| 1335 | Ga0500559_0026122 | |||
| 1336 | Ga0500564_000699 | |||
| 1337 | Ga0500568_0002081 | |||
| 1338 | Ga0500577_0029757 | |||
| 1339 | Ga0500590_018774 | |||
| 1340 | Ga0500604_0000583 | |||
| 1341 | Ga0500622_0014826 | |||
| 1342 | Ga0500622_0032680 | |||
| 1343 | Ga0500624_000005 | |||
| 1344 | Ga0500627_0000070 | |||
| 1345 | Ga0500630_065682 | |||
| 1346 | Ga0500637_0000610 | |||
| 1347 | Ga0500567_043247 | |||
| 1348 | Ga0500625_000021 | |||
| 1349 | Ga0500645_001022 | |||
| 1350 | Ga0500645_007475 | |||
| 1351 | 2511129171 | |||
| 1352 | 2512645139 | |||
| 1353 | 2600203223 | |||
| 1354 | 2643819254 | |||
| 1355 | 2643835116 | |||
| 1356 | 2643948596 | |||
| 1357 | 2644056043 | |||
| 1358 | 2738711046 | |||
| 1359 | 2738849471 | |||
| 1360 | 2738865200 | |||
| 1361 | 2739297718 | |||
| 1362 | 2739359396 | |||
| 1363 | 2739649155 | |||
| 1364 | 2740027628 | |||
| 1365 | 2753766750 | |||
| 1366 | 2778125836 | |||
| 1367 | 2809063356 | |||
| 1368 | 2809079208 | |||
| 1369 | 2809083418 | |||
| 1370 | 2819552145 | |||
| 1371 | 2848297598 | |||
| 1372 | 2852655930 | |||
| 1373 | 2852683018 | |||
| 1374 | 2880520626 | |||
| 1375 | 2882807188 | |||
| 1376 | 2885432232 | |||
| 1377 | 2895885857 | |||
| 1378 | 2896185405 | |||
| 1379 | 2896255805 | |||
| 1380 | 2919712997 | |||
| 1381 | 2928029407 | |||
| 1382 | 2928103659 | |||
| 1383 | 2928961328 | |||
| 1384 | 2984556604 | |||
| 1385 | 2984565223 | |||
| 1386 | 2993356299 | |||
| 1387 | 3000866938 | |||
| 1388 | 8057105115 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k96-assembly1.cif.gz_B | 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii | 0.9403 | 5 | 307 |
| 1z82-assembly1.cif.gz_B | crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution | 0.9247 | 5 | 307 |
| 1n1e-assembly1.cif.gz_B | crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase complexed with dhap and nad | 0.9235 | 3 | 317 |
| 1n1e-assembly1.cif.gz_B | crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase complexed with dhap and nad | 0.9151 | 3 | 317 |
| 2q6u-assembly1.cif.gz_A | semet-substituted form of nikd | 0.9089 | 4 | 34 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN75_188_329_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9561 | 181 | 305 | 1.10.1040.10 |
| af_Q2FYG1_190_332_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.952 | 185 | 311 | 1.10.1040.10 |
| 3k96B02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9379 | 185 | 307 | 1.10.1040.10 |
| af_Q949Q0_74_275_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9335 | 5 | 181 | 3.40.50.720 |
| af_Q2FYG1_1_188_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9311 | 5 | 181 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2ECY1-F1-model_v4 | deleted | 0.9834 | 75 | 273 |
|
| AF-A0A845AUG6-F1-model_v4 | Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (NAD(P)(+)-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase) | 0.9821 | 1 | 317 |
GO:0005829
GO:0005975 GO:0006650 GO:0008654 GO:0046167 GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A845AUG6-F1-model_v4 | Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (NAD(P)(+)-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase) | 0.9791 | 1 | 317 |
GO:0005829
GO:0005975 GO:0006650 GO:0008654 GO:0046167 GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A4Q5T7B4-F1-model_v4 | Glycerol-3-phosphate dehydrogenase | 0.9786 | 4 | 177 |
GO:0005829
GO:0046168 GO:0047952 GO:0051287 |
| AF-A0A161GKJ7-F1-model_v4 | NADH-dependent glycerol-3-phosphate dehydrogenase | 0.9778 | 118 | 311 |
GO:0005829
GO:0005975 GO:0006072 GO:0008654 GO:0047952 |