F475696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 410 | 1388 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1000294|Ga0055524_100029444 |
| Length | 291 |
| Sequence | MRGTVCKGYATNRTLSMHRTGSSRADARARDLQRRRHPWSFCIHAMRIDVINPNTTATMTAAIGHAAQAVAAPGTRIVATQPSFGAPSIEGHHDEVWGAAGVTEQVRLGQAAGADAFVIACFGDPGLAAARELASGPVIGIAEAAFHCASMLATGFSVVTTLTRTCVIAEHLVVQYGFERTCRGIHGTDIAVLELEDPASDAYGRILASAREALARDRSGAIVLGCAGMADLCRRLQQALGVPVVDGVAAAVKLAESLVSLGLGTSKAGDYARPLPKAYAGLAAPFGPVAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 25 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 149 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 159 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 170 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 171 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 172 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 173 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 174 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 177 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 178 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 179 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 182 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 183 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 251 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 253 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 258 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 259 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 261 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 262 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 263 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 264 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 265 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 266 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 267 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 268 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 271 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 272 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 275 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 276 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 277 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 278 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 279 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 280 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 281 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 282 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 283 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 284 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 285 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 286 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 287 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 288 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 289 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 290 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 291 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 292 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 293 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 294 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 295 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 296 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 297 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 298 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 299 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 300 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 301 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 302 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 303 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 304 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 305 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 306 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 307 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 308 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 309 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 310 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 311 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 312 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 313 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 314 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 315 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 316 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 317 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 318 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 319 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 320 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 321 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 322 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 323 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 324 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 325 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 326 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 327 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 328 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 329 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 330 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 331 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 332 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 333 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 334 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 335 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 336 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 337 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 338 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 339 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 340 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 341 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 342 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 343 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 344 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 345 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 346 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 347 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 348 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 349 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 350 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 351 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 352 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 353 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 354 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 355 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 356 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 357 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 358 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 359 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 360 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 361 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 362 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 363 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 364 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 365 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 366 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 367 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 368 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 369 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 370 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 371 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 372 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 373 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 374 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 375 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 376 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 377 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 378 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 379 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 380 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 381 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 382 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 383 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 384 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 385 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 386 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 387 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 388 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 389 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 390 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 391 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 392 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 393 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 394 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 395 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 396 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 397 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 398 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 399 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 400 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 401 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 402 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 403 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 404 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 405 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 406 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 407 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 408 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 409 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 410 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.83 |
| Metatranscriptomes | 0.43 |
| Isolates | 19.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.58 |
| Bulb | 0.14 |
| Endosphere | 16.43 |
| Nodule | 1.73 |
| Rhizoplane | 8.36 |
| Rhizosphere | 48.7 |
| Stem | 0.14 |
| Stem Tuber | 0.43 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055524_1000294 | 3300003775 | Bacteria | 48038 |
| 2 | RicEn_C3495 | 2010549000 | Bacteria | 2386 |
| 3 | SwRhRL2b_contig_306743 | 2162886007 | Bacteria | 4252 |
| 4 | JGI24741J21665_1000336 | 3300001915 | Bacteria | 14055 |
| 5 | JGI24740J21852_10001604 | 3300001979 | Bacteria | 10392 |
| 6 | JGI24740J21852_10009850 | 3300001979 | Bacteria | 3714 |
| 7 | JGI24739J22299_10000114 | 3300001989 | Bacteria | 25102 |
| 8 | JGI25162J39368_1002152 | 3300002737 | Bacteria | 8240 |
| 9 | JGI25163J39215_1000173 | 3300002771 | Bacteria | 25169 |
| 10 | JGI25164J39214_1000066 | 3300002772 | Bacteria | 106367 |
| 11 | JGI25152J39213_1003922 | 3300002773 | Bacteria | 4877 |
| 12 | JGI25150J39212_1010208 | 3300002774 | Bacteria | 1754 |
| 13 | JGI25153J46596_10004528 | 3300003215 | Bacteria | 7476 |
| 14 | JGI25153J46596_10007742 | 3300003215 | Bacteria | 5228 |
| 15 | rootL2_10022785 | 3300003322 | Bacteria | 6083 |
| 16 | rootH1_10149035 | 3300003323 | Bacteria | 1765 |
| 17 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 18 | Ga0055538_1001269 | 3300003751 | Bacteria | 5169 |
| 19 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 20 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 21 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 22 | Ga0055533_1001648 | 3300003756 | Bacteria | 5742 |
| 23 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 24 | Ga0055525_1000794 | 3300003759 | Bacteria | 9973 |
| 25 | Ga0055526_1002654 | 3300003771 | Bacteria | 11944 |
| 26 | Ga0055530_10000963 | 3300003791 | Bacteria | 23351 |
| 27 | Ga0055540_1000028 | 3300003792 | Bacteria | 184864 |
| 28 | Ga0055531_10009192 | 3300003794 | Bacteria | 5087 |
| 29 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 30 | Ga0055541_1001207 | 3300003841 | Bacteria | 5742 |
| 31 | Ga0058692_1000069 | 3300003856 | Bacteria | 83842 |
| 32 | Ga0058692_1000203 | 3300003856 | Bacteria | 35711 |
| 33 | Ga0058692_1000665 | 3300003856 | Bacteria | 14161 |
| 34 | Ga0058692_1008309 | 3300003856 | Bacteria | 2682 |
| 35 | Ga0058692_1009885 | 3300003856 | Bacteria | 2384 |
| 36 | Ga0058692_1036770 | 3300003856 | Bacteria | 884 |
| 37 | Ga0065703_1018934 | 3300005272 | Bacteria | 5003 |
| 38 | Ga0065704_10001388 | 3300005289 | Bacteria | 16610 |
| 39 | Ga0070660_100196571 | 3300005339 | Bacteria | 1635 |
| 40 | Ga0070661_100000057 | 3300005344 | Bacteria | 87637 |
| 41 | Ga0070667_100313198 | 3300005367 | Bacteria | 1415 |
| 42 | Ga0070709_10365546 | 3300005434 | Bacteria | 1069 |
| 43 | Ga0070714_100014261 | 3300005435 | Bacteria | 6383 |
| 44 | Ga0070713_100028574 | 3300005436 | Bacteria | 4404 |
| 45 | Ga0070713_100172477 | 3300005436 | Bacteria | 1938 |
| 46 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 47 | Ga0070662_100024723 | 3300005457 | Bacteria | 4142 |
| 48 | Ga0068867_100698050 | 3300005459 | Bacteria | 895 |
| 49 | Ga0070706_100011977 | 3300005467 | Bacteria | 8048 |
| 50 | Ga0070707_100070549 | 3300005468 | Bacteria | 3365 |
| 51 | Ga0070698_100271659 | 3300005471 | Bacteria | 1627 |
| 52 | Ga0070699_100483500 | 3300005518 | Bacteria | 1124 |
| 53 | Ga0068853_100201049 | 3300005539 | Bacteria | 1813 |
| 54 | Ga0070665_100007940 | 3300005548 | Bacteria | 10759 |
| 55 | Ga0070665_100022447 | 3300005548 | Bacteria | 6351 |
| 56 | Ga0070665_100098496 | 3300005548 | Bacteria | 2928 |
| 57 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 58 | Ga0068857_100072457 | 3300005577 | Bacteria | 3070 |
| 59 | Ga0068857_100430678 | 3300005577 | Bacteria | 1231 |
| 60 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 61 | Ga0070702_100572467 | 3300005615 | Bacteria | 842 |
| 62 | Ga0068852_100436747 | 3300005616 | Bacteria | 1293 |
| 63 | Ga0068864_100012311 | 3300005618 | Bacteria | 7070 |
| 64 | Ga0068864_100432172 | 3300005618 | Unclassified | 1256 |
| 65 | Ga0068861_100974330 | 3300005719 | Bacteria | 808 |
| 66 | Ga0068863_100006252 | 3300005841 | Bacteria | 11696 |
| 67 | Ga0068860_100000240 | 3300005843 | Bacteria | 83866 |
| 68 | Ga0068860_100084454 | 3300005843 | Bacteria | 3021 |
| 69 | Ga0068860_100149442 | 3300005843 | Bacteria | 2249 |
| 70 | Ga0068860_100319321 | 3300005843 | Bacteria | 1524 |
| 71 | Ga0068860_100811608 | 3300005843 | Bacteria | 949 |
| 72 | Ga0068862_100433432 | 3300005844 | Bacteria | 1236 |
| 73 | Ga0081455_10031300 | 3300005937 | Bacteria | 4816 |
| 74 | Ga0081539_10000528 | 3300005985 | Bacteria | 79508 |
| 75 | Ga0075368_10029365 | 3300006042 | Bacteria | 2126 |
| 76 | Ga0075362_10137353 | 3300006177 | Bacteria | 1167 |
| 77 | Ga0075367_10001948 | 3300006178 | Bacteria | 9173 |
| 78 | Ga0075369_10003023 | 3300006186 | Bacteria | 6082 |
| 79 | Ga0075369_10115912 | 3300006186 | Bacteria | 1210 |
| 80 | Ga0075366_10001982 | 3300006195 | Bacteria | 10366 |
| 81 | Ga0075366_10011685 | 3300006195 | Bacteria | 4961 |
| 82 | Ga0075366_10034102 | 3300006195 | Bacteria | 2998 |
| 83 | Ga0075366_10044029 | 3300006195 | Bacteria | 2645 |
| 84 | Ga0075366_10048597 | 3300006195 | Bacteria | 2516 |
| 85 | Ga0075366_10092690 | 3300006195 | Bacteria | 1810 |
| 86 | Ga0075366_10115386 | 3300006195 | Bacteria | 1617 |
| 87 | Ga0075366_10232098 | 3300006195 | Bacteria | 1124 |
| 88 | Ga0075366_10272627 | 3300006195 | Bacteria | 1033 |
| 89 | Ga0075370_10001022 | 3300006353 | Bacteria | 11620 |
| 90 | Ga0075370_10004484 | 3300006353 | Bacteria | 6788 |
| 91 | Ga0075370_10007271 | 3300006353 | Bacteria | 5635 |
| 92 | Ga0075370_10009710 | 3300006353 | Bacteria | 5010 |
| 93 | Ga0075370_10029004 | 3300006353 | Bacteria | 3079 |
| 94 | Ga0075370_10077923 | 3300006353 | Bacteria | 1902 |
| 95 | Ga0075370_10113351 | 3300006353 | Bacteria | 1575 |
| 96 | Ga0075428_100471573 | 3300006844 | Bacteria | 1344 |
| 97 | Ga0075430_100254308 | 3300006846 | Bacteria | 1455 |
| 98 | Ga0075433_10148227 | 3300006852 | Bacteria | 2087 |
| 99 | Ga0079104_1000194 | 3300006946 | Bacteria | 85426 |
| 100 | Ga0079104_1000388 | 3300006946 | Bacteria | 51046 |
| 101 | Ga0079104_1001429 | 3300006946 | Bacteria | 16094 |
| 102 | Ga0079104_1001784 | 3300006946 | Bacteria | 13444 |
| 103 | Ga0105251_10000115 | 3300009011 | Bacteria | 80221 |
| 104 | Ga0105251_10000439 | 3300009011 | Bacteria | 40348 |
| 105 | Ga0105251_10000483 | 3300009011 | Bacteria | 37688 |
| 106 | Ga0105251_10001004 | 3300009011 | Bacteria | 24713 |
| 107 | Ga0105251_10001496 | 3300009011 | Bacteria | 20070 |
| 108 | Ga0105251_10006794 | 3300009011 | Bacteria | 7215 |
| 109 | Ga0105251_10042071 | 3300009011 | Bacteria | 2220 |
| 110 | Ga0105251_10056262 | 3300009011 | Bacteria | 1862 |
| 111 | Ga0105244_10000622 | 3300009036 | Bacteria | 31482 |
| 112 | Ga0105244_10001238 | 3300009036 | Bacteria | 20952 |
| 113 | Ga0105244_10001690 | 3300009036 | Bacteria | 17432 |
| 114 | Ga0105244_10002104 | 3300009036 | Bacteria | 15304 |
| 115 | Ga0105244_10002278 | 3300009036 | Bacteria | 14580 |
| 116 | Ga0105244_10006228 | 3300009036 | Bacteria | 7775 |
| 117 | Ga0105244_10020371 | 3300009036 | Bacteria | 3687 |
| 118 | Ga0105244_10023525 | 3300009036 | Bacteria | 3376 |
| 119 | Ga0105250_10000040 | 3300009092 | Bacteria | 133899 |
| 120 | Ga0105250_10001631 | 3300009092 | Bacteria | 11994 |
| 121 | Ga0105250_10008346 | 3300009092 | Bacteria | 4405 |
| 122 | Ga0105250_10027462 | 3300009092 | Bacteria | 2294 |
| 123 | Ga0105240_10318707 | 3300009093 | Bacteria | 1773 |
| 124 | Ga0105240_11047609 | 3300009093 | Bacteria | 870 |
| 125 | Ga0111539_10758118 | 3300009094 | Bacteria | 1130 |
| 126 | Ga0105247_10006154 | 3300009101 | Bacteria | 7456 |
| 127 | Ga0105243_10110238 | 3300009148 | Bacteria | 2301 |
| 128 | Ga0105243_10146432 | 3300009148 | Bacteria | 2021 |
| 129 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 130 | Ga0105248_10147100 | 3300009177 | Bacteria | 2659 |
| 131 | Ga0105237_10003312 | 3300009545 | Bacteria | 19195 |
| 132 | Ga0105249_10061510 | 3300009553 | Bacteria | 3446 |
| 133 | Ga0105246_10020497 | 3300011119 | Bacteria | 4241 |
| 134 | Ga0105246_10079150 | 3300011119 | Bacteria | 2336 |
| 135 | Ga0157373_10002213 | 3300013100 | Bacteria | 14720 |
| 136 | Ga0157373_10009569 | 3300013100 | Bacteria | 7155 |
| 137 | Ga0157373_10289894 | 3300013100 | Bacteria | 1161 |
| 138 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 139 | Ga0157371_10001080 | 3300013102 | Bacteria | 29511 |
| 140 | Ga0157371_10006758 | 3300013102 | Bacteria | 9378 |
| 141 | Ga0157371_10014113 | 3300013102 | Bacteria | 6042 |
| 142 | Ga0157371_10539069 | 3300013102 | Bacteria | 864 |
| 143 | Ga0157370_10000200 | 3300013104 | Bacteria | 75469 |
| 144 | Ga0157370_10001699 | 3300013104 | Bacteria | 27103 |
| 145 | Ga0157370_10066311 | 3300013104 | Bacteria | 3414 |
| 146 | Ga0157369_10000420 | 3300013105 | Bacteria | 56126 |
| 147 | Ga0157369_10027968 | 3300013105 | Bacteria | 6244 |
| 148 | Ga0157369_10366998 | 3300013105 | Bacteria | 1494 |
| 149 | Ga0157369_10587923 | 3300013105 | Bacteria | 1150 |
| 150 | Ga0163162_10217753 | 3300013306 | Bacteria | 2039 |
| 151 | Ga0163162_10364750 | 3300013306 | Bacteria | 1577 |
| 152 | Ga0157372_10018738 | 3300013307 | Bacteria | 7447 |
| 153 | Ga0157372_10028595 | 3300013307 | Bacteria | 6086 |
| 154 | Ga0157372_10033015 | 3300013307 | Bacteria | 5682 |
| 155 | Ga0157372_10060886 | 3300013307 | Bacteria | 4224 |
| 156 | Ga0157372_10117557 | 3300013307 | Bacteria | 3049 |
| 157 | Ga0157372_10117625 | 3300013307 | Bacteria | 3049 |
| 158 | Ga0157372_10490141 | 3300013307 | Bacteria | 1433 |
| 159 | Ga0157375_10061755 | 3300013308 | Bacteria | 3722 |
| 160 | Ga0157375_10102374 | 3300013308 | Bacteria | 2948 |
| 161 | Ga0163163_10135494 | 3300014325 | Unclassified | 2504 |
| 162 | Ga0157380_10495398 | 3300014326 | Bacteria | 1185 |
| 163 | Ga0182008_10000960 | 3300014497 | Bacteria | 20049 |
| 164 | Ga0182008_10061756 | 3300014497 | Bacteria | 1847 |
| 165 | Ga0157379_10080773 | 3300014968 | Bacteria | 2913 |
| 166 | Ga0157379_10534679 | 3300014968 | Bacteria | 1089 |
| 167 | Ga0182006_1008169 | 3300015261 | Bacteria | 4750 |
| 168 | Ga0163161_10000107 | 3300017792 | Bacteria | 78998 |
| 169 | Ga0197907_11371469 | 3300020069 | Bacteria | 2176 |
| 170 | Ga0206355_1535507 | 3300020076 | Bacteria | 1267 |
| 171 | Ga0213876_10000214 | 3300021384 | Bacteria | 58407 |
| 172 | Ga0209760_100005 | 3300025207 | Bacteria | 238315 |
| 173 | Ga0209760_102476 | 3300025207 | Bacteria | 1724 |
| 174 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 175 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 176 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 177 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 178 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 179 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 180 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 181 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 182 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 183 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 184 | Ga0209437_100199 | 3300025233 | Bacteria | 120313 |
| 185 | Ga0207425_1000238 | 3300025245 | Bacteria | 42734 |
| 186 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 187 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 188 | Ga0209759_1003952 | 3300025256 | Bacteria | 5703 |
| 189 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 190 | Ga0209129_1000221 | 3300025258 | Bacteria | 64902 |
| 191 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 192 | Ga0209758_1000126 | 3300025297 | Bacteria | 189761 |
| 193 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 194 | Ga0209050_1001372 | 3300025298 | Bacteria | 26579 |
| 195 | Ga0209050_1007618 | 3300025298 | Bacteria | 6012 |
| 196 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 197 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 198 | Ga0209051_1019429 | 3300025303 | Bacteria | 2963 |
| 199 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 200 | Ga0209257_1029323 | 3300025304 | Bacteria | 1794 |
| 201 | Ga0207696_1000026 | 3300025711 | Bacteria | 418166 |
| 202 | Ga0207696_1000033 | 3300025711 | Bacteria | 360689 |
| 203 | Ga0207696_1000077 | 3300025711 | Bacteria | 209611 |
| 204 | Ga0207696_1000723 | 3300025711 | Bacteria | 22209 |
| 205 | Ga0207696_1000885 | 3300025711 | Bacteria | 18669 |
| 206 | Ga0207696_1008410 | 3300025711 | Bacteria | 3949 |
| 207 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 208 | Ga0207655_1000040 | 3300025728 | Bacteria | 335311 |
| 209 | Ga0207655_1000210 | 3300025728 | Bacteria | 102315 |
| 210 | Ga0207655_1000683 | 3300025728 | Bacteria | 39498 |
| 211 | Ga0207655_1006158 | 3300025728 | Bacteria | 8001 |
| 212 | Ga0207655_1008020 | 3300025728 | Bacteria | 6770 |
| 213 | Ga0207655_1009495 | 3300025728 | Bacteria | 6030 |
| 214 | Ga0207655_1009627 | 3300025728 | Bacteria | 5980 |
| 215 | Ga0207655_1014240 | 3300025728 | Bacteria | 4509 |
| 216 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 217 | Ga0207713_1000040 | 3300025735 | Bacteria | 245322 |
| 218 | Ga0207713_1000065 | 3300025735 | Bacteria | 196128 |
| 219 | Ga0207713_1000147 | 3300025735 | Bacteria | 106198 |
| 220 | Ga0207713_1000554 | 3300025735 | Bacteria | 37287 |
| 221 | Ga0207713_1009276 | 3300025735 | Bacteria | 5570 |
| 222 | Ga0207713_1024757 | 3300025735 | Bacteria | 2789 |
| 223 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 224 | Ga0207699_10234693 | 3300025906 | Bacteria | 1258 |
| 225 | Ga0207645_10098491 | 3300025907 | Bacteria | 1885 |
| 226 | Ga0207684_10008362 | 3300025910 | Bacteria | 9200 |
| 227 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 228 | Ga0207695_10195284 | 3300025913 | Bacteria | 1940 |
| 229 | Ga0207671_10007383 | 3300025914 | Bacteria | 9546 |
| 230 | Ga0207649_10000334 | 3300025920 | Bacteria | 35813 |
| 231 | Ga0207700_10003125 | 3300025928 | Bacteria | 9563 |
| 232 | Ga0207700_10104859 | 3300025928 | Bacteria | 2263 |
| 233 | Ga0207706_10093566 | 3300025933 | Bacteria | 2643 |
| 234 | Ga0207709_10108164 | 3300025935 | Bacteria | 1853 |
| 235 | Ga0207711_10092639 | 3300025941 | Bacteria | 2660 |
| 236 | Ga0207689_10115026 | 3300025942 | Bacteria | 2211 |
| 237 | Ga0207661_10425300 | 3300025944 | Bacteria | 1207 |
| 238 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 239 | Ga0207712_10420532 | 3300025961 | Bacteria | 1127 |
| 240 | Ga0207658_10175131 | 3300025986 | Bacteria | 1771 |
| 241 | Ga0207677_10334422 | 3300026023 | Bacteria | 1263 |
| 242 | Ga0207703_10117439 | 3300026035 | Bacteria | 2279 |
| 243 | Ga0207703_10161742 | 3300026035 | Bacteria | 1961 |
| 244 | Ga0207639_10266038 | 3300026041 | Bacteria | 1502 |
| 245 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 246 | Ga0207678_10358609 | 3300026067 | Bacteria | 1258 |
| 247 | Ga0207702_10000024 | 3300026078 | Bacteria | 187719 |
| 248 | Ga0207641_10023218 | 3300026088 | Bacteria | 5111 |
| 249 | Ga0207648_10511541 | 3300026089 | Bacteria | 1099 |
| 250 | Ga0207676_10036602 | 3300026095 | Bacteria | 3735 |
| 251 | Ga0207674_10421760 | 3300026116 | Bacteria | 1289 |
| 252 | Ga0207675_100430033 | 3300026118 | Bacteria | 1305 |
| 253 | Ga0207675_100466172 | 3300026118 | Bacteria | 1254 |
| 254 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 255 | Ga0209281_1000083 | 3300027111 | Bacteria | 255034 |
| 256 | Ga0209281_1000093 | 3300027111 | Bacteria | 240724 |
| 257 | Ga0209281_1003968 | 3300027111 | Bacteria | 4592 |
| 258 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 259 | Ga0209371_1000026 | 3300027312 | Bacteria | 449205 |
| 260 | Ga0209371_1000081 | 3300027312 | Bacteria | 185440 |
| 261 | Ga0209371_1000140 | 3300027312 | Bacteria | 119103 |
| 262 | Ga0209371_1000175 | 3300027312 | Bacteria | 95796 |
| 263 | Ga0209371_1001555 | 3300027312 | Bacteria | 15130 |
| 264 | Ga0209371_1002251 | 3300027312 | Bacteria | 11097 |
| 265 | Ga0209371_1006379 | 3300027312 | Bacteria | 4378 |
| 266 | Ga0209371_1011028 | 3300027312 | Bacteria | 2718 |
| 267 | Ga0209371_1043932 | 3300027312 | Bacteria | 891 |
| 268 | Ga0207428_10304004 | 3300027907 | Bacteria | 1180 |
| 269 | Ga0268266_10065245 | 3300028379 | Bacteria | 3147 |
| 270 | Ga0268266_10192124 | 3300028379 | Bacteria | 1864 |
| 271 | Ga0268265_10365380 | 3300028380 | Bacteria | 1323 |
| 272 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 273 | Ga0268264_10246734 | 3300028381 | Bacteria | 1657 |
| 274 | Ga0307517_10004249 | 3300028786 | Bacteria | 22093 |
| 275 | Ga0307517_10153629 | 3300028786 | Bacteria | 1570 |
| 276 | Ga0307515_10007857 | 3300028794 | Bacteria | 20966 |
| 277 | Ga0307515_10016105 | 3300028794 | Bacteria | 13712 |
| 278 | Ga0307515_10069956 | 3300028794 | Bacteria | 4786 |
| 279 | Ga0307515_10092906 | 3300028794 | Bacteria | 3748 |
| 280 | Ga0307515_10208414 | 3300028794 | Bacteria | 1807 |
| 281 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 282 | Ga0268256_1000094 | 3300030500 | Bacteria | 140741 |
| 283 | Ga0268256_1000102 | 3300030500 | Bacteria | 129989 |
| 284 | Ga0268256_1000136 | 3300030500 | Bacteria | 101369 |
| 285 | Ga0268256_1000400 | 3300030500 | Bacteria | 39434 |
| 286 | Ga0268256_1001329 | 3300030500 | Bacteria | 15134 |
| 287 | Ga0268256_1001989 | 3300030500 | Bacteria | 11097 |
| 288 | Ga0268256_1011917 | 3300030500 | Bacteria | 2718 |
| 289 | Ga0268256_1014995 | 3300030500 | Bacteria | 2278 |
| 290 | Ga0268256_1025635 | 3300030500 | Bacteria | 1494 |
| 291 | Ga0307512_10054219 | 3300030522 | Bacteria | 3178 |
| 292 | Ga0307512_10076673 | 3300030522 | Bacteria | 2435 |
| 293 | Ga0265330_10002010 | 3300031235 | Bacteria | 11285 |
| 294 | Ga0265328_10033952 | 3300031239 | Bacteria | 1890 |
| 295 | Ga0265325_10140018 | 3300031241 | Bacteria | 1151 |
| 296 | Ga0265340_10006737 | 3300031247 | Bacteria | 6290 |
| 297 | Ga0265339_10048947 | 3300031249 | Bacteria | 2316 |
| 298 | Ga0307513_10010816 | 3300031456 | Bacteria | 11398 |
| 299 | Ga0307513_10064429 | 3300031456 | Bacteria | 3862 |
| 300 | Ga0307513_10092127 | 3300031456 | Bacteria | 3086 |
| 301 | Ga0307513_10256746 | 3300031456 | Bacteria | 1540 |
| 302 | Ga0307513_10272978 | 3300031456 | Bacteria | 1473 |
| 303 | Ga0307509_10001361 | 3300031507 | Bacteria | 41386 |
| 304 | Ga0307509_10089253 | 3300031507 | Bacteria | 3161 |
| 305 | Ga0307509_10104206 | 3300031507 | Bacteria | 2862 |
| 306 | Ga0307408_100285991 | 3300031548 | Bacteria | 1375 |
| 307 | Ga0307508_10000023 | 3300031616 | Bacteria | 177362 |
| 308 | Ga0307508_10001573 | 3300031616 | Bacteria | 25462 |
| 309 | Ga0307508_10061271 | 3300031616 | Bacteria | 3325 |
| 310 | Ga0307508_10091161 | 3300031616 | Bacteria | 2635 |
| 311 | Ga0307508_10216461 | 3300031616 | Bacteria | 1515 |
| 312 | Ga0307514_10033311 | 3300031649 | Bacteria | 4112 |
| 313 | Ga0307514_10048470 | 3300031649 | Bacteria | 3309 |
| 314 | Ga0307514_10231874 | 3300031649 | Bacteria | 1118 |
| 315 | Ga0307516_10013210 | 3300031730 | Bacteria | 8818 |
| 316 | Ga0307412_10470693 | 3300031911 | Bacteria | 1040 |
| 317 | Ga0307507_10063836 | 3300033179 | Bacteria | 3405 |
| 318 | Ga0307507_10318071 | 3300033179 | Bacteria | 939 |
| 319 | Ga0307510_10001484 | 3300033180 | Bacteria | 25882 |
| 320 | Ga0307510_10029737 | 3300033180 | Bacteria | 6210 |
| 321 | Ga0307510_10042584 | 3300033180 | Bacteria | 4946 |
| 322 | Ga0373937_0095407 | 3300036401 | Bacteria | 2758 |
| 323 | Ga0395900_0018700 | 3300037418 | Bacteria | 7066 |
| 324 | Ga0395905_0331421 | 3300037471 | Bacteria | 1412 |
| 325 | Ga0395905_0377597 | 3300037471 | Bacteria | 1311 |
| 326 | Ga0395901_0071423 | 3300038443 | Bacteria | 3618 |
| 327 | Ga0400483_082990 | 3300039062 | Bacteria | 17925 |
| 328 | Ga0436365_0065679 | 3300039437 | Bacteria | 4400 |
| 329 | Ga0436365_1279401 | 3300039437 | Bacteria | 294819 |
| 330 | Ga0439438_000177 | 3300041405 | Bacteria | 28540 |
| 331 | Ga0439447_003944 | 3300041407 | Bacteria | 5195 |
| 332 | Ga0439447_025932 | 3300041407 | Bacteria | 1506 |
| 333 | Ga0439466_0000032 | 3300041411 | Bacteria | 60696 |
| 334 | Ga0451841_0729203 | 3300041498 | Bacteria | 1325 |
| 335 | Ga0451853_3000726 | 3300041512 | Bacteria | 1443 |
| 336 | Ga0439432_002543 | 3300042006 | Bacteria | 6875 |
| 337 | Ga0439432_014373 | 3300042006 | Bacteria | 2680 |
| 338 | Ga0439432_021150 | 3300042006 | Bacteria | 2159 |
| 339 | Ga0439449_0054049 | 3300042007 | Bacteria | 1484 |
| 340 | Ga0439452_000017 | 3300042010 | Bacteria | 324897 |
| 341 | Ga0439452_000038 | 3300042010 | Bacteria | 149746 |
| 342 | Ga0439452_006035 | 3300042010 | Bacteria | 3832 |
| 343 | Ga0450919_001482 | 3300042121 | Bacteria | 3064 |
| 344 | Ga0450923_037140 | 3300042125 | Bacteria | 1013 |
| 345 | Ga0450907_001977 | 3300042146 | Bacteria | 4136 |
| 346 | Ga0439464_0007569 | 3300042439 | Bacteria | 2839 |
| 347 | Ga0450918_000218 | 3300042531 | Bacteria | 13121 |
| 348 | Ga0450893_0013015 | 3300042532 | Bacteria | 1384 |
| 349 | Ga0466986_0027770 | 3300044650 | Bacteria | 3813 |
| 350 | Ga0466969_0029264 | 3300044656 | Bacteria | 2813 |
| 351 | Ga0466972_0024943 | 3300044658 | Bacteria | 2966 |
| 352 | Ga0466966_0159536 | 3300044684 | Bacteria | 1373 |
| 353 | Ga0466961_0000955 | 3300044693 | Bacteria | 17875 |
| 354 | Ga0466961_0115747 | 3300044693 | Bacteria | 1685 |
| 355 | Ga0453684_0064148 | 3300044712 | Bacteria | 4694 |
| 356 | Ga0453684_0121301 | 3300044712 | Bacteria | 3155 |
| 357 | Ga0466959_0006078 | 3300045049 | Bacteria | 8331 |
| 358 | Ga0466959_0100291 | 3300045049 | Bacteria | 2073 |
| 359 | Ga0495627_000194 | 3300046453 | Bacteria | 66597 |
| 360 | Ga0495592_0000495 | 3300046454 | Bacteria | 28713 |
| 361 | Ga0495590_0037437 | 3300046457 | Bacteria | 1692 |
| 362 | Ga0495591_001140 | 3300046458 | Bacteria | 17490 |
| 363 | Ga0495638_0002788 | 3300046460 | Bacteria | 14030 |
| 364 | Ga0495638_0033538 | 3300046460 | Bacteria | 3284 |
| 365 | Ga0495650_0000386 | 3300046471 | Bacteria | 75722 |
| 366 | Ga0495650_0019141 | 3300046471 | Bacteria | 3381 |
| 367 | Ga0495585_0154604 | 3300046492 | Bacteria | 1194 |
| 368 | Ga0495620_0000814 | 3300046515 | Bacteria | 19207 |
| 369 | Ga0495620_0176383 | 3300046515 | Bacteria | 827 |
| 370 | Ga0495630_0026460 | 3300046517 | Bacteria | 4295 |
| 371 | Ga0495632_0024113 | 3300046519 | Bacteria | 3238 |
| 372 | Ga0495632_0061634 | 3300046519 | Bacteria | 1820 |
| 373 | Ga0495632_0093708 | 3300046519 | Bacteria | 1421 |
| 374 | Ga0495637_0057358 | 3300046520 | Bacteria | 1609 |
| 375 | Ga0495643_0075680 | 3300046522 | Bacteria | 1761 |
| 376 | Ga0495643_0106844 | 3300046522 | Bacteria | 1428 |
| 377 | Ga0495643_0113084 | 3300046522 | Bacteria | 1378 |
| 378 | Ga0495648_0012690 | 3300046524 | Bacteria | 6265 |
| 379 | Ga0495648_0068827 | 3300046524 | Bacteria | 2063 |
| 380 | Ga0495648_0080739 | 3300046524 | Bacteria | 1852 |
| 381 | Ga0495642_0212551 | 3300046528 | Bacteria | 844 |
| 382 | Ga0495654_0004782 | 3300046530 | Bacteria | 7964 |
| 383 | Ga0495654_0060778 | 3300046530 | Bacteria | 1815 |
| 384 | Ga0495587_0260459 | 3300046536 | Bacteria | 974 |
| 385 | Ga0495597_0048843 | 3300046542 | Bacteria | 1871 |
| 386 | Ga0495625_0001105 | 3300046660 | Bacteria | 35003 |
| 387 | Ga0495625_0004561 | 3300046660 | Bacteria | 13031 |
| 388 | Ga0495625_0056814 | 3300046660 | Bacteria | 2784 |
| 389 | Ga0495646_0217904 | 3300046680 | Bacteria | 1033 |
| 390 | Ga0495658_0050367 | 3300046683 | Bacteria | 2356 |
| 391 | Ga0495658_0195271 | 3300046683 | Bacteria | 1260 |
| 392 | Ga0495649_0000753 | 3300046694 | Bacteria | 26030 |
| 393 | Ga0495649_0009602 | 3300046694 | Bacteria | 5737 |
| 394 | Ga0495649_0118606 | 3300046694 | Bacteria | 1400 |
| 395 | Ga0495589_0000006 | 3300046794 | Bacteria | 303635 |
| 396 | Ga0495600_0348901 | 3300046809 | Bacteria | 927 |
| 397 | Ga0495660_0000168 | 3300046810 | Bacteria | 71020 |
| 398 | Ga0495672_0000061 | 3300047320 | Bacteria | 212024 |
| 399 | Ga0495676_0432061 | 3300047321 | Bacteria | 870 |
| 400 | Ga0495687_000292 | 3300047443 | Bacteria | 65859 |
| 401 | Ga0495679_000525 | 3300047446 | Bacteria | 27117 |
| 402 | Ga0495679_022195 | 3300047446 | Bacteria | 2176 |
| 403 | Ga0495626_0052133 | 3300048091 | Bacteria | 1886 |
| 404 | Ga0495626_0141506 | 3300048091 | Bacteria | 1020 |
| 405 | Ga0496100_0012039 | 3300048903 | Bacteria | 4946 |
| 406 | Ga0496102_0001535 | 3300048905 | Bacteria | 20378 |
| 407 | Ga0496102_0008488 | 3300048905 | Bacteria | 8806 |
| 408 | Ga0496102_0010392 | 3300048905 | Bacteria | 8011 |
| 409 | Ga0496104_0003670 | 3300048907 | Bacteria | 13255 |
| 410 | Ga0496104_0481841 | 3300048907 | Unclassified | 1152 |
| 411 | Ga0496105_0010300 | 3300048908 | Bacteria | 7349 |
| 412 | Ga0496105_0154675 | 3300048908 | Bacteria | 1884 |
| 413 | Ga0496114_0014236 | 3300048917 | Bacteria | 6381 |
| 414 | Ga0496114_0366024 | 3300048917 | Bacteria | 1276 |
| 415 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 416 | Ga0496116_0000170 | 3300048919 | Bacteria | 131308 |
| 417 | Ga0496116_0000320 | 3300048919 | Bacteria | 78683 |
| 418 | Ga0496116_0000483 | 3300048919 | Bacteria | 54791 |
| 419 | Ga0496116_0011470 | 3300048919 | Bacteria | 7327 |
| 420 | Ga0496116_0012357 | 3300048919 | Bacteria | 6980 |
| 421 | Ga0496116_0021410 | 3300048919 | Bacteria | 4879 |
| 422 | Ga0496116_0034723 | 3300048919 | Bacteria | 3552 |
| 423 | Ga0496116_0055910 | 3300048919 | Bacteria | 2589 |
| 424 | Ga0496116_0159046 | 3300048919 | Bacteria | 1242 |
| 425 | Ga0496117_0000199 | 3300048920 | Bacteria | 118320 |
| 426 | Ga0496117_0000241 | 3300048920 | Bacteria | 103487 |
| 427 | Ga0496117_0003831 | 3300048920 | Bacteria | 17103 |
| 428 | Ga0496117_0004471 | 3300048920 | Bacteria | 15390 |
| 429 | Ga0496117_0014277 | 3300048920 | Bacteria | 6853 |
| 430 | Ga0496117_0043150 | 3300048920 | Bacteria | 3282 |
| 431 | Ga0496117_0043319 | 3300048920 | Bacteria | 3273 |
| 432 | Ga0496117_0266881 | 3300048920 | Bacteria | 924 |
| 433 | Ga0496118_0001006 | 3300048921 | Bacteria | 43874 |
| 434 | Ga0496118_0001337 | 3300048921 | Bacteria | 37414 |
| 435 | Ga0496118_0001883 | 3300048921 | Bacteria | 29944 |
| 436 | Ga0496118_0002359 | 3300048921 | Bacteria | 25582 |
| 437 | Ga0496118_0004608 | 3300048921 | Bacteria | 16195 |
| 438 | Ga0496118_0013591 | 3300048921 | Bacteria | 7685 |
| 439 | Ga0496118_0042796 | 3300048921 | Bacteria | 3568 |
| 440 | Ga0496118_0049316 | 3300048921 | Bacteria | 3243 |
| 441 | Ga0496118_0054518 | 3300048921 | Bacteria | 3027 |
| 442 | Ga0496118_0072893 | 3300048921 | Bacteria | 2463 |
| 443 | Ga0496119_0000078 | 3300048922 | Bacteria | 140556 |
| 444 | Ga0496119_0000101 | 3300048922 | Bacteria | 124548 |
| 445 | Ga0496119_0000110 | 3300048922 | Bacteria | 115586 |
| 446 | Ga0496119_0001277 | 3300048922 | Bacteria | 31234 |
| 447 | Ga0496119_0005506 | 3300048922 | Bacteria | 12087 |
| 448 | Ga0496119_0006856 | 3300048922 | Bacteria | 10421 |
| 449 | Ga0496119_0026346 | 3300048922 | Bacteria | 4033 |
| 450 | Ga0496119_0046405 | 3300048922 | Bacteria | 2714 |
| 451 | Ga0496120_0000009 | 3300048923 | Bacteria | 386727 |
| 452 | Ga0496120_0000151 | 3300048923 | Bacteria | 115582 |
| 453 | Ga0496120_0000425 | 3300048923 | Bacteria | 67329 |
| 454 | Ga0496120_0000439 | 3300048923 | Bacteria | 65920 |
| 455 | Ga0496120_0005237 | 3300048923 | Bacteria | 10421 |
| 456 | Ga0496120_0006196 | 3300048923 | Bacteria | 9245 |
| 457 | Ga0496120_0006205 | 3300048923 | Bacteria | 9237 |
| 458 | Ga0496120_0014731 | 3300048923 | Bacteria | 5192 |
| 459 | Ga0496120_0027453 | 3300048923 | Bacteria | 3501 |
| 460 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 461 | Ga0496121_0005703 | 3300048924 | Bacteria | 15820 |
| 462 | Ga0496121_0010460 | 3300048924 | Bacteria | 10464 |
| 463 | Ga0496121_0333856 | 3300048924 | Bacteria | 1016 |
| 464 | Ga0496122_0000571 | 3300048925 | Bacteria | 75468 |
| 465 | Ga0496122_0001029 | 3300048925 | Bacteria | 49078 |
| 466 | Ga0496122_0001807 | 3300048925 | Bacteria | 32779 |
| 467 | Ga0496122_0021782 | 3300048925 | Bacteria | 5720 |
| 468 | Ga0496122_0057679 | 3300048925 | Bacteria | 2881 |
| 469 | Ga0496122_0084781 | 3300048925 | Bacteria | 2189 |
| 470 | Ga0496122_0279028 | 3300048925 | Bacteria | 914 |
| 471 | Ga0496123_0000430 | 3300048926 | Bacteria | 75549 |
| 472 | Ga0496123_0000841 | 3300048926 | Bacteria | 49062 |
| 473 | Ga0496123_0006614 | 3300048926 | Bacteria | 11193 |
| 474 | Ga0496123_0009674 | 3300048926 | Bacteria | 8645 |
| 475 | Ga0496123_0013355 | 3300048926 | Bacteria | 6903 |
| 476 | Ga0496123_0090417 | 3300048926 | Bacteria | 1820 |
| 477 | Ga0496123_0099371 | 3300048926 | Bacteria | 1698 |
| 478 | Ga0496124_0000307 | 3300048927 | Bacteria | 90604 |
| 479 | Ga0496124_0000474 | 3300048927 | Bacteria | 69115 |
| 480 | Ga0496124_0000914 | 3300048927 | Bacteria | 47689 |
| 481 | Ga0496124_0006220 | 3300048927 | Bacteria | 13078 |
| 482 | Ga0496124_0023069 | 3300048927 | Bacteria | 5692 |
| 483 | Ga0496124_0238384 | 3300048927 | Bacteria | 1354 |
| 484 | Ga0496124_0266032 | 3300048927 | Bacteria | 1258 |
| 485 | Ga0496125_0001606 | 3300048928 | Bacteria | 31934 |
| 486 | Ga0496125_0009042 | 3300048928 | Bacteria | 10315 |
| 487 | Ga0496125_0023589 | 3300048928 | Bacteria | 5675 |
| 488 | Ga0496125_0059914 | 3300048928 | Bacteria | 3063 |
| 489 | Ga0496125_0076988 | 3300048928 | Bacteria | 2573 |
| 490 | Ga0496125_0248233 | 3300048928 | Bacteria | 1125 |
| 491 | Ga0496126_0001894 | 3300048929 | Bacteria | 30181 |
| 492 | Ga0496126_0011347 | 3300048929 | Bacteria | 9237 |
| 493 | Ga0496126_0051547 | 3300048929 | Bacteria | 3745 |
| 494 | Ga0496126_0219075 | 3300048929 | Bacteria | 1599 |
| 495 | Ga0496126_0388122 | 3300048929 | Bacteria | 1135 |
| 496 | Ga0496126_0543880 | 3300048929 | Bacteria | 922 |
| 497 | Ga0501033_0172621 | 3300049570 | Bacteria | 1552 |
| 498 | Ga0501034_0022606 | 3300049571 | Bacteria | 6406 |
| 499 | Ga0501036_0017842 | 3300049572 | Bacteria | 5941 |
| 500 | Ga0501038_0025148 | 3300049574 | Bacteria | 5309 |
| 501 | Ga0501038_0136845 | 3300049574 | Bacteria | 2006 |
| 502 | Ga0501039_0210767 | 3300049575 | Bacteria | 1528 |
| 503 | Ga0501040_0000108 | 3300049576 | Bacteria | 42539 |
| 504 | Ga0501042_0001266 | 3300049578 | Bacteria | 14716 |
| 505 | Ga0501042_0018639 | 3300049578 | Bacteria | 4808 |
| 506 | Ga0501043_0045292 | 3300049579 | Bacteria | 3460 |
| 507 | Ga0501067_0050601 | 3300049583 | Bacteria | 2302 |
| 508 | Ga0501072_0313085 | 3300049588 | Bacteria | 1248 |
| 509 | Ga0501035_0014954 | 3300049822 | Bacteria | 7160 |
| 510 | Ga0501044_0006131 | 3300049823 | Bacteria | 13273 |
| 511 | nmdc:mga03n38_357047_c1 | 3300050490 | Bacteria | 796 |
| 512 | nmdc:mga00v17_108077_c1 | 3300050491 | Bacteria | 1762 |
| 513 | nmdc:mga0yw44_156306_c1 | 3300050492 | Bacteria | 1490 |
| 514 | nmdc:mga0k408_1632_c2 | 3300050493 | Bacteria | 8253 |
| 515 | nmdc:mga0k408_163847_c1 | 3300050493 | Bacteria | 1325 |
| 516 | nmdc:mga0k408_24327_c1 | 3300050493 | Bacteria | 3423 |
| 517 | nmdc:mga0k408_252_c1 | 3300050493 | Bacteria | 29077 |
| 518 | nmdc:mga0k408_262773_c1 | 3300050493 | Bacteria | 1031 |
| 519 | nmdc:mga0k408_297415_c1 | 3300050493 | Bacteria | 963 |
| 520 | nmdc:mga0k408_429870_c1 | 3300050493 | Bacteria | 785 |
| 521 | nmdc:mga0k408_81575_c1 | 3300050493 | Bacteria | 1482 |
| 522 | nmdc:mga06z11_164409_c1 | 3300050494 | Bacteria | 1270 |
| 523 | nmdc:mga06z11_17486_c1 | 3300050494 | Bacteria | 3256 |
| 524 | nmdc:mga06z11_350620_c1 | 3300050494 | Bacteria | 883 |
| 525 | nmdc:mga04h51_77832_c1 | 3300050495 | Bacteria | 1171 |
| 526 | nmdc:mga07m45_11263_c1 | 3300050496 | Bacteria | 4695 |
| 527 | nmdc:mga07m45_116065_c1 | 3300050496 | Bacteria | 1544 |
| 528 | nmdc:mga07m45_139708_c1 | 3300050496 | Bacteria | 1403 |
| 529 | nmdc:mga07m45_15790_c1 | 3300050496 | Bacteria | 4036 |
| 530 | nmdc:mga07m45_49575_c1 | 3300050496 | Bacteria | 2364 |
| 531 | nmdc:mga07m45_59785_c1 | 3300050496 | Bacteria | 2156 |
| 532 | nmdc:mga0qj67_317961_c1 | 3300050509 | Bacteria | 1260 |
| 533 | nmdc:mga06r32_377601_c1 | 3300050510 | Unclassified | 1400 |
| 534 | nmdc:mga0a205_128794_c1 | 3300050515 | Bacteria | 2431 |
| 535 | nmdc:mga0sz30_109435_c1 | 3300050516 | Bacteria | 1210 |
| 536 | nmdc:mga0sz30_23594_c1 | 3300050516 | Bacteria | 2505 |
| 537 | Ga0500578_0000040 | 3300053086 | Bacteria | 133601 |
| 538 | Ga0500578_0103699 | 3300053086 | Bacteria | 1798 |
| 539 | Ga0500644_0002701 | 3300053088 | Bacteria | 4429 |
| 540 | Ga0500646_0007126 | 3300053090 | Bacteria | 2851 |
| 541 | Ga0500651_0040785 | 3300053093 | Bacteria | 2925 |
| 542 | Ga0500651_0063931 | 3300053093 | Bacteria | 2295 |
| 543 | Ga0500593_004477 | 3300053117 | Bacteria | 5414 |
| 544 | Ga0500594_0000600 | 3300053118 | Bacteria | 7720 |
| 545 | Ga0500595_004643 | 3300053119 | Bacteria | 6122 |
| 546 | Ga0500595_013872 | 3300053119 | Bacteria | 3074 |
| 547 | Ga0500642_0003186 | 3300053130 | Bacteria | 4923 |
| 548 | Ga0500652_010708 | 3300053131 | Bacteria | 3153 |
| 549 | Ga0500559_0001133 | 3300053136 | Bacteria | 16045 |
| 550 | Ga0500604_0028126 | 3300053151 | Bacteria | 1631 |
| 551 | Ga0500619_000054 | 3300053154 | Bacteria | 34866 |
| 552 | Ga0500622_0000138 | 3300053156 | Bacteria | 77892 |
| 553 | Ga0500622_0139847 | 3300053156 | Bacteria | 1155 |
| 554 | Ga0500636_0101701 | 3300053177 | Bacteria | 1633 |
| 555 | Ga0587072_006503 | 3300059643 | Bacteria | 1783 |
| 556 | Ga0501082_0764445 | 3300060353 | Bacteria | 846 |
| 557 | Ga0530510_0531063 | 3300061734 | Bacteria | 893 |
| 558 | 2506576884 | 2506520007 | Bacteria | 5442880 |
| 559 | 2506582022 | 2506520008 | Bacteria | 5443009 |
| 560 | 2508850851 | 2508501071 | Bacteria | 5454741 |
| 561 | 2511380114 | 2511231025 | Bacteria | 5324661 |
| 562 | 2516088257 | 2515154203 | Bacteria | 5458536 |
| 563 | 2521560199 | 2521172590 | Bacteria | 5047645 |
| 564 | 2547697452 | 2547132181 | Bacteria | 4945084 |
| 565 | 2555260501 | 2554235234 | Bacteria | 5762085 |
| 566 | 2562466107 | 2561511199 | Bacteria | 5155034 |
| 567 | 2585829801 | 2585427591 | Bacteria | 5482980 |
| 568 | 2585833508 | 2585427592 | Bacteria | 5370892 |
| 569 | 2587725781 | 2585428057 | Bacteria | 6737412 |
| 570 | 2587735173 | 2585428058 | Bacteria | 6853932 |
| 571 | 2587758794 | 2585428062 | Bacteria | 6842168 |
| 572 | 2588290712 | 2588253510 | Bacteria | 6901809 |
| 573 | 2599409280 | 2599185169 | Bacteria | 5441380 |
| 574 | 2599444581 | 2599185178 | Bacteria | 5365746 |
| 575 | 2599926917 | 2599185299 | Bacteria | 4854625 |
| 576 | 2601522214 | 2600255254 | Bacteria | 5281859 |
| 577 | 2601527239 | 2600255255 | Bacteria | 5282785 |
| 578 | 2601536516 | 2600255256 | Bacteria | 5597742 |
| 579 | 2601541855 | 2600255257 | Bacteria | 5597196 |
| 580 | 2601614069 | 2600255280 | Bacteria | 5292309 |
| 581 | 2601618792 | 2600255281 | Bacteria | 5288753 |
| 582 | 2601642599 | 2600255287 | Bacteria | 5210468 |
| 583 | 2601647451 | 2600255288 | Bacteria | 5282738 |
| 584 | 2601652217 | 2600255289 | Bacteria | 5281907 |
| 585 | 2601657544 | 2600255290 | Bacteria | 5282218 |
| 586 | 2601662420 | 2600255291 | Bacteria | 5217298 |
| 587 | 2601695377 | 2600255298 | Bacteria | 5215185 |
| 588 | 2601700053 | 2600255299 | Bacteria | 5218662 |
| 589 | 2601705341 | 2600255300 | Bacteria | 5287774 |
| 590 | 2601710370 | 2600255301 | Bacteria | 5280532 |
| 591 | 2601715382 | 2600255302 | Bacteria | 5288235 |
| 592 | 2601720404 | 2600255303 | Bacteria | 5219315 |
| 593 | 2601725788 | 2600255304 | Bacteria | 5283973 |
| 594 | 2601730330 | 2600255305 | Bacteria | 5282329 |
| 595 | 2601735347 | 2600255306 | Bacteria | 5281613 |
| 596 | 2601740044 | 2600255307 | Bacteria | 5439064 |
| 597 | 2601750533 | 2600255309 | Bacteria | 5431045 |
| 598 | 2601760214 | 2600255310 | Bacteria | 5600903 |
| 599 | 2601765617 | 2600255311 | Bacteria | 5598766 |
| 600 | 2602017786 | 2600255392 | Bacteria | 5437392 |
| 601 | 2603638478 | 2602042046 | Bacteria | 5483348 |
| 602 | 2603659790 | 2602042052 | Bacteria | 5215873 |
| 603 | 2603665066 | 2602042053 | Bacteria | 5214361 |
| 604 | 2603837719 | 2602042103 | Bacteria | 5284714 |
| 605 | 2603842795 | 2602042104 | Bacteria | 5281639 |
| 606 | 2603847870 | 2602042105 | Bacteria | 5282303 |
| 607 | 2603852940 | 2602042106 | Bacteria | 5282744 |
| 608 | 2603866824 | 2602042109 | Bacteria | 5152801 |
| 609 | 2603870994 | 2602042110 | Bacteria | 5283285 |
| 610 | 2603875909 | 2602042111 | Bacteria | 5212080 |
| 611 | 2606048185 | 2603880178 | Bacteria | 5283018 |
| 612 | 2606069496 | 2603880184 | Bacteria | 5217896 |
| 613 | 2606145309 | 2603880202 | Bacteria | 5284684 |
| 614 | 2606175587 | 2603880211 | Bacteria | 5284226 |
| 615 | 2608668372 | 2608642108 | Bacteria | 4104624 |
| 616 | 2609912659 | 2609459761 | Bacteria | 5513740 |
| 617 | 2637225180 | 2636415599 | Bacteria | 5718434 |
| 618 | 2643770412 | 2643221550 | Bacteria | 4619371 |
| 619 | 2643972210 | 2643221592 | Bacteria | 6608788 |
| 620 | 2644049839 | 2643221607 | Bacteria | 6314006 |
| 621 | 2644131419 | 2643221623 | Bacteria | 5239945 |
| 622 | 2644141679 | 2643221625 | Bacteria | 6512927 |
| 623 | 2644202100 | 2643221636 | Bacteria | 6583769 |
| 624 | 2644247414 | 2643221644 | Bacteria | 6865017 |
| 625 | 2644275550 | 2643221648 | Bacteria | 6521465 |
| 626 | 2644338069 | 2643221660 | Bacteria | 4208257 |
| 627 | 2644482751 | 2643221686 | Bacteria | 6310811 |
| 628 | 2650897680 | 2648501693 | Bacteria | 5069560 |
| 629 | 2656279256 | 2654587920 | Bacteria | 5475511 |
| 630 | 2671107441 | 2667528173 | Bacteria | 5375747 |
| 631 | 2671589310 | 2671180115 | Bacteria | 5353919 |
| 632 | 2676406424 | 2675903046 | Bacteria | 5451247 |
| 633 | 2686355954 | 2684622997 | Bacteria | 4624240 |
| 634 | 2689443283 | 2687453601 | Bacteria | 5546041 |
| 635 | 2739309214 | 2738543024 | Bacteria | 5603683 |
| 636 | 2765571367 | 2765235838 | Bacteria | 5445269 |
| 637 | 2777023512 | 2775507074 | Bacteria | 5532402 |
| 638 | 2791922937 | 2791354903 | Bacteria | 4937680 |
| 639 | 2792313516 | 2791355010 | Bacteria | 4864581 |
| 640 | 2808943157 | 2808606379 | Bacteria | 5022697 |
| 641 | 2809124465 | 2808606414 | Bacteria | 4917181 |
| 642 | 2813729535 | 2811995292 | Bacteria | 5303342 |
| 643 | 2814697025 | 2814123068 | Bacteria | 5687681 |
| 644 | 2819616557 | 2818991449 | Bacteria | 5518009 |
| 645 | 2821271945 | 2821268502 | Bacteria | 3750023 |
| 646 | 2839099208 | 2839094727 | Bacteria | 5534556 |
| 647 | 2847088903 | 2847085930 | Bacteria | 5070450 |
| 648 | 2847801088 | 2847797336 | Bacteria | 5176640 |
| 649 | 2857578065 | 2857576091 | Bacteria | 5465855 |
| 650 | 2858466578 | 2858466076 | Bacteria | 4722413 |
| 651 | 2862293184 | 2862290372 | Bacteria | 7471434 |
| 652 | 2865018128 | 2865014394 | Bacteria | 4764573 |
| 653 | 2867350366 | 2867346516 | Bacteria | 7608576 |
| 654 | 2869552689 | 2869551831 | Bacteria | 5474685 |
| 655 | 2871273351 | 2871272651 | Bacteria | 5042015 |
| 656 | 2881612030 | 2881609920 | Bacteria | 4405319 |
| 657 | 2900054655 | 2900051742 | Bacteria | 4985156 |
| 658 | 2900581635 | 2900577576 | Bacteria | 5438534 |
| 659 | 2904440760 | 2904439833 | Bacteria | 5931679 |
| 660 | 2904476389 | 2904474040 | Bacteria | 5504324 |
| 661 | 2904506825 | 2904504865 | Bacteria | 5152820 |
| 662 | 2904513932 | 2904513164 | Bacteria | 5476410 |
| 663 | 2904535359 | 2904530477 | Bacteria | 5876334 |
| 664 | 2904588493 | 2904584206 | Bacteria | 6028872 |
| 665 | 2904594619 | 2904589729 | Bacteria | 6113573 |
| 666 | 2904605849 | 2904601388 | Bacteria | 5884906 |
| 667 | 2919048925 | 2919046199 | Bacteria | 5567169 |
| 668 | 2919084828 | 2919079590 | Bacteria | 5946433 |
| 669 | 2919112933 | 2919108558 | Bacteria | 5897419 |
| 670 | 2919152558 | 2919150387 | Bacteria | 5500879 |
| 671 | 2920760639 | 2920760137 | Bacteria | 7427611 |
| 672 | 2927145227 | 2927143783 | Bacteria | 5504251 |
| 673 | 2928062578 | 2928058823 | Bacteria | 5520022 |
| 674 | 2935629719 | 2935625433 | Bacteria | 5042964 |
| 675 | 2939622425 | 2939617950 | Bacteria | 4820956 |
| 676 | 2945879555 | 2945874760 | Bacteria | 5527237 |
| 677 | 2945954134 | 2945951305 | Bacteria | 4918162 |
| 678 | 2952255089 | 2952252522 | Bacteria | 4171745 |
| 679 | 2969082175 | 2969079654 | Bacteria | 5439582 |
| 680 | 2971824394 | 2971820967 | Bacteria | 5823634 |
| 681 | 2974437139 | 2974435778 | Bacteria | 4876478 |
| 682 | 2978976614 | 2978975091 | Bacteria | 4704313 |
| 683 | 2984495428 | 2984494565 | Bacteria | 5000175 |
| 684 | 2984564620 | 2984559226 | Bacteria | 5683096 |
| 685 | 2984597349 | 2984595703 | Bacteria | 5682994 |
| 686 | 2990265471 | 2990261002 | Bacteria | 4919493 |
| 687 | 3006497580 | 3006493962 | Bacteria | 8825450 |
| 688 | 640936436 | 640753048 | Bacteria | 5495657 |
| 689 | 8002289651 | 8002285264 | Bacteria | 6717907 |
| 690 | 8002291608 | 8002285264 | Bacteria | 6717907 |
| 691 | 8019509275 | 8019504834 | Bacteria | 4819156 |
| 692 | 8048136923 | 8048127548 | Bacteria | 11053136 |
| 693 | 8054849451 | 8054849141 | Bacteria | 5232694 |
| 694 | 8057306457 | 8057304971 | Bacteria | 4649742 |
| 695 | Ga0055524_1000294 | |||
| 696 | RicEn_C3495 | |||
| 697 | SwRhRL2b_contig_306743 | |||
| 698 | JGI24741J21665_1000336 | |||
| 699 | JGI24740J21852_10001604 | |||
| 700 | JGI24740J21852_10009850 | |||
| 701 | JGI24739J22299_10000114 | |||
| 702 | JGI25162J39368_1002152 | |||
| 703 | JGI25163J39215_1000173 | |||
| 704 | JGI25164J39214_1000066 | |||
| 705 | JGI25152J39213_1003922 | |||
| 706 | JGI25150J39212_1010208 | |||
| 707 | JGI25153J46596_10004528 | |||
| 708 | JGI25153J46596_10007742 | |||
| 709 | rootL2_10022785 | |||
| 710 | rootH1_10149035 | |||
| 711 | Ga0055538_1000003 | |||
| 712 | Ga0055538_1001269 | |||
| 713 | Ga0055539_1000003 | |||
| 714 | Ga0055539_1000123 | |||
| 715 | Ga0055533_1000005 | |||
| 716 | Ga0055533_1001648 | |||
| 717 | Ga0055525_1000005 | |||
| 718 | Ga0055525_1000794 | |||
| 719 | Ga0055526_1002654 | |||
| 720 | Ga0055530_10000963 | |||
| 721 | Ga0055540_1000028 | |||
| 722 | Ga0055531_10009192 | |||
| 723 | Ga0055541_1000003 | |||
| 724 | Ga0055541_1001207 | |||
| 725 | Ga0058692_1000069 | |||
| 726 | Ga0058692_1000203 | |||
| 727 | Ga0058692_1000665 | |||
| 728 | Ga0058692_1008309 | |||
| 729 | Ga0058692_1009885 | |||
| 730 | Ga0058692_1036770 | |||
| 731 | Ga0065703_1018934 | |||
| 732 | Ga0065704_10001388 | |||
| 733 | Ga0070660_100196571 | |||
| 734 | Ga0070661_100000057 | |||
| 735 | Ga0070667_100313198 | |||
| 736 | Ga0070709_10365546 | |||
| 737 | Ga0070714_100014261 | |||
| 738 | Ga0070713_100028574 | |||
| 739 | Ga0070713_100172477 | |||
| 740 | Ga0070663_100000011 | |||
| 741 | Ga0070662_100024723 | |||
| 742 | Ga0068867_100698050 | |||
| 743 | Ga0070706_100011977 | |||
| 744 | Ga0070707_100070549 | |||
| 745 | Ga0070698_100271659 | |||
| 746 | Ga0070699_100483500 | |||
| 747 | Ga0068853_100201049 | |||
| 748 | Ga0070665_100007940 | |||
| 749 | Ga0070665_100022447 | |||
| 750 | Ga0070665_100098496 | |||
| 751 | Ga0070664_100000008 | |||
| 752 | Ga0068857_100072457 | |||
| 753 | Ga0068857_100430678 | |||
| 754 | Ga0068856_100000009 | |||
| 755 | Ga0070702_100572467 | |||
| 756 | Ga0068852_100436747 | |||
| 757 | Ga0068864_100012311 | |||
| 758 | Ga0068864_100432172 | |||
| 759 | Ga0068861_100974330 | |||
| 760 | Ga0068863_100006252 | |||
| 761 | Ga0068860_100000240 | |||
| 762 | Ga0068860_100084454 | |||
| 763 | Ga0068860_100149442 | |||
| 764 | Ga0068860_100319321 | |||
| 765 | Ga0068860_100811608 | |||
| 766 | Ga0068862_100433432 | |||
| 767 | Ga0081455_10031300 | |||
| 768 | Ga0081539_10000528 | |||
| 769 | Ga0075368_10029365 | |||
| 770 | Ga0075362_10137353 | |||
| 771 | Ga0075367_10001948 | |||
| 772 | Ga0075369_10003023 | |||
| 773 | Ga0075369_10115912 | |||
| 774 | Ga0075366_10001982 | |||
| 775 | Ga0075366_10011685 | |||
| 776 | Ga0075366_10034102 | |||
| 777 | Ga0075366_10044029 | |||
| 778 | Ga0075366_10048597 | |||
| 779 | Ga0075366_10092690 | |||
| 780 | Ga0075366_10115386 | |||
| 781 | Ga0075366_10232098 | |||
| 782 | Ga0075366_10272627 | |||
| 783 | Ga0075370_10001022 | |||
| 784 | Ga0075370_10004484 | |||
| 785 | Ga0075370_10007271 | |||
| 786 | Ga0075370_10009710 | |||
| 787 | Ga0075370_10029004 | |||
| 788 | Ga0075370_10077923 | |||
| 789 | Ga0075370_10113351 | |||
| 790 | Ga0075428_100471573 | |||
| 791 | Ga0075430_100254308 | |||
| 792 | Ga0075433_10148227 | |||
| 793 | Ga0079104_1000194 | |||
| 794 | Ga0079104_1000388 | |||
| 795 | Ga0079104_1001429 | |||
| 796 | Ga0079104_1001784 | |||
| 797 | Ga0105251_10000115 | |||
| 798 | Ga0105251_10000439 | |||
| 799 | Ga0105251_10000483 | |||
| 800 | Ga0105251_10001004 | |||
| 801 | Ga0105251_10001496 | |||
| 802 | Ga0105251_10006794 | |||
| 803 | Ga0105251_10042071 | |||
| 804 | Ga0105251_10056262 | |||
| 805 | Ga0105244_10000622 | |||
| 806 | Ga0105244_10001238 | |||
| 807 | Ga0105244_10001690 | |||
| 808 | Ga0105244_10002104 | |||
| 809 | Ga0105244_10002278 | |||
| 810 | Ga0105244_10006228 | |||
| 811 | Ga0105244_10020371 | |||
| 812 | Ga0105244_10023525 | |||
| 813 | Ga0105250_10000040 | |||
| 814 | Ga0105250_10001631 | |||
| 815 | Ga0105250_10008346 | |||
| 816 | Ga0105250_10027462 | |||
| 817 | Ga0105240_10318707 | |||
| 818 | Ga0105240_11047609 | |||
| 819 | Ga0111539_10758118 | |||
| 820 | Ga0105247_10006154 | |||
| 821 | Ga0105243_10110238 | |||
| 822 | Ga0105243_10146432 | |||
| 823 | Ga0105241_10000004 | |||
| 824 | Ga0105248_10147100 | |||
| 825 | Ga0105237_10003312 | |||
| 826 | Ga0105249_10061510 | |||
| 827 | Ga0105246_10020497 | |||
| 828 | Ga0105246_10079150 | |||
| 829 | Ga0157373_10002213 | |||
| 830 | Ga0157373_10009569 | |||
| 831 | Ga0157373_10289894 | |||
| 832 | Ga0157371_10000068 | |||
| 833 | Ga0157371_10001080 | |||
| 834 | Ga0157371_10006758 | |||
| 835 | Ga0157371_10014113 | |||
| 836 | Ga0157371_10539069 | |||
| 837 | Ga0157370_10000200 | |||
| 838 | Ga0157370_10001699 | |||
| 839 | Ga0157370_10066311 | |||
| 840 | Ga0157369_10000420 | |||
| 841 | Ga0157369_10027968 | |||
| 842 | Ga0157369_10366998 | |||
| 843 | Ga0157369_10587923 | |||
| 844 | Ga0163162_10217753 | |||
| 845 | Ga0163162_10364750 | |||
| 846 | Ga0157372_10018738 | |||
| 847 | Ga0157372_10028595 | |||
| 848 | Ga0157372_10033015 | |||
| 849 | Ga0157372_10060886 | |||
| 850 | Ga0157372_10117557 | |||
| 851 | Ga0157372_10117625 | |||
| 852 | Ga0157372_10490141 | |||
| 853 | Ga0157375_10061755 | |||
| 854 | Ga0157375_10102374 | |||
| 855 | Ga0163163_10135494 | |||
| 856 | Ga0157380_10495398 | |||
| 857 | Ga0182008_10000960 | |||
| 858 | Ga0182008_10061756 | |||
| 859 | Ga0157379_10080773 | |||
| 860 | Ga0157379_10534679 | |||
| 861 | Ga0182006_1008169 | |||
| 862 | Ga0163161_10000107 | |||
| 863 | Ga0197907_11371469 | |||
| 864 | Ga0206355_1535507 | |||
| 865 | Ga0213876_10000214 | |||
| 866 | Ga0209760_100005 | |||
| 867 | Ga0209760_102476 | |||
| 868 | Ga0209784_100001 | |||
| 869 | Ga0209784_100003 | |||
| 870 | Ga0209566_100001 | |||
| 871 | Ga0209566_100002 | |||
| 872 | Ga0209674_100002 | |||
| 873 | Ga0209674_100008 | |||
| 874 | Ga0209563_100002 | |||
| 875 | Ga0209563_100004 | |||
| 876 | Ga0207427_100009 | |||
| 877 | Ga0209437_100001 | |||
| 878 | Ga0209437_100199 | |||
| 879 | Ga0207425_1000238 | |||
| 880 | Ga0209677_100002 | |||
| 881 | Ga0209677_100009 | |||
| 882 | Ga0209759_1003952 | |||
| 883 | Ga0209129_1000062 | |||
| 884 | Ga0209129_1000221 | |||
| 885 | Ga0209564_1000014 | |||
| 886 | Ga0209758_1000126 | |||
| 887 | Ga0209758_1000129 | |||
| 888 | Ga0209050_1001372 | |||
| 889 | Ga0209050_1007618 | |||
| 890 | Ga0209256_1000015 | |||
| 891 | Ga0209051_1000022 | |||
| 892 | Ga0209051_1019429 | |||
| 893 | Ga0209257_1000030 | |||
| 894 | Ga0209257_1029323 | |||
| 895 | Ga0207696_1000026 | |||
| 896 | Ga0207696_1000033 | |||
| 897 | Ga0207696_1000077 | |||
| 898 | Ga0207696_1000723 | |||
| 899 | Ga0207696_1000885 | |||
| 900 | Ga0207696_1008410 | |||
| 901 | Ga0207655_1000023 | |||
| 902 | Ga0207655_1000040 | |||
| 903 | Ga0207655_1000210 | |||
| 904 | Ga0207655_1000683 | |||
| 905 | Ga0207655_1006158 | |||
| 906 | Ga0207655_1008020 | |||
| 907 | Ga0207655_1009495 | |||
| 908 | Ga0207655_1009627 | |||
| 909 | Ga0207655_1014240 | |||
| 910 | Ga0207713_1000001 | |||
| 911 | Ga0207713_1000040 | |||
| 912 | Ga0207713_1000065 | |||
| 913 | Ga0207713_1000147 | |||
| 914 | Ga0207713_1000554 | |||
| 915 | Ga0207713_1009276 | |||
| 916 | Ga0207713_1024757 | |||
| 917 | Ga0207710_10000016 | |||
| 918 | Ga0207699_10234693 | |||
| 919 | Ga0207645_10098491 | |||
| 920 | Ga0207684_10008362 | |||
| 921 | Ga0207654_10000006 | |||
| 922 | Ga0207695_10195284 | |||
| 923 | Ga0207671_10007383 | |||
| 924 | Ga0207649_10000334 | |||
| 925 | Ga0207700_10003125 | |||
| 926 | Ga0207700_10104859 | |||
| 927 | Ga0207706_10093566 | |||
| 928 | Ga0207709_10108164 | |||
| 929 | Ga0207711_10092639 | |||
| 930 | Ga0207689_10115026 | |||
| 931 | Ga0207661_10425300 | |||
| 932 | Ga0207679_10000001 | |||
| 933 | Ga0207712_10420532 | |||
| 934 | Ga0207658_10175131 | |||
| 935 | Ga0207677_10334422 | |||
| 936 | Ga0207703_10117439 | |||
| 937 | Ga0207703_10161742 | |||
| 938 | Ga0207639_10266038 | |||
| 939 | Ga0207678_10000001 | |||
| 940 | Ga0207678_10358609 | |||
| 941 | Ga0207702_10000024 | |||
| 942 | Ga0207641_10023218 | |||
| 943 | Ga0207648_10511541 | |||
| 944 | Ga0207676_10036602 | |||
| 945 | Ga0207674_10421760 | |||
| 946 | Ga0207675_100430033 | |||
| 947 | Ga0207675_100466172 | |||
| 948 | Ga0209281_1000008 | |||
| 949 | Ga0209281_1000083 | |||
| 950 | Ga0209281_1000093 | |||
| 951 | Ga0209281_1003968 | |||
| 952 | Ga0209371_1000010 | |||
| 953 | Ga0209371_1000026 | |||
| 954 | Ga0209371_1000081 | |||
| 955 | Ga0209371_1000140 | |||
| 956 | Ga0209371_1000175 | |||
| 957 | Ga0209371_1001555 | |||
| 958 | Ga0209371_1002251 | |||
| 959 | Ga0209371_1006379 | |||
| 960 | Ga0209371_1011028 | |||
| 961 | Ga0209371_1043932 | |||
| 962 | Ga0207428_10304004 | |||
| 963 | Ga0268266_10065245 | |||
| 964 | Ga0268266_10192124 | |||
| 965 | Ga0268265_10365380 | |||
| 966 | Ga0268264_10000035 | |||
| 967 | Ga0268264_10246734 | |||
| 968 | Ga0307517_10004249 | |||
| 969 | Ga0307517_10153629 | |||
| 970 | Ga0307515_10007857 | |||
| 971 | Ga0307515_10016105 | |||
| 972 | Ga0307515_10069956 | |||
| 973 | Ga0307515_10092906 | |||
| 974 | Ga0307515_10208414 | |||
| 975 | Ga0268256_1000003 | |||
| 976 | Ga0268256_1000094 | |||
| 977 | Ga0268256_1000102 | |||
| 978 | Ga0268256_1000136 | |||
| 979 | Ga0268256_1000400 | |||
| 980 | Ga0268256_1001329 | |||
| 981 | Ga0268256_1001989 | |||
| 982 | Ga0268256_1011917 | |||
| 983 | Ga0268256_1014995 | |||
| 984 | Ga0268256_1025635 | |||
| 985 | Ga0307512_10054219 | |||
| 986 | Ga0307512_10076673 | |||
| 987 | Ga0265330_10002010 | |||
| 988 | Ga0265328_10033952 | |||
| 989 | Ga0265325_10140018 | |||
| 990 | Ga0265340_10006737 | |||
| 991 | Ga0265339_10048947 | |||
| 992 | Ga0307513_10010816 | |||
| 993 | Ga0307513_10064429 | |||
| 994 | Ga0307513_10092127 | |||
| 995 | Ga0307513_10256746 | |||
| 996 | Ga0307513_10272978 | |||
| 997 | Ga0307509_10001361 | |||
| 998 | Ga0307509_10089253 | |||
| 999 | Ga0307509_10104206 | |||
| 1000 | Ga0307408_100285991 | |||
| 1001 | Ga0307508_10000023 | |||
| 1002 | Ga0307508_10001573 | |||
| 1003 | Ga0307508_10061271 | |||
| 1004 | Ga0307508_10091161 | |||
| 1005 | Ga0307508_10216461 | |||
| 1006 | Ga0307514_10033311 | |||
| 1007 | Ga0307514_10048470 | |||
| 1008 | Ga0307514_10231874 | |||
| 1009 | Ga0307516_10013210 | |||
| 1010 | Ga0307412_10470693 | |||
| 1011 | Ga0307507_10063836 | |||
| 1012 | Ga0307507_10318071 | |||
| 1013 | Ga0307510_10001484 | |||
| 1014 | Ga0307510_10029737 | |||
| 1015 | Ga0307510_10042584 | |||
| 1016 | Ga0373937_0095407 | |||
| 1017 | Ga0395900_0018700 | |||
| 1018 | Ga0395905_0331421 | |||
| 1019 | Ga0395905_0377597 | |||
| 1020 | Ga0395901_0071423 | |||
| 1021 | Ga0400483_082990 | |||
| 1022 | Ga0436365_0065679 | |||
| 1023 | Ga0436365_1279401 | |||
| 1024 | Ga0439438_000177 | |||
| 1025 | Ga0439447_003944 | |||
| 1026 | Ga0439447_025932 | |||
| 1027 | Ga0439466_0000032 | |||
| 1028 | Ga0451841_0729203 | |||
| 1029 | Ga0451853_3000726 | |||
| 1030 | Ga0439432_002543 | |||
| 1031 | Ga0439432_014373 | |||
| 1032 | Ga0439432_021150 | |||
| 1033 | Ga0439449_0054049 | |||
| 1034 | Ga0439452_000017 | |||
| 1035 | Ga0439452_000038 | |||
| 1036 | Ga0439452_006035 | |||
| 1037 | Ga0450919_001482 | |||
| 1038 | Ga0450923_037140 | |||
| 1039 | Ga0450907_001977 | |||
| 1040 | Ga0439464_0007569 | |||
| 1041 | Ga0450918_000218 | |||
| 1042 | Ga0450893_0013015 | |||
| 1043 | Ga0466986_0027770 | |||
| 1044 | Ga0466969_0029264 | |||
| 1045 | Ga0466972_0024943 | |||
| 1046 | Ga0466966_0159536 | |||
| 1047 | Ga0466961_0000955 | |||
| 1048 | Ga0466961_0115747 | |||
| 1049 | Ga0453684_0064148 | |||
| 1050 | Ga0453684_0121301 | |||
| 1051 | Ga0466959_0006078 | |||
| 1052 | Ga0466959_0100291 | |||
| 1053 | Ga0495627_000194 | |||
| 1054 | Ga0495592_0000495 | |||
| 1055 | Ga0495590_0037437 | |||
| 1056 | Ga0495591_001140 | |||
| 1057 | Ga0495638_0002788 | |||
| 1058 | Ga0495638_0033538 | |||
| 1059 | Ga0495650_0000386 | |||
| 1060 | Ga0495650_0019141 | |||
| 1061 | Ga0495585_0154604 | |||
| 1062 | Ga0495620_0000814 | |||
| 1063 | Ga0495620_0176383 | |||
| 1064 | Ga0495630_0026460 | |||
| 1065 | Ga0495632_0024113 | |||
| 1066 | Ga0495632_0061634 | |||
| 1067 | Ga0495632_0093708 | |||
| 1068 | Ga0495637_0057358 | |||
| 1069 | Ga0495643_0075680 | |||
| 1070 | Ga0495643_0106844 | |||
| 1071 | Ga0495643_0113084 | |||
| 1072 | Ga0495648_0012690 | |||
| 1073 | Ga0495648_0068827 | |||
| 1074 | Ga0495648_0080739 | |||
| 1075 | Ga0495642_0212551 | |||
| 1076 | Ga0495654_0004782 | |||
| 1077 | Ga0495654_0060778 | |||
| 1078 | Ga0495587_0260459 | |||
| 1079 | Ga0495597_0048843 | |||
| 1080 | Ga0495625_0001105 | |||
| 1081 | Ga0495625_0004561 | |||
| 1082 | Ga0495625_0056814 | |||
| 1083 | Ga0495646_0217904 | |||
| 1084 | Ga0495658_0050367 | |||
| 1085 | Ga0495658_0195271 | |||
| 1086 | Ga0495649_0000753 | |||
| 1087 | Ga0495649_0009602 | |||
| 1088 | Ga0495649_0118606 | |||
| 1089 | Ga0495589_0000006 | |||
| 1090 | Ga0495600_0348901 | |||
| 1091 | Ga0495660_0000168 | |||
| 1092 | Ga0495672_0000061 | |||
| 1093 | Ga0495676_0432061 | |||
| 1094 | Ga0495687_000292 | |||
| 1095 | Ga0495679_000525 | |||
| 1096 | Ga0495679_022195 | |||
| 1097 | Ga0495626_0052133 | |||
| 1098 | Ga0495626_0141506 | |||
| 1099 | Ga0496100_0012039 | |||
| 1100 | Ga0496102_0001535 | |||
| 1101 | Ga0496102_0008488 | |||
| 1102 | Ga0496102_0010392 | |||
| 1103 | Ga0496104_0003670 | |||
| 1104 | Ga0496104_0481841 | |||
| 1105 | Ga0496105_0010300 | |||
| 1106 | Ga0496105_0154675 | |||
| 1107 | Ga0496114_0014236 | |||
| 1108 | Ga0496114_0366024 | |||
| 1109 | Ga0496116_0000031 | |||
| 1110 | Ga0496116_0000170 | |||
| 1111 | Ga0496116_0000320 | |||
| 1112 | Ga0496116_0000483 | |||
| 1113 | Ga0496116_0011470 | |||
| 1114 | Ga0496116_0012357 | |||
| 1115 | Ga0496116_0021410 | |||
| 1116 | Ga0496116_0034723 | |||
| 1117 | Ga0496116_0055910 | |||
| 1118 | Ga0496116_0159046 | |||
| 1119 | Ga0496117_0000199 | |||
| 1120 | Ga0496117_0000241 | |||
| 1121 | Ga0496117_0003831 | |||
| 1122 | Ga0496117_0004471 | |||
| 1123 | Ga0496117_0014277 | |||
| 1124 | Ga0496117_0043150 | |||
| 1125 | Ga0496117_0043319 | |||
| 1126 | Ga0496117_0266881 | |||
| 1127 | Ga0496118_0001006 | |||
| 1128 | Ga0496118_0001337 | |||
| 1129 | Ga0496118_0001883 | |||
| 1130 | Ga0496118_0002359 | |||
| 1131 | Ga0496118_0004608 | |||
| 1132 | Ga0496118_0013591 | |||
| 1133 | Ga0496118_0042796 | |||
| 1134 | Ga0496118_0049316 | |||
| 1135 | Ga0496118_0054518 | |||
| 1136 | Ga0496118_0072893 | |||
| 1137 | Ga0496119_0000078 | |||
| 1138 | Ga0496119_0000101 | |||
| 1139 | Ga0496119_0000110 | |||
| 1140 | Ga0496119_0001277 | |||
| 1141 | Ga0496119_0005506 | |||
| 1142 | Ga0496119_0006856 | |||
| 1143 | Ga0496119_0026346 | |||
| 1144 | Ga0496119_0046405 | |||
| 1145 | Ga0496120_0000009 | |||
| 1146 | Ga0496120_0000151 | |||
| 1147 | Ga0496120_0000425 | |||
| 1148 | Ga0496120_0000439 | |||
| 1149 | Ga0496120_0005237 | |||
| 1150 | Ga0496120_0006196 | |||
| 1151 | Ga0496120_0006205 | |||
| 1152 | Ga0496120_0014731 | |||
| 1153 | Ga0496120_0027453 | |||
| 1154 | Ga0496121_0000041 | |||
| 1155 | Ga0496121_0005703 | |||
| 1156 | Ga0496121_0010460 | |||
| 1157 | Ga0496121_0333856 | |||
| 1158 | Ga0496122_0000571 | |||
| 1159 | Ga0496122_0001029 | |||
| 1160 | Ga0496122_0001807 | |||
| 1161 | Ga0496122_0021782 | |||
| 1162 | Ga0496122_0057679 | |||
| 1163 | Ga0496122_0084781 | |||
| 1164 | Ga0496122_0279028 | |||
| 1165 | Ga0496123_0000430 | |||
| 1166 | Ga0496123_0000841 | |||
| 1167 | Ga0496123_0006614 | |||
| 1168 | Ga0496123_0009674 | |||
| 1169 | Ga0496123_0013355 | |||
| 1170 | Ga0496123_0090417 | |||
| 1171 | Ga0496123_0099371 | |||
| 1172 | Ga0496124_0000307 | |||
| 1173 | Ga0496124_0000474 | |||
| 1174 | Ga0496124_0000914 | |||
| 1175 | Ga0496124_0006220 | |||
| 1176 | Ga0496124_0023069 | |||
| 1177 | Ga0496124_0238384 | |||
| 1178 | Ga0496124_0266032 | |||
| 1179 | Ga0496125_0001606 | |||
| 1180 | Ga0496125_0009042 | |||
| 1181 | Ga0496125_0023589 | |||
| 1182 | Ga0496125_0059914 | |||
| 1183 | Ga0496125_0076988 | |||
| 1184 | Ga0496125_0248233 | |||
| 1185 | Ga0496126_0001894 | |||
| 1186 | Ga0496126_0011347 | |||
| 1187 | Ga0496126_0051547 | |||
| 1188 | Ga0496126_0219075 | |||
| 1189 | Ga0496126_0388122 | |||
| 1190 | Ga0496126_0543880 | |||
| 1191 | Ga0501033_0172621 | |||
| 1192 | Ga0501034_0022606 | |||
| 1193 | Ga0501036_0017842 | |||
| 1194 | Ga0501038_0025148 | |||
| 1195 | Ga0501038_0136845 | |||
| 1196 | Ga0501039_0210767 | |||
| 1197 | Ga0501040_0000108 | |||
| 1198 | Ga0501042_0001266 | |||
| 1199 | Ga0501042_0018639 | |||
| 1200 | Ga0501043_0045292 | |||
| 1201 | Ga0501067_0050601 | |||
| 1202 | Ga0501072_0313085 | |||
| 1203 | Ga0501035_0014954 | |||
| 1204 | Ga0501044_0006131 | |||
| 1205 | nmdc:mga03n38_357047_c1 | |||
| 1206 | nmdc:mga00v17_108077_c1 | |||
| 1207 | nmdc:mga0yw44_156306_c1 | |||
| 1208 | nmdc:mga0k408_1632_c2 | |||
| 1209 | nmdc:mga0k408_163847_c1 | |||
| 1210 | nmdc:mga0k408_24327_c1 | |||
| 1211 | nmdc:mga0k408_252_c1 | |||
| 1212 | nmdc:mga0k408_262773_c1 | |||
| 1213 | nmdc:mga0k408_297415_c1 | |||
| 1214 | nmdc:mga0k408_429870_c1 | |||
| 1215 | nmdc:mga0k408_81575_c1 | |||
| 1216 | nmdc:mga06z11_164409_c1 | |||
| 1217 | nmdc:mga06z11_17486_c1 | |||
| 1218 | nmdc:mga06z11_350620_c1 | |||
| 1219 | nmdc:mga04h51_77832_c1 | |||
| 1220 | nmdc:mga07m45_11263_c1 | |||
| 1221 | nmdc:mga07m45_116065_c1 | |||
| 1222 | nmdc:mga07m45_139708_c1 | |||
| 1223 | nmdc:mga07m45_15790_c1 | |||
| 1224 | nmdc:mga07m45_49575_c1 | |||
| 1225 | nmdc:mga07m45_59785_c1 | |||
| 1226 | nmdc:mga0qj67_317961_c1 | |||
| 1227 | nmdc:mga06r32_377601_c1 | |||
| 1228 | nmdc:mga0a205_128794_c1 | |||
| 1229 | nmdc:mga0sz30_109435_c1 | |||
| 1230 | nmdc:mga0sz30_23594_c1 | |||
| 1231 | Ga0500578_0000040 | |||
| 1232 | Ga0500578_0103699 | |||
| 1233 | Ga0500644_0002701 | |||
| 1234 | Ga0500646_0007126 | |||
| 1235 | Ga0500651_0040785 | |||
| 1236 | Ga0500651_0063931 | |||
| 1237 | Ga0500593_004477 | |||
| 1238 | Ga0500594_0000600 | |||
| 1239 | Ga0500595_004643 | |||
| 1240 | Ga0500595_013872 | |||
| 1241 | Ga0500642_0003186 | |||
| 1242 | Ga0500652_010708 | |||
| 1243 | Ga0500559_0001133 | |||
| 1244 | Ga0500604_0028126 | |||
| 1245 | Ga0500619_000054 | |||
| 1246 | Ga0500622_0000138 | |||
| 1247 | Ga0500622_0139847 | |||
| 1248 | Ga0500636_0101701 | |||
| 1249 | Ga0587072_006503 | |||
| 1250 | Ga0501082_0764445 | |||
| 1251 | Ga0530510_0531063 | |||
| 1252 | 2506576884 | |||
| 1253 | 2506582022 | |||
| 1254 | 2508850851 | |||
| 1255 | 2511380114 | |||
| 1256 | 2516088257 | |||
| 1257 | 2521560199 | |||
| 1258 | 2547697452 | |||
| 1259 | 2555260501 | |||
| 1260 | 2562466107 | |||
| 1261 | 2585829801 | |||
| 1262 | 2585833508 | |||
| 1263 | 2587725781 | |||
| 1264 | 2587735173 | |||
| 1265 | 2587758794 | |||
| 1266 | 2588290712 | |||
| 1267 | 2599409280 | |||
| 1268 | 2599444581 | |||
| 1269 | 2599926917 | |||
| 1270 | 2601522214 | |||
| 1271 | 2601527239 | |||
| 1272 | 2601536516 | |||
| 1273 | 2601541855 | |||
| 1274 | 2601614069 | |||
| 1275 | 2601618792 | |||
| 1276 | 2601642599 | |||
| 1277 | 2601647451 | |||
| 1278 | 2601652217 | |||
| 1279 | 2601657544 | |||
| 1280 | 2601662420 | |||
| 1281 | 2601695377 | |||
| 1282 | 2601700053 | |||
| 1283 | 2601705341 | |||
| 1284 | 2601710370 | |||
| 1285 | 2601715382 | |||
| 1286 | 2601720404 | |||
| 1287 | 2601725788 | |||
| 1288 | 2601730330 | |||
| 1289 | 2601735347 | |||
| 1290 | 2601740044 | |||
| 1291 | 2601750533 | |||
| 1292 | 2601760214 | |||
| 1293 | 2601765617 | |||
| 1294 | 2602017786 | |||
| 1295 | 2603638478 | |||
| 1296 | 2603659790 | |||
| 1297 | 2603665066 | |||
| 1298 | 2603837719 | |||
| 1299 | 2603842795 | |||
| 1300 | 2603847870 | |||
| 1301 | 2603852940 | |||
| 1302 | 2603866824 | |||
| 1303 | 2603870994 | |||
| 1304 | 2603875909 | |||
| 1305 | 2606048185 | |||
| 1306 | 2606069496 | |||
| 1307 | 2606145309 | |||
| 1308 | 2606175587 | |||
| 1309 | 2608668372 | |||
| 1310 | 2609912659 | |||
| 1311 | 2637225180 | |||
| 1312 | 2643770412 | |||
| 1313 | 2643972210 | |||
| 1314 | 2644049839 | |||
| 1315 | 2644131419 | |||
| 1316 | 2644141679 | |||
| 1317 | 2644202100 | |||
| 1318 | 2644247414 | |||
| 1319 | 2644275550 | |||
| 1320 | 2644338069 | |||
| 1321 | 2644482751 | |||
| 1322 | 2650897680 | |||
| 1323 | 2656279256 | |||
| 1324 | 2671107441 | |||
| 1325 | 2671589310 | |||
| 1326 | 2676406424 | |||
| 1327 | 2686355954 | |||
| 1328 | 2689443283 | |||
| 1329 | 2739309214 | |||
| 1330 | 2765571367 | |||
| 1331 | 2777023512 | |||
| 1332 | 2791922937 | |||
| 1333 | 2792313516 | |||
| 1334 | 2808943157 | |||
| 1335 | 2809124465 | |||
| 1336 | 2813729535 | |||
| 1337 | 2814697025 | |||
| 1338 | 2819616557 | |||
| 1339 | 2821271945 | |||
| 1340 | 2839099208 | |||
| 1341 | 2847088903 | |||
| 1342 | 2847801088 | |||
| 1343 | 2857578065 | |||
| 1344 | 2858466578 | |||
| 1345 | 2862293184 | |||
| 1346 | 2865018128 | |||
| 1347 | 2867350366 | |||
| 1348 | 2869552689 | |||
| 1349 | 2871273351 | |||
| 1350 | 2881612030 | |||
| 1351 | 2900054655 | |||
| 1352 | 2900581635 | |||
| 1353 | 2904440760 | |||
| 1354 | 2904476389 | |||
| 1355 | 2904506825 | |||
| 1356 | 2904513932 | |||
| 1357 | 2904535359 | |||
| 1358 | 2904588493 | |||
| 1359 | 2904594619 | |||
| 1360 | 2904605849 | |||
| 1361 | 2919048925 | |||
| 1362 | 2919084828 | |||
| 1363 | 2919112933 | |||
| 1364 | 2919152558 | |||
| 1365 | 2920760639 | |||
| 1366 | 2927145227 | |||
| 1367 | 2928062578 | |||
| 1368 | 2935629719 | |||
| 1369 | 2939622425 | |||
| 1370 | 2945879555 | |||
| 1371 | 2945954134 | |||
| 1372 | 2952255089 | |||
| 1373 | 2969082175 | |||
| 1374 | 2971824394 | |||
| 1375 | 2974437139 | |||
| 1376 | 2978976614 | |||
| 1377 | 2984495428 | |||
| 1378 | 2984564620 | |||
| 1379 | 2984597349 | |||
| 1380 | 2990265471 | |||
| 1381 | 3006497580 | |||
| 1382 | 640936436 | |||
| 1383 | 8002289651 | |||
| 1384 | 8002291608 | |||
| 1385 | 8019509275 | |||
| 1386 | 8048136923 | |||
| 1387 | 8054849451 | |||
| 1388 | 8057306457 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qvj-assembly1.cif.gz_A | allantoin racemase from klebsiella pneumoniae | 0.9901 | 3 | 246 |
| 3qvk-assembly1.cif.gz_A | allantoin racemase from klebsiella pneumoniae | 0.99 | 3 | 246 |
| 3qvj-assembly1.cif.gz_A | allantoin racemase from klebsiella pneumoniae | 0.9821 | 3 | 246 |
| 3qvk-assembly1.cif.gz_A | allantoin racemase from klebsiella pneumoniae | 0.982 | 3 | 246 |
| 5lfd-assembly1.cif.gz_A | crystal structure of allantoin racemase from pseudomonas fluorescens allr | 0.9567 | 4 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qvjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9872 | 3 | 246 | 3.40.50.12500 |
| 3qvjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9791 | 3 | 246 | 3.40.50.12500 |
| 5lfdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9567 | 4 | 239 | 3.40.50.12500 |
| 5lfdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9527 | 4 | 239 | 3.40.50.12500 |
| af_Q09921_2_237_3.40.50.12500 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9218 | 4 | 229 | 3.40.50.12500 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X2MTC4-F1-model_v4 | Allantoin racemase (EC 5.1.99.3) | 1.002 | 4 | 133 |
GO:0036361
GO:0047653 |
| AF-A0A3B8YIV1-F1-model_v4 | deleted | 1.001 | 4 | 149 |
|
| AF-A0A7Z8GH71-F1-model_v4 | deleted | 0.9987 | 4 | 107 |
|
| AF-A0A378F4P8-F1-model_v4 | Putative hydantoin racemase | 0.994 | 77 | 235 |
GO:0036361
|
| AF-A0A3B8YIV1-F1-model_v4 | deleted | 0.9938 | 4 | 149 |
|