F475696

General Info

Members Datasets Scaffolds Average Seq Length
694 410 1388 245

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000294|Ga0055524_100029444
Length 291
Sequence MRGTVCKGYATNRTLSMHRTGSSRADARARDLQRRRHPWSFCIHAMRIDVINPNTTATMTAAIGHAAQAVAAPGTRIVATQPSFGAPSIEGHHDEVWGAAGVTEQVRLGQAAGADAFVIACFGDPGLAAARELASGPVIGIAEAAFHCASMLATGFSVVTTLTRTCVIAEHLVVQYGFERTCRGIHGTDIAVLELEDPASDAYGRILASAREALARDRSGAIVLGCAGMADLCRRLQQALGVPVVDGVAAAVKLAESLVSLGLGTSKAGDYARPLPKAYAGLAAPFGPVAN

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
177 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
183 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
276 2506520008 Serratia plymuthica AS12 Isolate Unclassified
277 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
278 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
279 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
280 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
281 2547132181 Kosakonia sacchari SP1 Isolate Stem
282 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
283 2561511199 Enterobacter sp. R4-368 Isolate Nodule
284 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
285 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
286 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
287 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
288 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
289 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
290 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
291 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
292 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
293 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
294 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
295 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
296 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
297 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
298 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
299 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
300 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
301 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
302 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
303 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
304 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
305 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
306 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
307 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
308 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
309 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
310 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
311 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
312 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
313 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
314 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
315 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
316 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
317 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
318 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
319 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
320 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
321 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
322 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
323 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
324 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
325 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
326 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
327 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
328 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
329 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
330 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
331 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
332 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
333 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
334 2636415599 Klebsiella variicola DX120E Isolate Unclassified
335 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
336 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
337 2643221607 Rhizobium sp. Root73 Isolate Unclassified
338 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
339 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
340 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
341 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
342 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
343 2643221660 Methylibium sp. Root1272 Isolate Unclassified
344 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
345 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
346 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
347 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
348 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
349 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
350 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
351 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
352 2738543024 Aminobacter sp. AP02 Isolate Unclassified
353 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
354 2775507074 Klebsiella sp. D5A Isolate Unclassified
355 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
356 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
357 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
358 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
359 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
360 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
361 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
362 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
363 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
364 2847085930 Erwinia persicina B64 Isolate Bulb
365 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
366 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
367 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
368 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
369 2865014394 Pantoea sp. R-71966 Isolate Unclassified
370 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
371 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
372 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
373 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
374 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
375 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
376 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
377 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
378 2904504865 Serratia marcescens 1822 Isolate Unclassified
379 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
380 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
381 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
382 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
383 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
384 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
385 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
386 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
387 2919150387 Rahnella aceris 1817 Isolate Unclassified
388 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
389 2927143783 Rahnella sp. 2050 Isolate Unclassified
390 2928058823 Ralstonia sp. 1138 Isolate Unclassified
391 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
392 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
393 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
394 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
395 2952252522 Salinicola sp. DM10 Isolate Unclassified
396 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
397 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
398 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
399 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
400 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
401 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
402 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
403 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
404 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
405 640753048 Serratia proteamaculans 568 Isolate Endosphere
406 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
407 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
408 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
409 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
410 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.83
Metatranscriptomes 0.43
Isolates 19.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0.14
Endosphere 16.43
Nodule 1.73
Rhizoplane 8.36
Rhizosphere 48.7
Stem 0.14
Stem Tuber 0.43
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1000294 3300003775 Bacteria 48038
2 RicEn_C3495 2010549000 Bacteria 2386
3 SwRhRL2b_contig_306743 2162886007 Bacteria 4252
4 JGI24741J21665_1000336 3300001915 Bacteria 14055
5 JGI24740J21852_10001604 3300001979 Bacteria 10392
6 JGI24740J21852_10009850 3300001979 Bacteria 3714
7 JGI24739J22299_10000114 3300001989 Bacteria 25102
8 JGI25162J39368_1002152 3300002737 Bacteria 8240
9 JGI25163J39215_1000173 3300002771 Bacteria 25169
10 JGI25164J39214_1000066 3300002772 Bacteria 106367
11 JGI25152J39213_1003922 3300002773 Bacteria 4877
12 JGI25150J39212_1010208 3300002774 Bacteria 1754
13 JGI25153J46596_10004528 3300003215 Bacteria 7476
14 JGI25153J46596_10007742 3300003215 Bacteria 5228
15 rootL2_10022785 3300003322 Bacteria 6083
16 rootH1_10149035 3300003323 Bacteria 1765
17 Ga0055538_1000003 3300003751 Bacteria 663004
18 Ga0055538_1001269 3300003751 Bacteria 5169
19 Ga0055539_1000003 3300003752 Bacteria 663004
20 Ga0055539_1000123 3300003752 Bacteria 83036
21 Ga0055533_1000005 3300003756 Bacteria 663004
22 Ga0055533_1001648 3300003756 Bacteria 5742
23 Ga0055525_1000005 3300003759 Bacteria 663004
24 Ga0055525_1000794 3300003759 Bacteria 9973
25 Ga0055526_1002654 3300003771 Bacteria 11944
26 Ga0055530_10000963 3300003791 Bacteria 23351
27 Ga0055540_1000028 3300003792 Bacteria 184864
28 Ga0055531_10009192 3300003794 Bacteria 5087
29 Ga0055541_1000003 3300003841 Bacteria 663004
30 Ga0055541_1001207 3300003841 Bacteria 5742
31 Ga0058692_1000069 3300003856 Bacteria 83842
32 Ga0058692_1000203 3300003856 Bacteria 35711
33 Ga0058692_1000665 3300003856 Bacteria 14161
34 Ga0058692_1008309 3300003856 Bacteria 2682
35 Ga0058692_1009885 3300003856 Bacteria 2384
36 Ga0058692_1036770 3300003856 Bacteria 884
37 Ga0065703_1018934 3300005272 Bacteria 5003
38 Ga0065704_10001388 3300005289 Bacteria 16610
39 Ga0070660_100196571 3300005339 Bacteria 1635
40 Ga0070661_100000057 3300005344 Bacteria 87637
41 Ga0070667_100313198 3300005367 Bacteria 1415
42 Ga0070709_10365546 3300005434 Bacteria 1069
43 Ga0070714_100014261 3300005435 Bacteria 6383
44 Ga0070713_100028574 3300005436 Bacteria 4404
45 Ga0070713_100172477 3300005436 Bacteria 1938
46 Ga0070663_100000011 3300005455 Bacteria 146097
47 Ga0070662_100024723 3300005457 Bacteria 4142
48 Ga0068867_100698050 3300005459 Bacteria 895
49 Ga0070706_100011977 3300005467 Bacteria 8048
50 Ga0070707_100070549 3300005468 Bacteria 3365
51 Ga0070698_100271659 3300005471 Bacteria 1627
52 Ga0070699_100483500 3300005518 Bacteria 1124
53 Ga0068853_100201049 3300005539 Bacteria 1813
54 Ga0070665_100007940 3300005548 Bacteria 10759
55 Ga0070665_100022447 3300005548 Bacteria 6351
56 Ga0070665_100098496 3300005548 Bacteria 2928
57 Ga0070664_100000008 3300005564 Bacteria 173734
58 Ga0068857_100072457 3300005577 Bacteria 3070
59 Ga0068857_100430678 3300005577 Bacteria 1231
60 Ga0068856_100000009 3300005614 Bacteria 181448
61 Ga0070702_100572467 3300005615 Bacteria 842
62 Ga0068852_100436747 3300005616 Bacteria 1293
63 Ga0068864_100012311 3300005618 Bacteria 7070
64 Ga0068864_100432172 3300005618 Unclassified 1256
65 Ga0068861_100974330 3300005719 Bacteria 808
66 Ga0068863_100006252 3300005841 Bacteria 11696
67 Ga0068860_100000240 3300005843 Bacteria 83866
68 Ga0068860_100084454 3300005843 Bacteria 3021
69 Ga0068860_100149442 3300005843 Bacteria 2249
70 Ga0068860_100319321 3300005843 Bacteria 1524
71 Ga0068860_100811608 3300005843 Bacteria 949
72 Ga0068862_100433432 3300005844 Bacteria 1236
73 Ga0081455_10031300 3300005937 Bacteria 4816
74 Ga0081539_10000528 3300005985 Bacteria 79508
75 Ga0075368_10029365 3300006042 Bacteria 2126
76 Ga0075362_10137353 3300006177 Bacteria 1167
77 Ga0075367_10001948 3300006178 Bacteria 9173
78 Ga0075369_10003023 3300006186 Bacteria 6082
79 Ga0075369_10115912 3300006186 Bacteria 1210
80 Ga0075366_10001982 3300006195 Bacteria 10366
81 Ga0075366_10011685 3300006195 Bacteria 4961
82 Ga0075366_10034102 3300006195 Bacteria 2998
83 Ga0075366_10044029 3300006195 Bacteria 2645
84 Ga0075366_10048597 3300006195 Bacteria 2516
85 Ga0075366_10092690 3300006195 Bacteria 1810
86 Ga0075366_10115386 3300006195 Bacteria 1617
87 Ga0075366_10232098 3300006195 Bacteria 1124
88 Ga0075366_10272627 3300006195 Bacteria 1033
89 Ga0075370_10001022 3300006353 Bacteria 11620
90 Ga0075370_10004484 3300006353 Bacteria 6788
91 Ga0075370_10007271 3300006353 Bacteria 5635
92 Ga0075370_10009710 3300006353 Bacteria 5010
93 Ga0075370_10029004 3300006353 Bacteria 3079
94 Ga0075370_10077923 3300006353 Bacteria 1902
95 Ga0075370_10113351 3300006353 Bacteria 1575
96 Ga0075428_100471573 3300006844 Bacteria 1344
97 Ga0075430_100254308 3300006846 Bacteria 1455
98 Ga0075433_10148227 3300006852 Bacteria 2087
99 Ga0079104_1000194 3300006946 Bacteria 85426
100 Ga0079104_1000388 3300006946 Bacteria 51046
101 Ga0079104_1001429 3300006946 Bacteria 16094
102 Ga0079104_1001784 3300006946 Bacteria 13444
103 Ga0105251_10000115 3300009011 Bacteria 80221
104 Ga0105251_10000439 3300009011 Bacteria 40348
105 Ga0105251_10000483 3300009011 Bacteria 37688
106 Ga0105251_10001004 3300009011 Bacteria 24713
107 Ga0105251_10001496 3300009011 Bacteria 20070
108 Ga0105251_10006794 3300009011 Bacteria 7215
109 Ga0105251_10042071 3300009011 Bacteria 2220
110 Ga0105251_10056262 3300009011 Bacteria 1862
111 Ga0105244_10000622 3300009036 Bacteria 31482
112 Ga0105244_10001238 3300009036 Bacteria 20952
113 Ga0105244_10001690 3300009036 Bacteria 17432
114 Ga0105244_10002104 3300009036 Bacteria 15304
115 Ga0105244_10002278 3300009036 Bacteria 14580
116 Ga0105244_10006228 3300009036 Bacteria 7775
117 Ga0105244_10020371 3300009036 Bacteria 3687
118 Ga0105244_10023525 3300009036 Bacteria 3376
119 Ga0105250_10000040 3300009092 Bacteria 133899
120 Ga0105250_10001631 3300009092 Bacteria 11994
121 Ga0105250_10008346 3300009092 Bacteria 4405
122 Ga0105250_10027462 3300009092 Bacteria 2294
123 Ga0105240_10318707 3300009093 Bacteria 1773
124 Ga0105240_11047609 3300009093 Bacteria 870
125 Ga0111539_10758118 3300009094 Bacteria 1130
126 Ga0105247_10006154 3300009101 Bacteria 7456
127 Ga0105243_10110238 3300009148 Bacteria 2301
128 Ga0105243_10146432 3300009148 Bacteria 2021
129 Ga0105241_10000004 3300009174 Bacteria 803007
130 Ga0105248_10147100 3300009177 Bacteria 2659
131 Ga0105237_10003312 3300009545 Bacteria 19195
132 Ga0105249_10061510 3300009553 Bacteria 3446
133 Ga0105246_10020497 3300011119 Bacteria 4241
134 Ga0105246_10079150 3300011119 Bacteria 2336
135 Ga0157373_10002213 3300013100 Bacteria 14720
136 Ga0157373_10009569 3300013100 Bacteria 7155
137 Ga0157373_10289894 3300013100 Bacteria 1161
138 Ga0157371_10000068 3300013102 Bacteria 168110
139 Ga0157371_10001080 3300013102 Bacteria 29511
140 Ga0157371_10006758 3300013102 Bacteria 9378
141 Ga0157371_10014113 3300013102 Bacteria 6042
142 Ga0157371_10539069 3300013102 Bacteria 864
143 Ga0157370_10000200 3300013104 Bacteria 75469
144 Ga0157370_10001699 3300013104 Bacteria 27103
145 Ga0157370_10066311 3300013104 Bacteria 3414
146 Ga0157369_10000420 3300013105 Bacteria 56126
147 Ga0157369_10027968 3300013105 Bacteria 6244
148 Ga0157369_10366998 3300013105 Bacteria 1494
149 Ga0157369_10587923 3300013105 Bacteria 1150
150 Ga0163162_10217753 3300013306 Bacteria 2039
151 Ga0163162_10364750 3300013306 Bacteria 1577
152 Ga0157372_10018738 3300013307 Bacteria 7447
153 Ga0157372_10028595 3300013307 Bacteria 6086
154 Ga0157372_10033015 3300013307 Bacteria 5682
155 Ga0157372_10060886 3300013307 Bacteria 4224
156 Ga0157372_10117557 3300013307 Bacteria 3049
157 Ga0157372_10117625 3300013307 Bacteria 3049
158 Ga0157372_10490141 3300013307 Bacteria 1433
159 Ga0157375_10061755 3300013308 Bacteria 3722
160 Ga0157375_10102374 3300013308 Bacteria 2948
161 Ga0163163_10135494 3300014325 Unclassified 2504
162 Ga0157380_10495398 3300014326 Bacteria 1185
163 Ga0182008_10000960 3300014497 Bacteria 20049
164 Ga0182008_10061756 3300014497 Bacteria 1847
165 Ga0157379_10080773 3300014968 Bacteria 2913
166 Ga0157379_10534679 3300014968 Bacteria 1089
167 Ga0182006_1008169 3300015261 Bacteria 4750
168 Ga0163161_10000107 3300017792 Bacteria 78998
169 Ga0197907_11371469 3300020069 Bacteria 2176
170 Ga0206355_1535507 3300020076 Bacteria 1267
171 Ga0213876_10000214 3300021384 Bacteria 58407
172 Ga0209760_100005 3300025207 Bacteria 238315
173 Ga0209760_102476 3300025207 Bacteria 1724
174 Ga0209784_100001 3300025224 Bacteria 3600592
175 Ga0209784_100003 3300025224 Bacteria 1379451
176 Ga0209566_100001 3300025225 Bacteria 3600765
177 Ga0209566_100002 3300025225 Bacteria 2614868
178 Ga0209674_100002 3300025226 Bacteria 3600592
179 Ga0209674_100008 3300025226 Bacteria 1076909
180 Ga0209563_100002 3300025230 Bacteria 2045675
181 Ga0209563_100004 3300025230 Bacteria 1814108
182 Ga0207427_100009 3300025231 Bacteria 663036
183 Ga0209437_100001 3300025233 Bacteria 2045675
184 Ga0209437_100199 3300025233 Bacteria 120313
185 Ga0207425_1000238 3300025245 Bacteria 42734
186 Ga0209677_100002 3300025253 Bacteria 2045675
187 Ga0209677_100009 3300025253 Bacteria 749530
188 Ga0209759_1003952 3300025256 Bacteria 5703
189 Ga0209129_1000062 3300025258 Bacteria 240655
190 Ga0209129_1000221 3300025258 Bacteria 64902
191 Ga0209564_1000014 3300025295 Bacteria 621501
192 Ga0209758_1000126 3300025297 Bacteria 189761
193 Ga0209758_1000129 3300025297 Bacteria 185022
194 Ga0209050_1001372 3300025298 Bacteria 26579
195 Ga0209050_1007618 3300025298 Bacteria 6012
196 Ga0209256_1000015 3300025299 Bacteria 622953
197 Ga0209051_1000022 3300025303 Bacteria 474879
198 Ga0209051_1019429 3300025303 Bacteria 2963
199 Ga0209257_1000030 3300025304 Bacteria 689812
200 Ga0209257_1029323 3300025304 Bacteria 1794
201 Ga0207696_1000026 3300025711 Bacteria 418166
202 Ga0207696_1000033 3300025711 Bacteria 360689
203 Ga0207696_1000077 3300025711 Bacteria 209611
204 Ga0207696_1000723 3300025711 Bacteria 22209
205 Ga0207696_1000885 3300025711 Bacteria 18669
206 Ga0207696_1008410 3300025711 Bacteria 3949
207 Ga0207655_1000023 3300025728 Bacteria 467070
208 Ga0207655_1000040 3300025728 Bacteria 335311
209 Ga0207655_1000210 3300025728 Bacteria 102315
210 Ga0207655_1000683 3300025728 Bacteria 39498
211 Ga0207655_1006158 3300025728 Bacteria 8001
212 Ga0207655_1008020 3300025728 Bacteria 6770
213 Ga0207655_1009495 3300025728 Bacteria 6030
214 Ga0207655_1009627 3300025728 Bacteria 5980
215 Ga0207655_1014240 3300025728 Bacteria 4509
216 Ga0207713_1000001 3300025735 Bacteria 2295391
217 Ga0207713_1000040 3300025735 Bacteria 245322
218 Ga0207713_1000065 3300025735 Bacteria 196128
219 Ga0207713_1000147 3300025735 Bacteria 106198
220 Ga0207713_1000554 3300025735 Bacteria 37287
221 Ga0207713_1009276 3300025735 Bacteria 5570
222 Ga0207713_1024757 3300025735 Bacteria 2789
223 Ga0207710_10000016 3300025900 Bacteria 388568
224 Ga0207699_10234693 3300025906 Bacteria 1258
225 Ga0207645_10098491 3300025907 Bacteria 1885
226 Ga0207684_10008362 3300025910 Bacteria 9200
227 Ga0207654_10000006 3300025911 Bacteria 815027
228 Ga0207695_10195284 3300025913 Bacteria 1940
229 Ga0207671_10007383 3300025914 Bacteria 9546
230 Ga0207649_10000334 3300025920 Bacteria 35813
231 Ga0207700_10003125 3300025928 Bacteria 9563
232 Ga0207700_10104859 3300025928 Bacteria 2263
233 Ga0207706_10093566 3300025933 Bacteria 2643
234 Ga0207709_10108164 3300025935 Bacteria 1853
235 Ga0207711_10092639 3300025941 Bacteria 2660
236 Ga0207689_10115026 3300025942 Bacteria 2211
237 Ga0207661_10425300 3300025944 Bacteria 1207
238 Ga0207679_10000001 3300025945 Bacteria 777444
239 Ga0207712_10420532 3300025961 Bacteria 1127
240 Ga0207658_10175131 3300025986 Bacteria 1771
241 Ga0207677_10334422 3300026023 Bacteria 1263
242 Ga0207703_10117439 3300026035 Bacteria 2279
243 Ga0207703_10161742 3300026035 Bacteria 1961
244 Ga0207639_10266038 3300026041 Bacteria 1502
245 Ga0207678_10000001 3300026067 Bacteria 433184
246 Ga0207678_10358609 3300026067 Bacteria 1258
247 Ga0207702_10000024 3300026078 Bacteria 187719
248 Ga0207641_10023218 3300026088 Bacteria 5111
249 Ga0207648_10511541 3300026089 Bacteria 1099
250 Ga0207676_10036602 3300026095 Bacteria 3735
251 Ga0207674_10421760 3300026116 Bacteria 1289
252 Ga0207675_100430033 3300026118 Bacteria 1305
253 Ga0207675_100466172 3300026118 Bacteria 1254
254 Ga0209281_1000008 3300027111 Bacteria 867470
255 Ga0209281_1000083 3300027111 Bacteria 255034
256 Ga0209281_1000093 3300027111 Bacteria 240724
257 Ga0209281_1003968 3300027111 Bacteria 4592
258 Ga0209371_1000010 3300027312 Bacteria 922021
259 Ga0209371_1000026 3300027312 Bacteria 449205
260 Ga0209371_1000081 3300027312 Bacteria 185440
261 Ga0209371_1000140 3300027312 Bacteria 119103
262 Ga0209371_1000175 3300027312 Bacteria 95796
263 Ga0209371_1001555 3300027312 Bacteria 15130
264 Ga0209371_1002251 3300027312 Bacteria 11097
265 Ga0209371_1006379 3300027312 Bacteria 4378
266 Ga0209371_1011028 3300027312 Bacteria 2718
267 Ga0209371_1043932 3300027312 Bacteria 891
268 Ga0207428_10304004 3300027907 Bacteria 1180
269 Ga0268266_10065245 3300028379 Bacteria 3147
270 Ga0268266_10192124 3300028379 Bacteria 1864
271 Ga0268265_10365380 3300028380 Bacteria 1323
272 Ga0268264_10000035 3300028381 Bacteria 398196
273 Ga0268264_10246734 3300028381 Bacteria 1657
274 Ga0307517_10004249 3300028786 Bacteria 22093
275 Ga0307517_10153629 3300028786 Bacteria 1570
276 Ga0307515_10007857 3300028794 Bacteria 20966
277 Ga0307515_10016105 3300028794 Bacteria 13712
278 Ga0307515_10069956 3300028794 Bacteria 4786
279 Ga0307515_10092906 3300028794 Bacteria 3748
280 Ga0307515_10208414 3300028794 Bacteria 1807
281 Ga0268256_1000003 3300030500 Bacteria 1289401
282 Ga0268256_1000094 3300030500 Bacteria 140741
283 Ga0268256_1000102 3300030500 Bacteria 129989
284 Ga0268256_1000136 3300030500 Bacteria 101369
285 Ga0268256_1000400 3300030500 Bacteria 39434
286 Ga0268256_1001329 3300030500 Bacteria 15134
287 Ga0268256_1001989 3300030500 Bacteria 11097
288 Ga0268256_1011917 3300030500 Bacteria 2718
289 Ga0268256_1014995 3300030500 Bacteria 2278
290 Ga0268256_1025635 3300030500 Bacteria 1494
291 Ga0307512_10054219 3300030522 Bacteria 3178
292 Ga0307512_10076673 3300030522 Bacteria 2435
293 Ga0265330_10002010 3300031235 Bacteria 11285
294 Ga0265328_10033952 3300031239 Bacteria 1890
295 Ga0265325_10140018 3300031241 Bacteria 1151
296 Ga0265340_10006737 3300031247 Bacteria 6290
297 Ga0265339_10048947 3300031249 Bacteria 2316
298 Ga0307513_10010816 3300031456 Bacteria 11398
299 Ga0307513_10064429 3300031456 Bacteria 3862
300 Ga0307513_10092127 3300031456 Bacteria 3086
301 Ga0307513_10256746 3300031456 Bacteria 1540
302 Ga0307513_10272978 3300031456 Bacteria 1473
303 Ga0307509_10001361 3300031507 Bacteria 41386
304 Ga0307509_10089253 3300031507 Bacteria 3161
305 Ga0307509_10104206 3300031507 Bacteria 2862
306 Ga0307408_100285991 3300031548 Bacteria 1375
307 Ga0307508_10000023 3300031616 Bacteria 177362
308 Ga0307508_10001573 3300031616 Bacteria 25462
309 Ga0307508_10061271 3300031616 Bacteria 3325
310 Ga0307508_10091161 3300031616 Bacteria 2635
311 Ga0307508_10216461 3300031616 Bacteria 1515
312 Ga0307514_10033311 3300031649 Bacteria 4112
313 Ga0307514_10048470 3300031649 Bacteria 3309
314 Ga0307514_10231874 3300031649 Bacteria 1118
315 Ga0307516_10013210 3300031730 Bacteria 8818
316 Ga0307412_10470693 3300031911 Bacteria 1040
317 Ga0307507_10063836 3300033179 Bacteria 3405
318 Ga0307507_10318071 3300033179 Bacteria 939
319 Ga0307510_10001484 3300033180 Bacteria 25882
320 Ga0307510_10029737 3300033180 Bacteria 6210
321 Ga0307510_10042584 3300033180 Bacteria 4946
322 Ga0373937_0095407 3300036401 Bacteria 2758
323 Ga0395900_0018700 3300037418 Bacteria 7066
324 Ga0395905_0331421 3300037471 Bacteria 1412
325 Ga0395905_0377597 3300037471 Bacteria 1311
326 Ga0395901_0071423 3300038443 Bacteria 3618
327 Ga0400483_082990 3300039062 Bacteria 17925
328 Ga0436365_0065679 3300039437 Bacteria 4400
329 Ga0436365_1279401 3300039437 Bacteria 294819
330 Ga0439438_000177 3300041405 Bacteria 28540
331 Ga0439447_003944 3300041407 Bacteria 5195
332 Ga0439447_025932 3300041407 Bacteria 1506
333 Ga0439466_0000032 3300041411 Bacteria 60696
334 Ga0451841_0729203 3300041498 Bacteria 1325
335 Ga0451853_3000726 3300041512 Bacteria 1443
336 Ga0439432_002543 3300042006 Bacteria 6875
337 Ga0439432_014373 3300042006 Bacteria 2680
338 Ga0439432_021150 3300042006 Bacteria 2159
339 Ga0439449_0054049 3300042007 Bacteria 1484
340 Ga0439452_000017 3300042010 Bacteria 324897
341 Ga0439452_000038 3300042010 Bacteria 149746
342 Ga0439452_006035 3300042010 Bacteria 3832
343 Ga0450919_001482 3300042121 Bacteria 3064
344 Ga0450923_037140 3300042125 Bacteria 1013
345 Ga0450907_001977 3300042146 Bacteria 4136
346 Ga0439464_0007569 3300042439 Bacteria 2839
347 Ga0450918_000218 3300042531 Bacteria 13121
348 Ga0450893_0013015 3300042532 Bacteria 1384
349 Ga0466986_0027770 3300044650 Bacteria 3813
350 Ga0466969_0029264 3300044656 Bacteria 2813
351 Ga0466972_0024943 3300044658 Bacteria 2966
352 Ga0466966_0159536 3300044684 Bacteria 1373
353 Ga0466961_0000955 3300044693 Bacteria 17875
354 Ga0466961_0115747 3300044693 Bacteria 1685
355 Ga0453684_0064148 3300044712 Bacteria 4694
356 Ga0453684_0121301 3300044712 Bacteria 3155
357 Ga0466959_0006078 3300045049 Bacteria 8331
358 Ga0466959_0100291 3300045049 Bacteria 2073
359 Ga0495627_000194 3300046453 Bacteria 66597
360 Ga0495592_0000495 3300046454 Bacteria 28713
361 Ga0495590_0037437 3300046457 Bacteria 1692
362 Ga0495591_001140 3300046458 Bacteria 17490
363 Ga0495638_0002788 3300046460 Bacteria 14030
364 Ga0495638_0033538 3300046460 Bacteria 3284
365 Ga0495650_0000386 3300046471 Bacteria 75722
366 Ga0495650_0019141 3300046471 Bacteria 3381
367 Ga0495585_0154604 3300046492 Bacteria 1194
368 Ga0495620_0000814 3300046515 Bacteria 19207
369 Ga0495620_0176383 3300046515 Bacteria 827
370 Ga0495630_0026460 3300046517 Bacteria 4295
371 Ga0495632_0024113 3300046519 Bacteria 3238
372 Ga0495632_0061634 3300046519 Bacteria 1820
373 Ga0495632_0093708 3300046519 Bacteria 1421
374 Ga0495637_0057358 3300046520 Bacteria 1609
375 Ga0495643_0075680 3300046522 Bacteria 1761
376 Ga0495643_0106844 3300046522 Bacteria 1428
377 Ga0495643_0113084 3300046522 Bacteria 1378
378 Ga0495648_0012690 3300046524 Bacteria 6265
379 Ga0495648_0068827 3300046524 Bacteria 2063
380 Ga0495648_0080739 3300046524 Bacteria 1852
381 Ga0495642_0212551 3300046528 Bacteria 844
382 Ga0495654_0004782 3300046530 Bacteria 7964
383 Ga0495654_0060778 3300046530 Bacteria 1815
384 Ga0495587_0260459 3300046536 Bacteria 974
385 Ga0495597_0048843 3300046542 Bacteria 1871
386 Ga0495625_0001105 3300046660 Bacteria 35003
387 Ga0495625_0004561 3300046660 Bacteria 13031
388 Ga0495625_0056814 3300046660 Bacteria 2784
389 Ga0495646_0217904 3300046680 Bacteria 1033
390 Ga0495658_0050367 3300046683 Bacteria 2356
391 Ga0495658_0195271 3300046683 Bacteria 1260
392 Ga0495649_0000753 3300046694 Bacteria 26030
393 Ga0495649_0009602 3300046694 Bacteria 5737
394 Ga0495649_0118606 3300046694 Bacteria 1400
395 Ga0495589_0000006 3300046794 Bacteria 303635
396 Ga0495600_0348901 3300046809 Bacteria 927
397 Ga0495660_0000168 3300046810 Bacteria 71020
398 Ga0495672_0000061 3300047320 Bacteria 212024
399 Ga0495676_0432061 3300047321 Bacteria 870
400 Ga0495687_000292 3300047443 Bacteria 65859
401 Ga0495679_000525 3300047446 Bacteria 27117
402 Ga0495679_022195 3300047446 Bacteria 2176
403 Ga0495626_0052133 3300048091 Bacteria 1886
404 Ga0495626_0141506 3300048091 Bacteria 1020
405 Ga0496100_0012039 3300048903 Bacteria 4946
406 Ga0496102_0001535 3300048905 Bacteria 20378
407 Ga0496102_0008488 3300048905 Bacteria 8806
408 Ga0496102_0010392 3300048905 Bacteria 8011
409 Ga0496104_0003670 3300048907 Bacteria 13255
410 Ga0496104_0481841 3300048907 Unclassified 1152
411 Ga0496105_0010300 3300048908 Bacteria 7349
412 Ga0496105_0154675 3300048908 Bacteria 1884
413 Ga0496114_0014236 3300048917 Bacteria 6381
414 Ga0496114_0366024 3300048917 Bacteria 1276
415 Ga0496116_0000031 3300048919 Bacteria 420043
416 Ga0496116_0000170 3300048919 Bacteria 131308
417 Ga0496116_0000320 3300048919 Bacteria 78683
418 Ga0496116_0000483 3300048919 Bacteria 54791
419 Ga0496116_0011470 3300048919 Bacteria 7327
420 Ga0496116_0012357 3300048919 Bacteria 6980
421 Ga0496116_0021410 3300048919 Bacteria 4879
422 Ga0496116_0034723 3300048919 Bacteria 3552
423 Ga0496116_0055910 3300048919 Bacteria 2589
424 Ga0496116_0159046 3300048919 Bacteria 1242
425 Ga0496117_0000199 3300048920 Bacteria 118320
426 Ga0496117_0000241 3300048920 Bacteria 103487
427 Ga0496117_0003831 3300048920 Bacteria 17103
428 Ga0496117_0004471 3300048920 Bacteria 15390
429 Ga0496117_0014277 3300048920 Bacteria 6853
430 Ga0496117_0043150 3300048920 Bacteria 3282
431 Ga0496117_0043319 3300048920 Bacteria 3273
432 Ga0496117_0266881 3300048920 Bacteria 924
433 Ga0496118_0001006 3300048921 Bacteria 43874
434 Ga0496118_0001337 3300048921 Bacteria 37414
435 Ga0496118_0001883 3300048921 Bacteria 29944
436 Ga0496118_0002359 3300048921 Bacteria 25582
437 Ga0496118_0004608 3300048921 Bacteria 16195
438 Ga0496118_0013591 3300048921 Bacteria 7685
439 Ga0496118_0042796 3300048921 Bacteria 3568
440 Ga0496118_0049316 3300048921 Bacteria 3243
441 Ga0496118_0054518 3300048921 Bacteria 3027
442 Ga0496118_0072893 3300048921 Bacteria 2463
443 Ga0496119_0000078 3300048922 Bacteria 140556
444 Ga0496119_0000101 3300048922 Bacteria 124548
445 Ga0496119_0000110 3300048922 Bacteria 115586
446 Ga0496119_0001277 3300048922 Bacteria 31234
447 Ga0496119_0005506 3300048922 Bacteria 12087
448 Ga0496119_0006856 3300048922 Bacteria 10421
449 Ga0496119_0026346 3300048922 Bacteria 4033
450 Ga0496119_0046405 3300048922 Bacteria 2714
451 Ga0496120_0000009 3300048923 Bacteria 386727
452 Ga0496120_0000151 3300048923 Bacteria 115582
453 Ga0496120_0000425 3300048923 Bacteria 67329
454 Ga0496120_0000439 3300048923 Bacteria 65920
455 Ga0496120_0005237 3300048923 Bacteria 10421
456 Ga0496120_0006196 3300048923 Bacteria 9245
457 Ga0496120_0006205 3300048923 Bacteria 9237
458 Ga0496120_0014731 3300048923 Bacteria 5192
459 Ga0496120_0027453 3300048923 Bacteria 3501
460 Ga0496121_0000041 3300048924 Bacteria 346686
461 Ga0496121_0005703 3300048924 Bacteria 15820
462 Ga0496121_0010460 3300048924 Bacteria 10464
463 Ga0496121_0333856 3300048924 Bacteria 1016
464 Ga0496122_0000571 3300048925 Bacteria 75468
465 Ga0496122_0001029 3300048925 Bacteria 49078
466 Ga0496122_0001807 3300048925 Bacteria 32779
467 Ga0496122_0021782 3300048925 Bacteria 5720
468 Ga0496122_0057679 3300048925 Bacteria 2881
469 Ga0496122_0084781 3300048925 Bacteria 2189
470 Ga0496122_0279028 3300048925 Bacteria 914
471 Ga0496123_0000430 3300048926 Bacteria 75549
472 Ga0496123_0000841 3300048926 Bacteria 49062
473 Ga0496123_0006614 3300048926 Bacteria 11193
474 Ga0496123_0009674 3300048926 Bacteria 8645
475 Ga0496123_0013355 3300048926 Bacteria 6903
476 Ga0496123_0090417 3300048926 Bacteria 1820
477 Ga0496123_0099371 3300048926 Bacteria 1698
478 Ga0496124_0000307 3300048927 Bacteria 90604
479 Ga0496124_0000474 3300048927 Bacteria 69115
480 Ga0496124_0000914 3300048927 Bacteria 47689
481 Ga0496124_0006220 3300048927 Bacteria 13078
482 Ga0496124_0023069 3300048927 Bacteria 5692
483 Ga0496124_0238384 3300048927 Bacteria 1354
484 Ga0496124_0266032 3300048927 Bacteria 1258
485 Ga0496125_0001606 3300048928 Bacteria 31934
486 Ga0496125_0009042 3300048928 Bacteria 10315
487 Ga0496125_0023589 3300048928 Bacteria 5675
488 Ga0496125_0059914 3300048928 Bacteria 3063
489 Ga0496125_0076988 3300048928 Bacteria 2573
490 Ga0496125_0248233 3300048928 Bacteria 1125
491 Ga0496126_0001894 3300048929 Bacteria 30181
492 Ga0496126_0011347 3300048929 Bacteria 9237
493 Ga0496126_0051547 3300048929 Bacteria 3745
494 Ga0496126_0219075 3300048929 Bacteria 1599
495 Ga0496126_0388122 3300048929 Bacteria 1135
496 Ga0496126_0543880 3300048929 Bacteria 922
497 Ga0501033_0172621 3300049570 Bacteria 1552
498 Ga0501034_0022606 3300049571 Bacteria 6406
499 Ga0501036_0017842 3300049572 Bacteria 5941
500 Ga0501038_0025148 3300049574 Bacteria 5309
501 Ga0501038_0136845 3300049574 Bacteria 2006
502 Ga0501039_0210767 3300049575 Bacteria 1528
503 Ga0501040_0000108 3300049576 Bacteria 42539
504 Ga0501042_0001266 3300049578 Bacteria 14716
505 Ga0501042_0018639 3300049578 Bacteria 4808
506 Ga0501043_0045292 3300049579 Bacteria 3460
507 Ga0501067_0050601 3300049583 Bacteria 2302
508 Ga0501072_0313085 3300049588 Bacteria 1248
509 Ga0501035_0014954 3300049822 Bacteria 7160
510 Ga0501044_0006131 3300049823 Bacteria 13273
511 nmdc:mga03n38_357047_c1 3300050490 Bacteria 796
512 nmdc:mga00v17_108077_c1 3300050491 Bacteria 1762
513 nmdc:mga0yw44_156306_c1 3300050492 Bacteria 1490
514 nmdc:mga0k408_1632_c2 3300050493 Bacteria 8253
515 nmdc:mga0k408_163847_c1 3300050493 Bacteria 1325
516 nmdc:mga0k408_24327_c1 3300050493 Bacteria 3423
517 nmdc:mga0k408_252_c1 3300050493 Bacteria 29077
518 nmdc:mga0k408_262773_c1 3300050493 Bacteria 1031
519 nmdc:mga0k408_297415_c1 3300050493 Bacteria 963
520 nmdc:mga0k408_429870_c1 3300050493 Bacteria 785
521 nmdc:mga0k408_81575_c1 3300050493 Bacteria 1482
522 nmdc:mga06z11_164409_c1 3300050494 Bacteria 1270
523 nmdc:mga06z11_17486_c1 3300050494 Bacteria 3256
524 nmdc:mga06z11_350620_c1 3300050494 Bacteria 883
525 nmdc:mga04h51_77832_c1 3300050495 Bacteria 1171
526 nmdc:mga07m45_11263_c1 3300050496 Bacteria 4695
527 nmdc:mga07m45_116065_c1 3300050496 Bacteria 1544
528 nmdc:mga07m45_139708_c1 3300050496 Bacteria 1403
529 nmdc:mga07m45_15790_c1 3300050496 Bacteria 4036
530 nmdc:mga07m45_49575_c1 3300050496 Bacteria 2364
531 nmdc:mga07m45_59785_c1 3300050496 Bacteria 2156
532 nmdc:mga0qj67_317961_c1 3300050509 Bacteria 1260
533 nmdc:mga06r32_377601_c1 3300050510 Unclassified 1400
534 nmdc:mga0a205_128794_c1 3300050515 Bacteria 2431
535 nmdc:mga0sz30_109435_c1 3300050516 Bacteria 1210
536 nmdc:mga0sz30_23594_c1 3300050516 Bacteria 2505
537 Ga0500578_0000040 3300053086 Bacteria 133601
538 Ga0500578_0103699 3300053086 Bacteria 1798
539 Ga0500644_0002701 3300053088 Bacteria 4429
540 Ga0500646_0007126 3300053090 Bacteria 2851
541 Ga0500651_0040785 3300053093 Bacteria 2925
542 Ga0500651_0063931 3300053093 Bacteria 2295
543 Ga0500593_004477 3300053117 Bacteria 5414
544 Ga0500594_0000600 3300053118 Bacteria 7720
545 Ga0500595_004643 3300053119 Bacteria 6122
546 Ga0500595_013872 3300053119 Bacteria 3074
547 Ga0500642_0003186 3300053130 Bacteria 4923
548 Ga0500652_010708 3300053131 Bacteria 3153
549 Ga0500559_0001133 3300053136 Bacteria 16045
550 Ga0500604_0028126 3300053151 Bacteria 1631
551 Ga0500619_000054 3300053154 Bacteria 34866
552 Ga0500622_0000138 3300053156 Bacteria 77892
553 Ga0500622_0139847 3300053156 Bacteria 1155
554 Ga0500636_0101701 3300053177 Bacteria 1633
555 Ga0587072_006503 3300059643 Bacteria 1783
556 Ga0501082_0764445 3300060353 Bacteria 846
557 Ga0530510_0531063 3300061734 Bacteria 893
558 2506576884 2506520007 Bacteria 5442880
559 2506582022 2506520008 Bacteria 5443009
560 2508850851 2508501071 Bacteria 5454741
561 2511380114 2511231025 Bacteria 5324661
562 2516088257 2515154203 Bacteria 5458536
563 2521560199 2521172590 Bacteria 5047645
564 2547697452 2547132181 Bacteria 4945084
565 2555260501 2554235234 Bacteria 5762085
566 2562466107 2561511199 Bacteria 5155034
567 2585829801 2585427591 Bacteria 5482980
568 2585833508 2585427592 Bacteria 5370892
569 2587725781 2585428057 Bacteria 6737412
570 2587735173 2585428058 Bacteria 6853932
571 2587758794 2585428062 Bacteria 6842168
572 2588290712 2588253510 Bacteria 6901809
573 2599409280 2599185169 Bacteria 5441380
574 2599444581 2599185178 Bacteria 5365746
575 2599926917 2599185299 Bacteria 4854625
576 2601522214 2600255254 Bacteria 5281859
577 2601527239 2600255255 Bacteria 5282785
578 2601536516 2600255256 Bacteria 5597742
579 2601541855 2600255257 Bacteria 5597196
580 2601614069 2600255280 Bacteria 5292309
581 2601618792 2600255281 Bacteria 5288753
582 2601642599 2600255287 Bacteria 5210468
583 2601647451 2600255288 Bacteria 5282738
584 2601652217 2600255289 Bacteria 5281907
585 2601657544 2600255290 Bacteria 5282218
586 2601662420 2600255291 Bacteria 5217298
587 2601695377 2600255298 Bacteria 5215185
588 2601700053 2600255299 Bacteria 5218662
589 2601705341 2600255300 Bacteria 5287774
590 2601710370 2600255301 Bacteria 5280532
591 2601715382 2600255302 Bacteria 5288235
592 2601720404 2600255303 Bacteria 5219315
593 2601725788 2600255304 Bacteria 5283973
594 2601730330 2600255305 Bacteria 5282329
595 2601735347 2600255306 Bacteria 5281613
596 2601740044 2600255307 Bacteria 5439064
597 2601750533 2600255309 Bacteria 5431045
598 2601760214 2600255310 Bacteria 5600903
599 2601765617 2600255311 Bacteria 5598766
600 2602017786 2600255392 Bacteria 5437392
601 2603638478 2602042046 Bacteria 5483348
602 2603659790 2602042052 Bacteria 5215873
603 2603665066 2602042053 Bacteria 5214361
604 2603837719 2602042103 Bacteria 5284714
605 2603842795 2602042104 Bacteria 5281639
606 2603847870 2602042105 Bacteria 5282303
607 2603852940 2602042106 Bacteria 5282744
608 2603866824 2602042109 Bacteria 5152801
609 2603870994 2602042110 Bacteria 5283285
610 2603875909 2602042111 Bacteria 5212080
611 2606048185 2603880178 Bacteria 5283018
612 2606069496 2603880184 Bacteria 5217896
613 2606145309 2603880202 Bacteria 5284684
614 2606175587 2603880211 Bacteria 5284226
615 2608668372 2608642108 Bacteria 4104624
616 2609912659 2609459761 Bacteria 5513740
617 2637225180 2636415599 Bacteria 5718434
618 2643770412 2643221550 Bacteria 4619371
619 2643972210 2643221592 Bacteria 6608788
620 2644049839 2643221607 Bacteria 6314006
621 2644131419 2643221623 Bacteria 5239945
622 2644141679 2643221625 Bacteria 6512927
623 2644202100 2643221636 Bacteria 6583769
624 2644247414 2643221644 Bacteria 6865017
625 2644275550 2643221648 Bacteria 6521465
626 2644338069 2643221660 Bacteria 4208257
627 2644482751 2643221686 Bacteria 6310811
628 2650897680 2648501693 Bacteria 5069560
629 2656279256 2654587920 Bacteria 5475511
630 2671107441 2667528173 Bacteria 5375747
631 2671589310 2671180115 Bacteria 5353919
632 2676406424 2675903046 Bacteria 5451247
633 2686355954 2684622997 Bacteria 4624240
634 2689443283 2687453601 Bacteria 5546041
635 2739309214 2738543024 Bacteria 5603683
636 2765571367 2765235838 Bacteria 5445269
637 2777023512 2775507074 Bacteria 5532402
638 2791922937 2791354903 Bacteria 4937680
639 2792313516 2791355010 Bacteria 4864581
640 2808943157 2808606379 Bacteria 5022697
641 2809124465 2808606414 Bacteria 4917181
642 2813729535 2811995292 Bacteria 5303342
643 2814697025 2814123068 Bacteria 5687681
644 2819616557 2818991449 Bacteria 5518009
645 2821271945 2821268502 Bacteria 3750023
646 2839099208 2839094727 Bacteria 5534556
647 2847088903 2847085930 Bacteria 5070450
648 2847801088 2847797336 Bacteria 5176640
649 2857578065 2857576091 Bacteria 5465855
650 2858466578 2858466076 Bacteria 4722413
651 2862293184 2862290372 Bacteria 7471434
652 2865018128 2865014394 Bacteria 4764573
653 2867350366 2867346516 Bacteria 7608576
654 2869552689 2869551831 Bacteria 5474685
655 2871273351 2871272651 Bacteria 5042015
656 2881612030 2881609920 Bacteria 4405319
657 2900054655 2900051742 Bacteria 4985156
658 2900581635 2900577576 Bacteria 5438534
659 2904440760 2904439833 Bacteria 5931679
660 2904476389 2904474040 Bacteria 5504324
661 2904506825 2904504865 Bacteria 5152820
662 2904513932 2904513164 Bacteria 5476410
663 2904535359 2904530477 Bacteria 5876334
664 2904588493 2904584206 Bacteria 6028872
665 2904594619 2904589729 Bacteria 6113573
666 2904605849 2904601388 Bacteria 5884906
667 2919048925 2919046199 Bacteria 5567169
668 2919084828 2919079590 Bacteria 5946433
669 2919112933 2919108558 Bacteria 5897419
670 2919152558 2919150387 Bacteria 5500879
671 2920760639 2920760137 Bacteria 7427611
672 2927145227 2927143783 Bacteria 5504251
673 2928062578 2928058823 Bacteria 5520022
674 2935629719 2935625433 Bacteria 5042964
675 2939622425 2939617950 Bacteria 4820956
676 2945879555 2945874760 Bacteria 5527237
677 2945954134 2945951305 Bacteria 4918162
678 2952255089 2952252522 Bacteria 4171745
679 2969082175 2969079654 Bacteria 5439582
680 2971824394 2971820967 Bacteria 5823634
681 2974437139 2974435778 Bacteria 4876478
682 2978976614 2978975091 Bacteria 4704313
683 2984495428 2984494565 Bacteria 5000175
684 2984564620 2984559226 Bacteria 5683096
685 2984597349 2984595703 Bacteria 5682994
686 2990265471 2990261002 Bacteria 4919493
687 3006497580 3006493962 Bacteria 8825450
688 640936436 640753048 Bacteria 5495657
689 8002289651 8002285264 Bacteria 6717907
690 8002291608 8002285264 Bacteria 6717907
691 8019509275 8019504834 Bacteria 4819156
692 8048136923 8048127548 Bacteria 11053136
693 8054849451 8054849141 Bacteria 5232694
694 8057306457 8057304971 Bacteria 4649742
695 Ga0055524_1000294
696 RicEn_C3495
697 SwRhRL2b_contig_306743
698 JGI24741J21665_1000336
699 JGI24740J21852_10001604
700 JGI24740J21852_10009850
701 JGI24739J22299_10000114
702 JGI25162J39368_1002152
703 JGI25163J39215_1000173
704 JGI25164J39214_1000066
705 JGI25152J39213_1003922
706 JGI25150J39212_1010208
707 JGI25153J46596_10004528
708 JGI25153J46596_10007742
709 rootL2_10022785
710 rootH1_10149035
711 Ga0055538_1000003
712 Ga0055538_1001269
713 Ga0055539_1000003
714 Ga0055539_1000123
715 Ga0055533_1000005
716 Ga0055533_1001648
717 Ga0055525_1000005
718 Ga0055525_1000794
719 Ga0055526_1002654
720 Ga0055530_10000963
721 Ga0055540_1000028
722 Ga0055531_10009192
723 Ga0055541_1000003
724 Ga0055541_1001207
725 Ga0058692_1000069
726 Ga0058692_1000203
727 Ga0058692_1000665
728 Ga0058692_1008309
729 Ga0058692_1009885
730 Ga0058692_1036770
731 Ga0065703_1018934
732 Ga0065704_10001388
733 Ga0070660_100196571
734 Ga0070661_100000057
735 Ga0070667_100313198
736 Ga0070709_10365546
737 Ga0070714_100014261
738 Ga0070713_100028574
739 Ga0070713_100172477
740 Ga0070663_100000011
741 Ga0070662_100024723
742 Ga0068867_100698050
743 Ga0070706_100011977
744 Ga0070707_100070549
745 Ga0070698_100271659
746 Ga0070699_100483500
747 Ga0068853_100201049
748 Ga0070665_100007940
749 Ga0070665_100022447
750 Ga0070665_100098496
751 Ga0070664_100000008
752 Ga0068857_100072457
753 Ga0068857_100430678
754 Ga0068856_100000009
755 Ga0070702_100572467
756 Ga0068852_100436747
757 Ga0068864_100012311
758 Ga0068864_100432172
759 Ga0068861_100974330
760 Ga0068863_100006252
761 Ga0068860_100000240
762 Ga0068860_100084454
763 Ga0068860_100149442
764 Ga0068860_100319321
765 Ga0068860_100811608
766 Ga0068862_100433432
767 Ga0081455_10031300
768 Ga0081539_10000528
769 Ga0075368_10029365
770 Ga0075362_10137353
771 Ga0075367_10001948
772 Ga0075369_10003023
773 Ga0075369_10115912
774 Ga0075366_10001982
775 Ga0075366_10011685
776 Ga0075366_10034102
777 Ga0075366_10044029
778 Ga0075366_10048597
779 Ga0075366_10092690
780 Ga0075366_10115386
781 Ga0075366_10232098
782 Ga0075366_10272627
783 Ga0075370_10001022
784 Ga0075370_10004484
785 Ga0075370_10007271
786 Ga0075370_10009710
787 Ga0075370_10029004
788 Ga0075370_10077923
789 Ga0075370_10113351
790 Ga0075428_100471573
791 Ga0075430_100254308
792 Ga0075433_10148227
793 Ga0079104_1000194
794 Ga0079104_1000388
795 Ga0079104_1001429
796 Ga0079104_1001784
797 Ga0105251_10000115
798 Ga0105251_10000439
799 Ga0105251_10000483
800 Ga0105251_10001004
801 Ga0105251_10001496
802 Ga0105251_10006794
803 Ga0105251_10042071
804 Ga0105251_10056262
805 Ga0105244_10000622
806 Ga0105244_10001238
807 Ga0105244_10001690
808 Ga0105244_10002104
809 Ga0105244_10002278
810 Ga0105244_10006228
811 Ga0105244_10020371
812 Ga0105244_10023525
813 Ga0105250_10000040
814 Ga0105250_10001631
815 Ga0105250_10008346
816 Ga0105250_10027462
817 Ga0105240_10318707
818 Ga0105240_11047609
819 Ga0111539_10758118
820 Ga0105247_10006154
821 Ga0105243_10110238
822 Ga0105243_10146432
823 Ga0105241_10000004
824 Ga0105248_10147100
825 Ga0105237_10003312
826 Ga0105249_10061510
827 Ga0105246_10020497
828 Ga0105246_10079150
829 Ga0157373_10002213
830 Ga0157373_10009569
831 Ga0157373_10289894
832 Ga0157371_10000068
833 Ga0157371_10001080
834 Ga0157371_10006758
835 Ga0157371_10014113
836 Ga0157371_10539069
837 Ga0157370_10000200
838 Ga0157370_10001699
839 Ga0157370_10066311
840 Ga0157369_10000420
841 Ga0157369_10027968
842 Ga0157369_10366998
843 Ga0157369_10587923
844 Ga0163162_10217753
845 Ga0163162_10364750
846 Ga0157372_10018738
847 Ga0157372_10028595
848 Ga0157372_10033015
849 Ga0157372_10060886
850 Ga0157372_10117557
851 Ga0157372_10117625
852 Ga0157372_10490141
853 Ga0157375_10061755
854 Ga0157375_10102374
855 Ga0163163_10135494
856 Ga0157380_10495398
857 Ga0182008_10000960
858 Ga0182008_10061756
859 Ga0157379_10080773
860 Ga0157379_10534679
861 Ga0182006_1008169
862 Ga0163161_10000107
863 Ga0197907_11371469
864 Ga0206355_1535507
865 Ga0213876_10000214
866 Ga0209760_100005
867 Ga0209760_102476
868 Ga0209784_100001
869 Ga0209784_100003
870 Ga0209566_100001
871 Ga0209566_100002
872 Ga0209674_100002
873 Ga0209674_100008
874 Ga0209563_100002
875 Ga0209563_100004
876 Ga0207427_100009
877 Ga0209437_100001
878 Ga0209437_100199
879 Ga0207425_1000238
880 Ga0209677_100002
881 Ga0209677_100009
882 Ga0209759_1003952
883 Ga0209129_1000062
884 Ga0209129_1000221
885 Ga0209564_1000014
886 Ga0209758_1000126
887 Ga0209758_1000129
888 Ga0209050_1001372
889 Ga0209050_1007618
890 Ga0209256_1000015
891 Ga0209051_1000022
892 Ga0209051_1019429
893 Ga0209257_1000030
894 Ga0209257_1029323
895 Ga0207696_1000026
896 Ga0207696_1000033
897 Ga0207696_1000077
898 Ga0207696_1000723
899 Ga0207696_1000885
900 Ga0207696_1008410
901 Ga0207655_1000023
902 Ga0207655_1000040
903 Ga0207655_1000210
904 Ga0207655_1000683
905 Ga0207655_1006158
906 Ga0207655_1008020
907 Ga0207655_1009495
908 Ga0207655_1009627
909 Ga0207655_1014240
910 Ga0207713_1000001
911 Ga0207713_1000040
912 Ga0207713_1000065
913 Ga0207713_1000147
914 Ga0207713_1000554
915 Ga0207713_1009276
916 Ga0207713_1024757
917 Ga0207710_10000016
918 Ga0207699_10234693
919 Ga0207645_10098491
920 Ga0207684_10008362
921 Ga0207654_10000006
922 Ga0207695_10195284
923 Ga0207671_10007383
924 Ga0207649_10000334
925 Ga0207700_10003125
926 Ga0207700_10104859
927 Ga0207706_10093566
928 Ga0207709_10108164
929 Ga0207711_10092639
930 Ga0207689_10115026
931 Ga0207661_10425300
932 Ga0207679_10000001
933 Ga0207712_10420532
934 Ga0207658_10175131
935 Ga0207677_10334422
936 Ga0207703_10117439
937 Ga0207703_10161742
938 Ga0207639_10266038
939 Ga0207678_10000001
940 Ga0207678_10358609
941 Ga0207702_10000024
942 Ga0207641_10023218
943 Ga0207648_10511541
944 Ga0207676_10036602
945 Ga0207674_10421760
946 Ga0207675_100430033
947 Ga0207675_100466172
948 Ga0209281_1000008
949 Ga0209281_1000083
950 Ga0209281_1000093
951 Ga0209281_1003968
952 Ga0209371_1000010
953 Ga0209371_1000026
954 Ga0209371_1000081
955 Ga0209371_1000140
956 Ga0209371_1000175
957 Ga0209371_1001555
958 Ga0209371_1002251
959 Ga0209371_1006379
960 Ga0209371_1011028
961 Ga0209371_1043932
962 Ga0207428_10304004
963 Ga0268266_10065245
964 Ga0268266_10192124
965 Ga0268265_10365380
966 Ga0268264_10000035
967 Ga0268264_10246734
968 Ga0307517_10004249
969 Ga0307517_10153629
970 Ga0307515_10007857
971 Ga0307515_10016105
972 Ga0307515_10069956
973 Ga0307515_10092906
974 Ga0307515_10208414
975 Ga0268256_1000003
976 Ga0268256_1000094
977 Ga0268256_1000102
978 Ga0268256_1000136
979 Ga0268256_1000400
980 Ga0268256_1001329
981 Ga0268256_1001989
982 Ga0268256_1011917
983 Ga0268256_1014995
984 Ga0268256_1025635
985 Ga0307512_10054219
986 Ga0307512_10076673
987 Ga0265330_10002010
988 Ga0265328_10033952
989 Ga0265325_10140018
990 Ga0265340_10006737
991 Ga0265339_10048947
992 Ga0307513_10010816
993 Ga0307513_10064429
994 Ga0307513_10092127
995 Ga0307513_10256746
996 Ga0307513_10272978
997 Ga0307509_10001361
998 Ga0307509_10089253
999 Ga0307509_10104206
1000 Ga0307408_100285991
1001 Ga0307508_10000023
1002 Ga0307508_10001573
1003 Ga0307508_10061271
1004 Ga0307508_10091161
1005 Ga0307508_10216461
1006 Ga0307514_10033311
1007 Ga0307514_10048470
1008 Ga0307514_10231874
1009 Ga0307516_10013210
1010 Ga0307412_10470693
1011 Ga0307507_10063836
1012 Ga0307507_10318071
1013 Ga0307510_10001484
1014 Ga0307510_10029737
1015 Ga0307510_10042584
1016 Ga0373937_0095407
1017 Ga0395900_0018700
1018 Ga0395905_0331421
1019 Ga0395905_0377597
1020 Ga0395901_0071423
1021 Ga0400483_082990
1022 Ga0436365_0065679
1023 Ga0436365_1279401
1024 Ga0439438_000177
1025 Ga0439447_003944
1026 Ga0439447_025932
1027 Ga0439466_0000032
1028 Ga0451841_0729203
1029 Ga0451853_3000726
1030 Ga0439432_002543
1031 Ga0439432_014373
1032 Ga0439432_021150
1033 Ga0439449_0054049
1034 Ga0439452_000017
1035 Ga0439452_000038
1036 Ga0439452_006035
1037 Ga0450919_001482
1038 Ga0450923_037140
1039 Ga0450907_001977
1040 Ga0439464_0007569
1041 Ga0450918_000218
1042 Ga0450893_0013015
1043 Ga0466986_0027770
1044 Ga0466969_0029264
1045 Ga0466972_0024943
1046 Ga0466966_0159536
1047 Ga0466961_0000955
1048 Ga0466961_0115747
1049 Ga0453684_0064148
1050 Ga0453684_0121301
1051 Ga0466959_0006078
1052 Ga0466959_0100291
1053 Ga0495627_000194
1054 Ga0495592_0000495
1055 Ga0495590_0037437
1056 Ga0495591_001140
1057 Ga0495638_0002788
1058 Ga0495638_0033538
1059 Ga0495650_0000386
1060 Ga0495650_0019141
1061 Ga0495585_0154604
1062 Ga0495620_0000814
1063 Ga0495620_0176383
1064 Ga0495630_0026460
1065 Ga0495632_0024113
1066 Ga0495632_0061634
1067 Ga0495632_0093708
1068 Ga0495637_0057358
1069 Ga0495643_0075680
1070 Ga0495643_0106844
1071 Ga0495643_0113084
1072 Ga0495648_0012690
1073 Ga0495648_0068827
1074 Ga0495648_0080739
1075 Ga0495642_0212551
1076 Ga0495654_0004782
1077 Ga0495654_0060778
1078 Ga0495587_0260459
1079 Ga0495597_0048843
1080 Ga0495625_0001105
1081 Ga0495625_0004561
1082 Ga0495625_0056814
1083 Ga0495646_0217904
1084 Ga0495658_0050367
1085 Ga0495658_0195271
1086 Ga0495649_0000753
1087 Ga0495649_0009602
1088 Ga0495649_0118606
1089 Ga0495589_0000006
1090 Ga0495600_0348901
1091 Ga0495660_0000168
1092 Ga0495672_0000061
1093 Ga0495676_0432061
1094 Ga0495687_000292
1095 Ga0495679_000525
1096 Ga0495679_022195
1097 Ga0495626_0052133
1098 Ga0495626_0141506
1099 Ga0496100_0012039
1100 Ga0496102_0001535
1101 Ga0496102_0008488
1102 Ga0496102_0010392
1103 Ga0496104_0003670
1104 Ga0496104_0481841
1105 Ga0496105_0010300
1106 Ga0496105_0154675
1107 Ga0496114_0014236
1108 Ga0496114_0366024
1109 Ga0496116_0000031
1110 Ga0496116_0000170
1111 Ga0496116_0000320
1112 Ga0496116_0000483
1113 Ga0496116_0011470
1114 Ga0496116_0012357
1115 Ga0496116_0021410
1116 Ga0496116_0034723
1117 Ga0496116_0055910
1118 Ga0496116_0159046
1119 Ga0496117_0000199
1120 Ga0496117_0000241
1121 Ga0496117_0003831
1122 Ga0496117_0004471
1123 Ga0496117_0014277
1124 Ga0496117_0043150
1125 Ga0496117_0043319
1126 Ga0496117_0266881
1127 Ga0496118_0001006
1128 Ga0496118_0001337
1129 Ga0496118_0001883
1130 Ga0496118_0002359
1131 Ga0496118_0004608
1132 Ga0496118_0013591
1133 Ga0496118_0042796
1134 Ga0496118_0049316
1135 Ga0496118_0054518
1136 Ga0496118_0072893
1137 Ga0496119_0000078
1138 Ga0496119_0000101
1139 Ga0496119_0000110
1140 Ga0496119_0001277
1141 Ga0496119_0005506
1142 Ga0496119_0006856
1143 Ga0496119_0026346
1144 Ga0496119_0046405
1145 Ga0496120_0000009
1146 Ga0496120_0000151
1147 Ga0496120_0000425
1148 Ga0496120_0000439
1149 Ga0496120_0005237
1150 Ga0496120_0006196
1151 Ga0496120_0006205
1152 Ga0496120_0014731
1153 Ga0496120_0027453
1154 Ga0496121_0000041
1155 Ga0496121_0005703
1156 Ga0496121_0010460
1157 Ga0496121_0333856
1158 Ga0496122_0000571
1159 Ga0496122_0001029
1160 Ga0496122_0001807
1161 Ga0496122_0021782
1162 Ga0496122_0057679
1163 Ga0496122_0084781
1164 Ga0496122_0279028
1165 Ga0496123_0000430
1166 Ga0496123_0000841
1167 Ga0496123_0006614
1168 Ga0496123_0009674
1169 Ga0496123_0013355
1170 Ga0496123_0090417
1171 Ga0496123_0099371
1172 Ga0496124_0000307
1173 Ga0496124_0000474
1174 Ga0496124_0000914
1175 Ga0496124_0006220
1176 Ga0496124_0023069
1177 Ga0496124_0238384
1178 Ga0496124_0266032
1179 Ga0496125_0001606
1180 Ga0496125_0009042
1181 Ga0496125_0023589
1182 Ga0496125_0059914
1183 Ga0496125_0076988
1184 Ga0496125_0248233
1185 Ga0496126_0001894
1186 Ga0496126_0011347
1187 Ga0496126_0051547
1188 Ga0496126_0219075
1189 Ga0496126_0388122
1190 Ga0496126_0543880
1191 Ga0501033_0172621
1192 Ga0501034_0022606
1193 Ga0501036_0017842
1194 Ga0501038_0025148
1195 Ga0501038_0136845
1196 Ga0501039_0210767
1197 Ga0501040_0000108
1198 Ga0501042_0001266
1199 Ga0501042_0018639
1200 Ga0501043_0045292
1201 Ga0501067_0050601
1202 Ga0501072_0313085
1203 Ga0501035_0014954
1204 Ga0501044_0006131
1205 nmdc:mga03n38_357047_c1
1206 nmdc:mga00v17_108077_c1
1207 nmdc:mga0yw44_156306_c1
1208 nmdc:mga0k408_1632_c2
1209 nmdc:mga0k408_163847_c1
1210 nmdc:mga0k408_24327_c1
1211 nmdc:mga0k408_252_c1
1212 nmdc:mga0k408_262773_c1
1213 nmdc:mga0k408_297415_c1
1214 nmdc:mga0k408_429870_c1
1215 nmdc:mga0k408_81575_c1
1216 nmdc:mga06z11_164409_c1
1217 nmdc:mga06z11_17486_c1
1218 nmdc:mga06z11_350620_c1
1219 nmdc:mga04h51_77832_c1
1220 nmdc:mga07m45_11263_c1
1221 nmdc:mga07m45_116065_c1
1222 nmdc:mga07m45_139708_c1
1223 nmdc:mga07m45_15790_c1
1224 nmdc:mga07m45_49575_c1
1225 nmdc:mga07m45_59785_c1
1226 nmdc:mga0qj67_317961_c1
1227 nmdc:mga06r32_377601_c1
1228 nmdc:mga0a205_128794_c1
1229 nmdc:mga0sz30_109435_c1
1230 nmdc:mga0sz30_23594_c1
1231 Ga0500578_0000040
1232 Ga0500578_0103699
1233 Ga0500644_0002701
1234 Ga0500646_0007126
1235 Ga0500651_0040785
1236 Ga0500651_0063931
1237 Ga0500593_004477
1238 Ga0500594_0000600
1239 Ga0500595_004643
1240 Ga0500595_013872
1241 Ga0500642_0003186
1242 Ga0500652_010708
1243 Ga0500559_0001133
1244 Ga0500604_0028126
1245 Ga0500619_000054
1246 Ga0500622_0000138
1247 Ga0500622_0139847
1248 Ga0500636_0101701
1249 Ga0587072_006503
1250 Ga0501082_0764445
1251 Ga0530510_0531063
1252 2506576884
1253 2506582022
1254 2508850851
1255 2511380114
1256 2516088257
1257 2521560199
1258 2547697452
1259 2555260501
1260 2562466107
1261 2585829801
1262 2585833508
1263 2587725781
1264 2587735173
1265 2587758794
1266 2588290712
1267 2599409280
1268 2599444581
1269 2599926917
1270 2601522214
1271 2601527239
1272 2601536516
1273 2601541855
1274 2601614069
1275 2601618792
1276 2601642599
1277 2601647451
1278 2601652217
1279 2601657544
1280 2601662420
1281 2601695377
1282 2601700053
1283 2601705341
1284 2601710370
1285 2601715382
1286 2601720404
1287 2601725788
1288 2601730330
1289 2601735347
1290 2601740044
1291 2601750533
1292 2601760214
1293 2601765617
1294 2602017786
1295 2603638478
1296 2603659790
1297 2603665066
1298 2603837719
1299 2603842795
1300 2603847870
1301 2603852940
1302 2603866824
1303 2603870994
1304 2603875909
1305 2606048185
1306 2606069496
1307 2606145309
1308 2606175587
1309 2608668372
1310 2609912659
1311 2637225180
1312 2643770412
1313 2643972210
1314 2644049839
1315 2644131419
1316 2644141679
1317 2644202100
1318 2644247414
1319 2644275550
1320 2644338069
1321 2644482751
1322 2650897680
1323 2656279256
1324 2671107441
1325 2671589310
1326 2676406424
1327 2686355954
1328 2689443283
1329 2739309214
1330 2765571367
1331 2777023512
1332 2791922937
1333 2792313516
1334 2808943157
1335 2809124465
1336 2813729535
1337 2814697025
1338 2819616557
1339 2821271945
1340 2839099208
1341 2847088903
1342 2847801088
1343 2857578065
1344 2858466578
1345 2862293184
1346 2865018128
1347 2867350366
1348 2869552689
1349 2871273351
1350 2881612030
1351 2900054655
1352 2900581635
1353 2904440760
1354 2904476389
1355 2904506825
1356 2904513932
1357 2904535359
1358 2904588493
1359 2904594619
1360 2904605849
1361 2919048925
1362 2919084828
1363 2919112933
1364 2919152558
1365 2920760639
1366 2927145227
1367 2928062578
1368 2935629719
1369 2939622425
1370 2945879555
1371 2945954134
1372 2952255089
1373 2969082175
1374 2971824394
1375 2974437139
1376 2978976614
1377 2984495428
1378 2984564620
1379 2984597349
1380 2990265471
1381 3006497580
1382 640936436
1383 8002289651
1384 8002291608
1385 8019509275
1386 8048136923
1387 8054849451
1388 8057306457

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

48

255

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qvj-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9901 3 246
3qvk-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.99 3 246
3qvj-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9821 3 246
3qvk-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.982 3 246
5lfd-assembly1.cif.gz_A crystal structure of allantoin racemase from pseudomonas fluorescens allr 0.9567 4 239
ID Description Score Start End Superfamily
3qvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9872 3 246 3.40.50.12500
3qvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9791 3 246 3.40.50.12500
5lfdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9567 4 239 3.40.50.12500
5lfdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9527 4 239 3.40.50.12500
af_Q09921_2_237_3.40.50.12500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9218 4 229 3.40.50.12500
ID Description Score Start End GO Terms
AF-A0A7X2MTC4-F1-model_v4 Allantoin racemase (EC 5.1.99.3) 1.002 4 133 GO:0036361
GO:0047653
AF-A0A3B8YIV1-F1-model_v4 deleted 1.001 4 149
AF-A0A7Z8GH71-F1-model_v4 deleted 0.9987 4 107
AF-A0A378F4P8-F1-model_v4 Putative hydantoin racemase 0.994 77 235 GO:0036361
AF-A0A3B8YIV1-F1-model_v4 deleted 0.9938 4 149

Map