F475702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 274 | 1388 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100002197|Ga0070680_1000021973 |
| Length | 338 |
| Sequence | MPGTRLRLVFAGTPDFAVPGLRACIEAGEVVAVYTQPDRPAGRGRKLAPSPVKQAALAAGLPVEQPESLKISETQARLRDWAPDLMVVIAYGLILPRKVLAIPRLGCWNLHASLLPRWRGAAPIQRAILAGDAETGVCLMQMEPGLDTGPVLLSESTPIRADDTGGTLHDRLADIGARVLRAGLQRVIAGESMSAMPQSGAGATYAHKLEKSEAELDFSRPAIELERKVRAFDPWPVAEADVAGERVRVWHALAVPSPESRETRRSCGSPSGPSASPMFAPASCLRSPSPGQIVAASKRGIDIVCGEGALRILKLQRAGGRVIGAADYVNARAGLRQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 171 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 172 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 221 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 222 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 225 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 226 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 227 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 253 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 254 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 256 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 257 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 263 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 264 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 265 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 266 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 267 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 268 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 269 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 270 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 271 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 272 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 273 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 274 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.54 |
| Metatranscriptomes | 1.73 |
| Isolates | 1.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.79 |
| Nodule | 0 |
| Rhizoplane | 1.44 |
| Rhizosphere | 82.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100002197 | 3300005336 | Bacteria | 14383 |
| 2 | JGI24741J21665_1000076 | 3300001915 | Bacteria | 24422 |
| 3 | JGI24741J21665_1005437 | 3300001915 | Bacteria | 2662 |
| 4 | JGI24740J21852_10000279 | 3300001979 | Bacteria | 21672 |
| 5 | JGI24740J21852_10005082 | 3300001979 | Bacteria | 5586 |
| 6 | JGI25156J39149_1002783 | 3300002705 | Bacteria | 6064 |
| 7 | JGI25156J39149_1009367 | 3300002705 | Bacteria | 2388 |
| 8 | JGI25162J39368_1001445 | 3300002737 | Bacteria | 12645 |
| 9 | JGI25162J39368_1003044 | 3300002737 | Bacteria | 5436 |
| 10 | JGI25154J39366_1004509 | 3300002738 | Bacteria | 2480 |
| 11 | JGI25157J39369_1000344 | 3300002741 | Bacteria | 32837 |
| 12 | JGI25157J39369_1001046 | 3300002741 | Bacteria | 12637 |
| 13 | JGI25163J39215_1000588 | 3300002771 | Bacteria | 10200 |
| 14 | JGI25164J39214_1000117 | 3300002772 | Bacteria | 76695 |
| 15 | JGI25164J39214_1000714 | 3300002772 | Bacteria | 12645 |
| 16 | JGI25164J39214_1000865 | 3300002772 | Bacteria | 10312 |
| 17 | JGI25165J46597_1000235 | 3300003214 | Bacteria | 76684 |
| 18 | JGI25165J46597_1001443 | 3300003214 | Bacteria | 12645 |
| 19 | JGI25165J46597_1001780 | 3300003214 | Bacteria | 9280 |
| 20 | Ga0055533_1001538 | 3300003756 | Bacteria | 6012 |
| 21 | Ga0055527_1003026 | 3300003760 | Bacteria | 2614 |
| 22 | Ga0055535_1000941 | 3300003761 | Bacteria | 19328 |
| 23 | Ga0055535_1001080 | 3300003761 | Bacteria | 16755 |
| 24 | Ga0055535_1001379 | 3300003761 | Bacteria | 12645 |
| 25 | Ga0055542_1000245 | 3300003762 | Bacteria | 62120 |
| 26 | Ga0055542_1001179 | 3300003762 | Bacteria | 14972 |
| 27 | Ga0055542_1001180 | 3300003762 | Bacteria | 14953 |
| 28 | Ga0055542_1001349 | 3300003762 | Bacteria | 12645 |
| 29 | Ga0055529_1000314 | 3300003763 | Bacteria | 55435 |
| 30 | Ga0055529_1001072 | 3300003763 | Bacteria | 12645 |
| 31 | Ga0055529_1002135 | 3300003763 | Bacteria | 4157 |
| 32 | Ga0070658_10002163 | 3300005327 | Bacteria | 16493 |
| 33 | Ga0070683_100015187 | 3300005329 | Bacteria | 6760 |
| 34 | Ga0070683_100015955 | 3300005329 | Bacteria | 6608 |
| 35 | Ga0070683_100293315 | 3300005329 | Bacteria | 1547 |
| 36 | Ga0070690_100029514 | 3300005330 | Bacteria | 3402 |
| 37 | Ga0070670_100227448 | 3300005331 | Bacteria | 1623 |
| 38 | Ga0068869_100124752 | 3300005334 | Bacteria | 1973 |
| 39 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 40 | Ga0070666_10052751 | 3300005335 | Bacteria | 2741 |
| 41 | Ga0070680_100000946 | 3300005336 | Bacteria | 20577 |
| 42 | Ga0070680_100100120 | 3300005336 | Bacteria | 2405 |
| 43 | Ga0070682_100014480 | 3300005337 | Bacteria | 4559 |
| 44 | Ga0070682_100014970 | 3300005337 | Bacteria | 4491 |
| 45 | Ga0070682_100015837 | 3300005337 | Bacteria | 4375 |
| 46 | Ga0070682_100045315 | 3300005337 | Bacteria | 2726 |
| 47 | Ga0068868_100016923 | 3300005338 | Bacteria | 5424 |
| 48 | Ga0068868_100266644 | 3300005338 | Bacteria | 1446 |
| 49 | Ga0070660_100046496 | 3300005339 | Bacteria | 3327 |
| 50 | Ga0070660_100049491 | 3300005339 | Bacteria | 3231 |
| 51 | Ga0070660_100163024 | 3300005339 | Bacteria | 1797 |
| 52 | Ga0070661_100002526 | 3300005344 | Bacteria | 12533 |
| 53 | Ga0070661_100003952 | 3300005344 | Bacteria | 10199 |
| 54 | Ga0070661_100034435 | 3300005344 | Bacteria | 3672 |
| 55 | Ga0070661_100096555 | 3300005344 | Bacteria | 2193 |
| 56 | Ga0070692_10000307 | 3300005345 | Bacteria | 13933 |
| 57 | Ga0070692_10000420 | 3300005345 | Bacteria | 12798 |
| 58 | Ga0070692_10159273 | 3300005345 | Bacteria | 1292 |
| 59 | Ga0070668_100064734 | 3300005347 | Bacteria | 2835 |
| 60 | Ga0070675_100074093 | 3300005354 | Bacteria | 2827 |
| 61 | Ga0070688_100125161 | 3300005365 | Bacteria | 1727 |
| 62 | Ga0070659_100013061 | 3300005366 | Bacteria | 6176 |
| 63 | Ga0070659_100028080 | 3300005366 | Bacteria | 4342 |
| 64 | Ga0070667_100013367 | 3300005367 | Bacteria | 6786 |
| 65 | Ga0070667_100139556 | 3300005367 | Bacteria | 2121 |
| 66 | Ga0070667_100317045 | 3300005367 | Bacteria | 1406 |
| 67 | Ga0070714_100000136 | 3300005435 | Bacteria | 58402 |
| 68 | Ga0070711_100024811 | 3300005439 | Bacteria | 3916 |
| 69 | Ga0070663_100035443 | 3300005455 | Bacteria | 3463 |
| 70 | Ga0070662_100065358 | 3300005457 | Bacteria | 2666 |
| 71 | Ga0070662_100175736 | 3300005457 | Bacteria | 1685 |
| 72 | Ga0070681_10000552 | 3300005458 | Bacteria | 30843 |
| 73 | Ga0070681_10003671 | 3300005458 | Bacteria | 14393 |
| 74 | Ga0070681_10004860 | 3300005458 | Bacteria | 12890 |
| 75 | Ga0070681_10007360 | 3300005458 | Bacteria | 10759 |
| 76 | Ga0070681_10039513 | 3300005458 | Bacteria | 4729 |
| 77 | Ga0070681_10045534 | 3300005458 | Bacteria | 4389 |
| 78 | Ga0070681_10207387 | 3300005458 | Bacteria | 1876 |
| 79 | Ga0068867_100308495 | 3300005459 | Bacteria | 1307 |
| 80 | Ga0070685_10002434 | 3300005466 | Bacteria | 9568 |
| 81 | Ga0070685_10013112 | 3300005466 | Bacteria | 4364 |
| 82 | Ga0070679_100002097 | 3300005530 | Bacteria | 17962 |
| 83 | Ga0070679_100003490 | 3300005530 | Bacteria | 14393 |
| 84 | Ga0070679_100012167 | 3300005530 | Bacteria | 8221 |
| 85 | Ga0070679_100049404 | 3300005530 | Bacteria | 4189 |
| 86 | Ga0070679_100160069 | 3300005530 | Bacteria | 2226 |
| 87 | Ga0070684_100008594 | 3300005535 | Bacteria | 7998 |
| 88 | Ga0070684_100010992 | 3300005535 | Bacteria | 7199 |
| 89 | Ga0070684_100388599 | 3300005535 | Bacteria | 1286 |
| 90 | Ga0068853_100002290 | 3300005539 | Bacteria | 14303 |
| 91 | Ga0068853_100015163 | 3300005539 | Bacteria | 6336 |
| 92 | Ga0068853_100044837 | 3300005539 | Bacteria | 3786 |
| 93 | Ga0068853_100059863 | 3300005539 | Bacteria | 3290 |
| 94 | Ga0068853_100063960 | 3300005539 | Bacteria | 3188 |
| 95 | Ga0068853_100073444 | 3300005539 | Bacteria | 2982 |
| 96 | Ga0068853_100214666 | 3300005539 | Bacteria | 1755 |
| 97 | Ga0070672_100029858 | 3300005543 | Bacteria | 4092 |
| 98 | Ga0070686_100035506 | 3300005544 | Bacteria | 3080 |
| 99 | Ga0070696_100034217 | 3300005546 | Bacteria | 3495 |
| 100 | Ga0070696_100154920 | 3300005546 | Bacteria | 1684 |
| 101 | Ga0070693_100006423 | 3300005547 | Bacteria | 5697 |
| 102 | Ga0070693_100010956 | 3300005547 | Bacteria | 4556 |
| 103 | Ga0070693_100019703 | 3300005547 | Bacteria | 3543 |
| 104 | Ga0070693_100101715 | 3300005547 | Bacteria | 1752 |
| 105 | Ga0070665_100000712 | 3300005548 | Bacteria | 44327 |
| 106 | Ga0070665_100009799 | 3300005548 | Bacteria | 9687 |
| 107 | Ga0070665_100026563 | 3300005548 | Bacteria | 5829 |
| 108 | Ga0068855_100016860 | 3300005563 | Bacteria | 8784 |
| 109 | Ga0068855_100108668 | 3300005563 | Bacteria | 3185 |
| 110 | Ga0068855_100123760 | 3300005563 | Bacteria | 2958 |
| 111 | Ga0068855_100254647 | 3300005563 | Bacteria | 1957 |
| 112 | Ga0068855_100493937 | 3300005563 | Bacteria | 1331 |
| 113 | Ga0068855_100505101 | 3300005563 | Bacteria | 1313 |
| 114 | Ga0070664_100146377 | 3300005564 | Bacteria | 2083 |
| 115 | Ga0068857_100068091 | 3300005577 | Bacteria | 3169 |
| 116 | Ga0068854_100000026 | 3300005578 | Bacteria | 118880 |
| 117 | Ga0068854_100003525 | 3300005578 | Bacteria | 9775 |
| 118 | Ga0068854_100006081 | 3300005578 | Bacteria | 7656 |
| 119 | Ga0068856_100003430 | 3300005614 | Bacteria | 16024 |
| 120 | Ga0068856_100003717 | 3300005614 | Bacteria | 15310 |
| 121 | Ga0068856_100086051 | 3300005614 | Bacteria | 3123 |
| 122 | Ga0068856_100154783 | 3300005614 | Bacteria | 2302 |
| 123 | Ga0068856_100258841 | 3300005614 | Bacteria | 1755 |
| 124 | Ga0068852_100002438 | 3300005616 | Bacteria | 12803 |
| 125 | Ga0068852_100027419 | 3300005616 | Bacteria | 4642 |
| 126 | Ga0068852_100046785 | 3300005616 | Bacteria | 3687 |
| 127 | Ga0068852_100077654 | 3300005616 | Bacteria | 2936 |
| 128 | Ga0068852_100081911 | 3300005616 | Bacteria | 2866 |
| 129 | Ga0068852_100093186 | 3300005616 | Bacteria | 2699 |
| 130 | Ga0068859_100185524 | 3300005617 | Bacteria | 2164 |
| 131 | Ga0068859_100194926 | 3300005617 | Bacteria | 2110 |
| 132 | Ga0068864_100001937 | 3300005618 | Bacteria | 17002 |
| 133 | Ga0068864_100169015 | 3300005618 | Bacteria | 1992 |
| 134 | Ga0068864_100441945 | 3300005618 | Bacteria | 1242 |
| 135 | Ga0068851_10003106 | 3300005834 | Bacteria | 7357 |
| 136 | Ga0068851_10027637 | 3300005834 | Bacteria | 2797 |
| 137 | Ga0068851_10050072 | 3300005834 | Bacteria | 2120 |
| 138 | Ga0068870_10063166 | 3300005840 | Bacteria | 1997 |
| 139 | Ga0068863_100113210 | 3300005841 | Bacteria | 2584 |
| 140 | Ga0068863_100179577 | 3300005841 | Bacteria | 2032 |
| 141 | Ga0068863_100312146 | 3300005841 | Bacteria | 1526 |
| 142 | Ga0068863_100333736 | 3300005841 | Bacteria | 1474 |
| 143 | Ga0068858_100003930 | 3300005842 | Bacteria | 14672 |
| 144 | Ga0068858_100072506 | 3300005842 | Bacteria | 3195 |
| 145 | Ga0068860_100000822 | 3300005843 | Bacteria | 34721 |
| 146 | Ga0068860_100012637 | 3300005843 | Bacteria | 8308 |
| 147 | Ga0097621_100052340 | 3300006237 | Bacteria | 3326 |
| 148 | Ga0097621_100069711 | 3300006237 | Bacteria | 2903 |
| 149 | Ga0097621_100122753 | 3300006237 | Bacteria | 2205 |
| 150 | Ga0068871_100450501 | 3300006358 | Bacteria | 1153 |
| 151 | Ga0068865_100003462 | 3300006881 | Bacteria | 9456 |
| 152 | Ga0068865_100025746 | 3300006881 | Bacteria | 3874 |
| 153 | Ga0068865_100050142 | 3300006881 | Bacteria | 2882 |
| 154 | Ga0097620_100185528 | 3300006931 | Bacteria | 2164 |
| 155 | Ga0097620_100194937 | 3300006931 | Bacteria | 2110 |
| 156 | Ga0105240_10003317 | 3300009093 | Bacteria | 25157 |
| 157 | Ga0105240_10035352 | 3300009093 | Bacteria | 6440 |
| 158 | Ga0105240_10076161 | 3300009093 | Bacteria | 4137 |
| 159 | Ga0105240_10115212 | 3300009093 | Bacteria | 3245 |
| 160 | Ga0105240_10173120 | 3300009093 | Bacteria | 2555 |
| 161 | Ga0105240_10289346 | 3300009093 | Bacteria | 1879 |
| 162 | Ga0105245_10479507 | 3300009098 | Bacteria | 1257 |
| 163 | Ga0105247_10000804 | 3300009101 | Bacteria | 23935 |
| 164 | Ga0105241_10036533 | 3300009174 | Bacteria | 3697 |
| 165 | Ga0105241_10212677 | 3300009174 | Bacteria | 1621 |
| 166 | Ga0105241_10535294 | 3300009174 | Bacteria | 1049 |
| 167 | Ga0105242_10153044 | 3300009176 | Bacteria | 2013 |
| 168 | Ga0105248_10190603 | 3300009177 | Bacteria | 2310 |
| 169 | Ga0105237_10000108 | 3300009545 | Bacteria | 116481 |
| 170 | Ga0105237_10022010 | 3300009545 | Bacteria | 6543 |
| 171 | Ga0105237_10060807 | 3300009545 | Bacteria | 3778 |
| 172 | Ga0105237_10168033 | 3300009545 | Bacteria | 2193 |
| 173 | Ga0105237_10224269 | 3300009545 | Bacteria | 1880 |
| 174 | Ga0105237_10663088 | 3300009545 | Bacteria | 1050 |
| 175 | Ga0105238_10000729 | 3300009551 | Bacteria | 34322 |
| 176 | Ga0105238_10001656 | 3300009551 | Bacteria | 22366 |
| 177 | Ga0105238_10023815 | 3300009551 | Bacteria | 6241 |
| 178 | Ga0105238_10029898 | 3300009551 | Bacteria | 5547 |
| 179 | Ga0105238_10033003 | 3300009551 | Bacteria | 5268 |
| 180 | Ga0105238_10042081 | 3300009551 | Bacteria | 4626 |
| 181 | Ga0105238_10059367 | 3300009551 | Bacteria | 3832 |
| 182 | Ga0105238_10063300 | 3300009551 | Bacteria | 3699 |
| 183 | Ga0105238_10314826 | 3300009551 | Bacteria | 1550 |
| 184 | Ga0105238_10492747 | 3300009551 | Bacteria | 1226 |
| 185 | Ga0105249_10011804 | 3300009553 | Bacteria | 7681 |
| 186 | Ga0105239_10000830 | 3300010375 | Bacteria | 43916 |
| 187 | Ga0105239_10011256 | 3300010375 | Bacteria | 9979 |
| 188 | Ga0105239_10059531 | 3300010375 | Bacteria | 4192 |
| 189 | Ga0105239_10082349 | 3300010375 | Bacteria | 3543 |
| 190 | Ga0105239_10212423 | 3300010375 | Bacteria | 2169 |
| 191 | Ga0105239_10416576 | 3300010375 | Bacteria | 1521 |
| 192 | Ga0105246_10024732 | 3300011119 | Bacteria | 3906 |
| 193 | Ga0157373_10002433 | 3300013100 | Bacteria | 14173 |
| 194 | Ga0157373_10005601 | 3300013100 | Bacteria | 9416 |
| 195 | Ga0157373_10020677 | 3300013100 | Bacteria | 4781 |
| 196 | Ga0157373_10040386 | 3300013100 | Bacteria | 3339 |
| 197 | Ga0157371_10005965 | 3300013102 | Bacteria | 10162 |
| 198 | Ga0157371_10008699 | 3300013102 | Bacteria | 8059 |
| 199 | Ga0157371_10033226 | 3300013102 | Bacteria | 3708 |
| 200 | Ga0157371_10161455 | 3300013102 | Bacteria | 1601 |
| 201 | Ga0157370_10001106 | 3300013104 | Bacteria | 33789 |
| 202 | Ga0157370_10007218 | 3300013104 | Bacteria | 12126 |
| 203 | Ga0157370_10008714 | 3300013104 | Bacteria | 10912 |
| 204 | Ga0157370_10010315 | 3300013104 | Bacteria | 9854 |
| 205 | Ga0157370_10115169 | 3300013104 | Bacteria | 2511 |
| 206 | Ga0157370_10167396 | 3300013104 | Bacteria | 2043 |
| 207 | Ga0157369_10001250 | 3300013105 | Bacteria | 31665 |
| 208 | Ga0157369_10006062 | 3300013105 | Bacteria | 14025 |
| 209 | Ga0157369_10022892 | 3300013105 | Bacteria | 6967 |
| 210 | Ga0157369_10130393 | 3300013105 | Bacteria | 2665 |
| 211 | Ga0157374_10077155 | 3300013296 | Bacteria | 3152 |
| 212 | Ga0157378_10069854 | 3300013297 | Bacteria | 3152 |
| 213 | Ga0157378_10268527 | 3300013297 | Bacteria | 1640 |
| 214 | Ga0163162_10000310 | 3300013306 | Bacteria | 45072 |
| 215 | Ga0163162_10000642 | 3300013306 | Bacteria | 32380 |
| 216 | Ga0163162_10087782 | 3300013306 | Bacteria | 3189 |
| 217 | Ga0163162_10224333 | 3300013306 | Bacteria | 2009 |
| 218 | Ga0157372_10007610 | 3300013307 | Bacteria | 11517 |
| 219 | Ga0157372_10009427 | 3300013307 | Bacteria | 10387 |
| 220 | Ga0157372_10011313 | 3300013307 | Bacteria | 9489 |
| 221 | Ga0157372_10021398 | 3300013307 | Bacteria | 6987 |
| 222 | Ga0157372_10029270 | 3300013307 | Bacteria | 6013 |
| 223 | Ga0157372_10059694 | 3300013307 | Bacteria | 4267 |
| 224 | Ga0157372_10094119 | 3300013307 | Bacteria | 3411 |
| 225 | Ga0157372_10813170 | 3300013307 | Bacteria | 1085 |
| 226 | Ga0157375_10031352 | 3300013308 | Bacteria | 5024 |
| 227 | Ga0157375_10226444 | 3300013308 | Bacteria | 2028 |
| 228 | Ga0163163_10001487 | 3300014325 | Bacteria | 19846 |
| 229 | Ga0163163_10056882 | 3300014325 | Bacteria | 3866 |
| 230 | Ga0157379_10013005 | 3300014968 | Bacteria | 7285 |
| 231 | Ga0157379_10305607 | 3300014968 | Bacteria | 1450 |
| 232 | Ga0157376_10014582 | 3300014969 | Bacteria | 5905 |
| 233 | Ga0157376_10037971 | 3300014969 | Bacteria | 3916 |
| 234 | Ga0157376_10045836 | 3300014969 | Bacteria | 3602 |
| 235 | Ga0157376_10074292 | 3300014969 | Bacteria | 2898 |
| 236 | Ga0182006_1000041 | 3300015261 | Bacteria | 203413 |
| 237 | Ga0182006_1000133 | 3300015261 | Bacteria | 80418 |
| 238 | Ga0182007_10003846 | 3300015262 | Bacteria | 6981 |
| 239 | Ga0182005_1000257 | 3300015265 | Bacteria | 33567 |
| 240 | Ga0182005_1002454 | 3300015265 | Bacteria | 6617 |
| 241 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 242 | Ga0163161_10012913 | 3300017792 | Bacteria | 5804 |
| 243 | Ga0197907_10696324 | 3300020069 | Bacteria | 2433 |
| 244 | Ga0206356_10033220 | 3300020070 | Bacteria | 2954 |
| 245 | Ga0206356_10907506 | 3300020070 | Bacteria | 2184 |
| 246 | Ga0206356_11546151 | 3300020070 | Bacteria | 3937 |
| 247 | Ga0206354_10818447 | 3300020081 | Bacteria | 3035 |
| 248 | Ga0206354_10932484 | 3300020081 | Bacteria | 4408 |
| 249 | Ga0206354_11021742 | 3300020081 | Bacteria | 1863 |
| 250 | Ga0206353_10050604 | 3300020082 | Bacteria | 3105 |
| 251 | Ga0206353_10485823 | 3300020082 | Bacteria | 3438 |
| 252 | Ga0206353_10562421 | 3300020082 | Bacteria | 1369 |
| 253 | Ga0206353_10579021 | 3300020082 | Bacteria | 3894 |
| 254 | Ga0209760_100701 | 3300025207 | Bacteria | 5170 |
| 255 | Ga0209784_100053 | 3300025224 | Bacteria | 182075 |
| 256 | Ga0209566_100922 | 3300025225 | Bacteria | 13688 |
| 257 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 258 | Ga0209672_100089 | 3300025228 | Bacteria | 120658 |
| 259 | Ga0209672_111421 | 3300025228 | Bacteria | 1150 |
| 260 | Ga0207427_100051 | 3300025231 | Bacteria | 218792 |
| 261 | Ga0207427_100061 | 3300025231 | Bacteria | 182815 |
| 262 | Ga0207427_100129 | 3300025231 | Bacteria | 94644 |
| 263 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 264 | Ga0209437_100118 | 3300025233 | Bacteria | 207534 |
| 265 | Ga0209437_100152 | 3300025233 | Bacteria | 154551 |
| 266 | Ga0209437_100406 | 3300025233 | Bacteria | 39888 |
| 267 | Ga0209258_100090 | 3300025242 | Bacteria | 232619 |
| 268 | Ga0209258_100101 | 3300025242 | Bacteria | 210252 |
| 269 | Ga0209258_100138 | 3300025242 | Bacteria | 167495 |
| 270 | Ga0209258_100479 | 3300025242 | Bacteria | 42065 |
| 271 | Ga0209258_101737 | 3300025242 | Bacteria | 6756 |
| 272 | Ga0209646_1001427 | 3300025246 | Bacteria | 6440 |
| 273 | Ga0209646_1002026 | 3300025246 | Bacteria | 4832 |
| 274 | Ga0209646_1002739 | 3300025246 | Bacteria | 3744 |
| 275 | Ga0209026_1000104 | 3300025250 | Bacteria | 152614 |
| 276 | Ga0209026_1000294 | 3300025250 | Bacteria | 55402 |
| 277 | Ga0209026_1000553 | 3300025250 | Bacteria | 25735 |
| 278 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 279 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 280 | Ga0209148_1000065 | 3300025254 | Bacteria | 344489 |
| 281 | Ga0209148_1000079 | 3300025254 | Bacteria | 288992 |
| 282 | Ga0209759_1000165 | 3300025256 | Bacteria | 113117 |
| 283 | Ga0209759_1001467 | 3300025256 | Bacteria | 13162 |
| 284 | Ga0209759_1002925 | 3300025256 | Bacteria | 7154 |
| 285 | Ga0209759_1009463 | 3300025256 | Bacteria | 2944 |
| 286 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 287 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 288 | Ga0209233_1000099 | 3300025261 | Bacteria | 293995 |
| 289 | Ga0209233_1006812 | 3300025261 | Bacteria | 3656 |
| 290 | Ga0209233_1008159 | 3300025261 | Bacteria | 3263 |
| 291 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 292 | Ga0209455_1000079 | 3300025272 | Bacteria | 268778 |
| 293 | Ga0209455_1000189 | 3300025272 | Bacteria | 92877 |
| 294 | Ga0209455_1003693 | 3300025272 | Bacteria | 5298 |
| 295 | Ga0209051_1004768 | 3300025303 | Bacteria | 8193 |
| 296 | Ga0207656_10002191 | 3300025321 | Bacteria | 6536 |
| 297 | Ga0207656_10062171 | 3300025321 | Bacteria | 1640 |
| 298 | Ga0207710_10014465 | 3300025900 | Bacteria | 3329 |
| 299 | Ga0207680_10000139 | 3300025903 | Bacteria | 34616 |
| 300 | Ga0207680_10074224 | 3300025903 | Bacteria | 2117 |
| 301 | Ga0207680_10187221 | 3300025903 | Bacteria | 1403 |
| 302 | Ga0207647_10000002 | 3300025904 | Bacteria | 400771 |
| 303 | Ga0207647_10000175 | 3300025904 | Bacteria | 51622 |
| 304 | Ga0207647_10000224 | 3300025904 | Bacteria | 46793 |
| 305 | Ga0207647_10000525 | 3300025904 | Bacteria | 30595 |
| 306 | Ga0207647_10002255 | 3300025904 | Bacteria | 14694 |
| 307 | Ga0207647_10038965 | 3300025904 | Bacteria | 3001 |
| 308 | Ga0207643_10012719 | 3300025908 | Bacteria | 4549 |
| 309 | Ga0207705_10000198 | 3300025909 | Bacteria | 61005 |
| 310 | Ga0207705_10001050 | 3300025909 | Bacteria | 22453 |
| 311 | Ga0207705_10001085 | 3300025909 | Bacteria | 22127 |
| 312 | Ga0207705_10001679 | 3300025909 | Bacteria | 17622 |
| 313 | Ga0207705_10001682 | 3300025909 | Bacteria | 17606 |
| 314 | Ga0207705_10005637 | 3300025909 | Bacteria | 9353 |
| 315 | Ga0207705_10140855 | 3300025909 | Bacteria | 1801 |
| 316 | Ga0207654_10003591 | 3300025911 | Bacteria | 7842 |
| 317 | Ga0207707_10000020 | 3300025912 | Bacteria | 205480 |
| 318 | Ga0207707_10000131 | 3300025912 | Bacteria | 77593 |
| 319 | Ga0207707_10000136 | 3300025912 | Bacteria | 76610 |
| 320 | Ga0207707_10000942 | 3300025912 | Bacteria | 28059 |
| 321 | Ga0207707_10001255 | 3300025912 | Bacteria | 23780 |
| 322 | Ga0207707_10001368 | 3300025912 | Bacteria | 22608 |
| 323 | Ga0207707_10002269 | 3300025912 | Bacteria | 17392 |
| 324 | Ga0207707_10003877 | 3300025912 | Bacteria | 13260 |
| 325 | Ga0207707_10006101 | 3300025912 | Bacteria | 10539 |
| 326 | Ga0207707_10032416 | 3300025912 | Bacteria | 4573 |
| 327 | Ga0207707_10183288 | 3300025912 | Bacteria | 1827 |
| 328 | Ga0207695_10000101 | 3300025913 | Bacteria | 258504 |
| 329 | Ga0207695_10000418 | 3300025913 | Bacteria | 94702 |
| 330 | Ga0207695_10000751 | 3300025913 | Bacteria | 62399 |
| 331 | Ga0207695_10003587 | 3300025913 | Bacteria | 21711 |
| 332 | Ga0207695_10003838 | 3300025913 | Bacteria | 20806 |
| 333 | Ga0207695_10004386 | 3300025913 | Bacteria | 19292 |
| 334 | Ga0207695_10019450 | 3300025913 | Bacteria | 7822 |
| 335 | Ga0207695_10032954 | 3300025913 | Bacteria | 5661 |
| 336 | Ga0207695_10057689 | 3300025913 | Bacteria | 4033 |
| 337 | Ga0207695_10059440 | 3300025913 | Bacteria | 3963 |
| 338 | Ga0207671_10001039 | 3300025914 | Bacteria | 33742 |
| 339 | Ga0207671_10022465 | 3300025914 | Bacteria | 4770 |
| 340 | Ga0207671_10063712 | 3300025914 | Bacteria | 2740 |
| 341 | Ga0207660_10000594 | 3300025917 | Bacteria | 24432 |
| 342 | Ga0207660_10001035 | 3300025917 | Bacteria | 18403 |
| 343 | Ga0207660_10001057 | 3300025917 | Bacteria | 18244 |
| 344 | Ga0207660_10001511 | 3300025917 | Bacteria | 15659 |
| 345 | Ga0207660_10052034 | 3300025917 | Bacteria | 2914 |
| 346 | Ga0207660_10141499 | 3300025917 | Bacteria | 1839 |
| 347 | Ga0207657_10001821 | 3300025919 | Bacteria | 22995 |
| 348 | Ga0207657_10004696 | 3300025919 | Bacteria | 14420 |
| 349 | Ga0207657_10006034 | 3300025919 | Bacteria | 12597 |
| 350 | Ga0207657_10011359 | 3300025919 | Bacteria | 8846 |
| 351 | Ga0207657_10035064 | 3300025919 | Bacteria | 4504 |
| 352 | Ga0207657_10098901 | 3300025919 | Bacteria | 2424 |
| 353 | Ga0207657_10100370 | 3300025919 | Bacteria | 2403 |
| 354 | Ga0207657_10196769 | 3300025919 | Bacteria | 1623 |
| 355 | Ga0207649_10010581 | 3300025920 | Bacteria | 5073 |
| 356 | Ga0207649_10015754 | 3300025920 | Bacteria | 4249 |
| 357 | Ga0207649_10020685 | 3300025920 | Bacteria | 3775 |
| 358 | Ga0207649_10023168 | 3300025920 | Bacteria | 3593 |
| 359 | Ga0207649_10032787 | 3300025920 | Bacteria | 3099 |
| 360 | Ga0207649_10218335 | 3300025920 | Bacteria | 1357 |
| 361 | Ga0207652_10000037 | 3300025921 | Bacteria | 134369 |
| 362 | Ga0207652_10000226 | 3300025921 | Bacteria | 59362 |
| 363 | Ga0207652_10000902 | 3300025921 | Bacteria | 28060 |
| 364 | Ga0207652_10001301 | 3300025921 | Bacteria | 22199 |
| 365 | Ga0207652_10002104 | 3300025921 | Bacteria | 17100 |
| 366 | Ga0207652_10007880 | 3300025921 | Bacteria | 8551 |
| 367 | Ga0207694_10000336 | 3300025924 | Bacteria | 44443 |
| 368 | Ga0207694_10002801 | 3300025924 | Bacteria | 14074 |
| 369 | Ga0207694_10003401 | 3300025924 | Bacteria | 12671 |
| 370 | Ga0207694_10003716 | 3300025924 | Bacteria | 12087 |
| 371 | Ga0207694_10005085 | 3300025924 | Bacteria | 10166 |
| 372 | Ga0207694_10043610 | 3300025924 | Bacteria | 3462 |
| 373 | Ga0207694_10090234 | 3300025924 | Bacteria | 2418 |
| 374 | Ga0207659_10090706 | 3300025926 | Bacteria | 2282 |
| 375 | Ga0207664_10000150 | 3300025929 | Bacteria | 56559 |
| 376 | Ga0207690_10001578 | 3300025932 | Bacteria | 14250 |
| 377 | Ga0207690_10005495 | 3300025932 | Bacteria | 7477 |
| 378 | Ga0207690_10008354 | 3300025932 | Bacteria | 6145 |
| 379 | Ga0207690_10022761 | 3300025932 | Bacteria | 3902 |
| 380 | Ga0207690_10023298 | 3300025932 | Bacteria | 3862 |
| 381 | Ga0207690_10025875 | 3300025932 | Bacteria | 3690 |
| 382 | Ga0207690_10125735 | 3300025932 | Bacteria | 1869 |
| 383 | Ga0207690_10488052 | 3300025932 | Bacteria | 995 |
| 384 | Ga0207706_10010415 | 3300025933 | Bacteria | 8494 |
| 385 | Ga0207706_10028042 | 3300025933 | Bacteria | 5030 |
| 386 | Ga0207706_10269459 | 3300025933 | Bacteria | 1486 |
| 387 | Ga0207670_10030810 | 3300025936 | Bacteria | 3429 |
| 388 | Ga0207704_10228326 | 3300025938 | Bacteria | 1382 |
| 389 | Ga0207691_10009722 | 3300025940 | Bacteria | 9229 |
| 390 | Ga0207691_10036351 | 3300025940 | Bacteria | 4563 |
| 391 | Ga0207689_10016937 | 3300025942 | Bacteria | 6166 |
| 392 | Ga0207661_10005158 | 3300025944 | Bacteria | 9179 |
| 393 | Ga0207661_10005219 | 3300025944 | Bacteria | 9131 |
| 394 | Ga0207661_10016793 | 3300025944 | Bacteria | 5404 |
| 395 | Ga0207679_10081290 | 3300025945 | Bacteria | 2477 |
| 396 | Ga0207667_10000077 | 3300025949 | Bacteria | 166095 |
| 397 | Ga0207667_10000739 | 3300025949 | Bacteria | 42543 |
| 398 | Ga0207667_10004983 | 3300025949 | Bacteria | 16228 |
| 399 | Ga0207667_10006687 | 3300025949 | Bacteria | 13940 |
| 400 | Ga0207667_10010885 | 3300025949 | Bacteria | 10608 |
| 401 | Ga0207667_10013352 | 3300025949 | Bacteria | 9402 |
| 402 | Ga0207667_10031674 | 3300025949 | Bacteria | 5706 |
| 403 | Ga0207667_10048246 | 3300025949 | Bacteria | 4504 |
| 404 | Ga0207667_10143865 | 3300025949 | Bacteria | 2455 |
| 405 | Ga0207667_10437060 | 3300025949 | Bacteria | 1330 |
| 406 | Ga0207712_10000105 | 3300025961 | Bacteria | 95153 |
| 407 | Ga0207640_10000032 | 3300025981 | Bacteria | 116582 |
| 408 | Ga0207640_10000479 | 3300025981 | Bacteria | 24364 |
| 409 | Ga0207640_10001610 | 3300025981 | Bacteria | 12117 |
| 410 | Ga0207640_10001639 | 3300025981 | Bacteria | 11992 |
| 411 | Ga0207640_10002761 | 3300025981 | Bacteria | 9396 |
| 412 | Ga0207640_10055275 | 3300025981 | Bacteria | 2600 |
| 413 | Ga0207640_10297027 | 3300025981 | Bacteria | 1276 |
| 414 | Ga0207658_10025041 | 3300025986 | Bacteria | 4176 |
| 415 | Ga0207703_10004097 | 3300026035 | Bacteria | 12028 |
| 416 | Ga0207703_10026189 | 3300026035 | Bacteria | 4589 |
| 417 | Ga0207639_10001251 | 3300026041 | Bacteria | 17212 |
| 418 | Ga0207639_10004488 | 3300026041 | Bacteria | 9416 |
| 419 | Ga0207639_10004560 | 3300026041 | Bacteria | 9331 |
| 420 | Ga0207639_10005917 | 3300026041 | Bacteria | 8289 |
| 421 | Ga0207639_10009206 | 3300026041 | Bacteria | 6808 |
| 422 | Ga0207639_10036014 | 3300026041 | Bacteria | 3664 |
| 423 | Ga0207639_10041665 | 3300026041 | Bacteria | 3437 |
| 424 | Ga0207639_10086821 | 3300026041 | Bacteria | 2492 |
| 425 | Ga0207639_10137212 | 3300026041 | Bacteria | 2033 |
| 426 | Ga0207678_10001007 | 3300026067 | Bacteria | 25669 |
| 427 | Ga0207678_10001852 | 3300026067 | Bacteria | 19350 |
| 428 | Ga0207678_10003314 | 3300026067 | Bacteria | 14521 |
| 429 | Ga0207678_10005388 | 3300026067 | Bacteria | 11460 |
| 430 | Ga0207678_10008801 | 3300026067 | Bacteria | 8882 |
| 431 | Ga0207678_10068948 | 3300026067 | Bacteria | 3033 |
| 432 | Ga0207678_10078439 | 3300026067 | Bacteria | 2829 |
| 433 | Ga0207702_10001658 | 3300026078 | Bacteria | 21995 |
| 434 | Ga0207702_10007180 | 3300026078 | Bacteria | 9533 |
| 435 | Ga0207702_10077386 | 3300026078 | Bacteria | 2877 |
| 436 | Ga0207702_10544218 | 3300026078 | Bacteria | 1135 |
| 437 | Ga0207641_10012492 | 3300026088 | Bacteria | 6960 |
| 438 | Ga0207641_10020195 | 3300026088 | Bacteria | 5469 |
| 439 | Ga0207641_10070822 | 3300026088 | Bacteria | 2997 |
| 440 | Ga0207641_10076479 | 3300026088 | Bacteria | 2894 |
| 441 | Ga0207648_10022355 | 3300026089 | Bacteria | 5682 |
| 442 | Ga0207648_10287639 | 3300026089 | Bacteria | 1471 |
| 443 | Ga0207676_10291396 | 3300026095 | Bacteria | 1486 |
| 444 | Ga0207674_10004053 | 3300026116 | Bacteria | 17767 |
| 445 | Ga0207674_10006924 | 3300026116 | Bacteria | 13282 |
| 446 | Ga0207674_10014510 | 3300026116 | Bacteria | 8700 |
| 447 | Ga0207674_10040168 | 3300026116 | Bacteria | 4849 |
| 448 | Ga0207674_10076033 | 3300026116 | Bacteria | 3367 |
| 449 | Ga0207674_10165082 | 3300026116 | Bacteria | 2168 |
| 450 | Ga0207683_10009137 | 3300026121 | Bacteria | 8448 |
| 451 | Ga0207698_10001009 | 3300026142 | Bacteria | 16385 |
| 452 | Ga0207698_10004040 | 3300026142 | Bacteria | 8909 |
| 453 | Ga0207698_10008897 | 3300026142 | Bacteria | 6366 |
| 454 | Ga0207698_10011336 | 3300026142 | Bacteria | 5773 |
| 455 | Ga0207698_10017935 | 3300026142 | Bacteria | 4812 |
| 456 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 457 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 458 | Ga0268266_10082893 | 3300028379 | Bacteria | 2798 |
| 459 | Ga0307508_10027843 | 3300031616 | Bacteria | 5114 |
| 460 | Ga0316576_10035079 | 3300031727 | Bacteria | 3579 |
| 461 | Ga0316578_10166865 | 3300031728 | Bacteria | 1327 |
| 462 | Ga0307516_10052276 | 3300031730 | Bacteria | 3999 |
| 463 | Ga0307405_10139831 | 3300031731 | Bacteria | 1686 |
| 464 | Ga0307412_10003896 | 3300031911 | Bacteria | 8306 |
| 465 | Ga0316593_10103114 | 3300032168 | Bacteria | 1014 |
| 466 | Ga0307510_10004110 | 3300033180 | Bacteria | 17078 |
| 467 | Ga0373944_0013530 | 3300035089 | Bacteria | 2265 |
| 468 | Ga0373943_0203309 | 3300035170 | Bacteria | 1097 |
| 469 | Ga0316574_0050891 | 3300035398 | Bacteria | 2580 |
| 470 | Ga0316574_0116889 | 3300035398 | Bacteria | 1711 |
| 471 | Ga0373924_0134581 | 3300035410 | Bacteria | 1076 |
| 472 | Ga0373933_0010679 | 3300035724 | Bacteria | 5036 |
| 473 | Ga0373937_0016801 | 3300036401 | Bacteria | 6505 |
| 474 | Ga0316584_0047429 | 3300036712 | Bacteria | 3209 |
| 475 | Ga0395899_0023623 | 3300037312 | Bacteria | 4654 |
| 476 | Ga0395899_0036443 | 3300037312 | Bacteria | 3689 |
| 477 | Ga0395899_0053699 | 3300037312 | Bacteria | 2982 |
| 478 | Ga0395900_0003805 | 3300037418 | Bacteria | 16142 |
| 479 | Ga0395900_0004421 | 3300037418 | Bacteria | 14904 |
| 480 | Ga0395900_0124201 | 3300037418 | Bacteria | 2647 |
| 481 | Ga0395900_0140270 | 3300037418 | Bacteria | 2475 |
| 482 | Ga0395900_0504475 | 3300037418 | Bacteria | 1160 |
| 483 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 484 | Ga0395898_0006262 | 3300037466 | Bacteria | 12730 |
| 485 | Ga0395901_0022120 | 3300038443 | Bacteria | 6514 |
| 486 | Ga0395901_0050913 | 3300038443 | Bacteria | 4303 |
| 487 | Ga0395901_0098919 | 3300038443 | Bacteria | 3058 |
| 488 | Ga0395901_0160042 | 3300038443 | Bacteria | 2365 |
| 489 | Ga0395901_0209158 | 3300038443 | Bacteria | 2043 |
| 490 | Ga0400483_022784 | 3300039062 | Bacteria | 6265 |
| 491 | Ga0400483_062577 | 3300039062 | Bacteria | 66463 |
| 492 | Ga0400483_150507 | 3300039062 | Bacteria | 2303 |
| 493 | Ga0400483_276618 | 3300039062 | Bacteria | 37892 |
| 494 | Ga0400489_37299 | 3300039093 | Bacteria | 63307 |
| 495 | Ga0439436_0000004 | 3300041404 | Bacteria | 175137 |
| 496 | Ga0439465_0001501 | 3300041413 | Bacteria | 7564 |
| 497 | Ga0439432_020495 | 3300042006 | Bacteria | 2197 |
| 498 | Ga0466969_0037206 | 3300044656 | Bacteria | 2456 |
| 499 | Ga0466966_0011070 | 3300044684 | Bacteria | 5987 |
| 500 | Ga0466966_0017959 | 3300044684 | Bacteria | 4670 |
| 501 | Ga0466961_0004762 | 3300044693 | Bacteria | 8540 |
| 502 | Ga0466964_0005140 | 3300044706 | Bacteria | 4847 |
| 503 | Ga0466971_0001794 | 3300044719 | Bacteria | 9109 |
| 504 | Ga0466968_0000061 | 3300044735 | Bacteria | 31791 |
| 505 | Ga0466970_0000496 | 3300044765 | Bacteria | 19359 |
| 506 | Ga0466970_0003435 | 3300044765 | Bacteria | 7711 |
| 507 | Ga0466960_0045412 | 3300044901 | Bacteria | 2098 |
| 508 | Ga0466959_0021971 | 3300045049 | Bacteria | 4712 |
| 509 | Ga0466959_0059609 | 3300045049 | Bacteria | 2779 |
| 510 | Ga0466958_0012695 | 3300045836 | Bacteria | 4777 |
| 511 | Ga0495617_000085 | 3300046452 | Bacteria | 67837 |
| 512 | Ga0495617_001170 | 3300046452 | Bacteria | 11853 |
| 513 | Ga0495629_0038732 | 3300046459 | Bacteria | 3357 |
| 514 | Ga0495638_0000236 | 3300046460 | Bacteria | 75732 |
| 515 | Ga0495638_0000754 | 3300046460 | Bacteria | 34482 |
| 516 | Ga0495638_0001087 | 3300046460 | Bacteria | 26471 |
| 517 | Ga0495650_0000191 | 3300046471 | Bacteria | 132016 |
| 518 | Ga0495650_0012428 | 3300046471 | Bacteria | 4582 |
| 519 | Ga0495584_0000457 | 3300046491 | Bacteria | 28087 |
| 520 | Ga0495585_0003589 | 3300046492 | Bacteria | 10405 |
| 521 | Ga0495607_0000131 | 3300046501 | Bacteria | 80259 |
| 522 | Ga0495583_0012629 | 3300046506 | Bacteria | 4764 |
| 523 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 524 | Ga0495606_0001253 | 3300046507 | Bacteria | 35422 |
| 525 | Ga0495606_0001443 | 3300046507 | Bacteria | 31874 |
| 526 | Ga0495610_0003274 | 3300046512 | Bacteria | 12764 |
| 527 | Ga0495616_0000401 | 3300046513 | Bacteria | 33353 |
| 528 | Ga0495616_0002110 | 3300046513 | Bacteria | 13330 |
| 529 | Ga0495620_0000365 | 3300046515 | Bacteria | 31131 |
| 530 | Ga0495632_0000531 | 3300046519 | Bacteria | 36042 |
| 531 | Ga0495632_0004712 | 3300046519 | Bacteria | 9206 |
| 532 | Ga0495632_0018148 | 3300046519 | Bacteria | 3867 |
| 533 | Ga0495632_0108904 | 3300046519 | Bacteria | 1301 |
| 534 | Ga0495637_0005557 | 3300046520 | Bacteria | 6401 |
| 535 | Ga0495609_0009588 | 3300046538 | Bacteria | 4681 |
| 536 | Ga0495645_0142533 | 3300046543 | Bacteria | 1671 |
| 537 | Ga0495668_0001761 | 3300046616 | Bacteria | 19820 |
| 538 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 539 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 540 | Ga0495625_0044528 | 3300046660 | Bacteria | 3213 |
| 541 | Ga0495658_0006050 | 3300046683 | Bacteria | 5944 |
| 542 | Ga0495670_0000227 | 3300046691 | Bacteria | 25531 |
| 543 | Ga0495670_0000599 | 3300046691 | Bacteria | 17194 |
| 544 | Ga0495670_0018576 | 3300046691 | Bacteria | 3423 |
| 545 | Ga0495671_0001204 | 3300046692 | Bacteria | 17706 |
| 546 | Ga0495649_0000450 | 3300046694 | Bacteria | 35527 |
| 547 | Ga0495649_0002369 | 3300046694 | Bacteria | 13331 |
| 548 | Ga0495589_0000190 | 3300046794 | Bacteria | 54374 |
| 549 | Ga0495660_0000437 | 3300046810 | Bacteria | 34919 |
| 550 | Ga0495660_0000447 | 3300046810 | Bacteria | 34412 |
| 551 | Ga0495683_0001059 | 3300047323 | Bacteria | 19067 |
| 552 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 553 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 554 | Ga0495673_0002144 | 3300047469 | Bacteria | 14333 |
| 555 | Ga0495686_0000426 | 3300047472 | Bacteria | 66285 |
| 556 | Ga0495686_0001228 | 3300047472 | Bacteria | 29296 |
| 557 | Ga0496102_0068661 | 3300048905 | Bacteria | 3253 |
| 558 | Ga0496104_0022187 | 3300048907 | Bacteria | 5832 |
| 559 | Ga0496105_0002152 | 3300048908 | Bacteria | 14259 |
| 560 | Ga0496106_0000168 | 3300048909 | Bacteria | 47597 |
| 561 | Ga0496106_0364809 | 3300048909 | Bacteria | 1160 |
| 562 | Ga0496113_0393183 | 3300048916 | Bacteria | 1113 |
| 563 | Ga0496115_0000095 | 3300048918 | Bacteria | 82835 |
| 564 | Ga0496115_0000729 | 3300048918 | Bacteria | 24348 |
| 565 | Ga0496115_0024156 | 3300048918 | Bacteria | 4722 |
| 566 | Ga0496115_0174095 | 3300048918 | Bacteria | 1779 |
| 567 | Ga0496118_0003990 | 3300048921 | Bacteria | 17983 |
| 568 | Ga0496119_0000966 | 3300048922 | Bacteria | 36886 |
| 569 | Ga0496119_0039081 | 3300048922 | Bacteria | 3054 |
| 570 | Ga0496120_0000409 | 3300048923 | Bacteria | 68984 |
| 571 | Ga0496120_0001143 | 3300048923 | Bacteria | 34091 |
| 572 | Ga0496121_0006433 | 3300048924 | Bacteria | 14585 |
| 573 | Ga0496121_0008592 | 3300048924 | Bacteria | 11958 |
| 574 | Ga0496121_0054584 | 3300048924 | Bacteria | 3336 |
| 575 | Ga0496121_0129877 | 3300048924 | Bacteria | 1888 |
| 576 | Ga0496123_0019361 | 3300048926 | Bacteria | 5368 |
| 577 | Ga0496125_0023406 | 3300048928 | Bacteria | 5702 |
| 578 | Ga0496125_0033120 | 3300048928 | Bacteria | 4579 |
| 579 | Ga0496126_0022583 | 3300048929 | Bacteria | 6117 |
| 580 | Ga0496126_0088204 | 3300048929 | Bacteria | 2733 |
| 581 | Ga0496126_0088245 | 3300048929 | Bacteria | 2732 |
| 582 | Ga0496126_0111159 | 3300048929 | Bacteria | 2386 |
| 583 | Ga0496126_0121945 | 3300048929 | Bacteria | 2260 |
| 584 | Ga0496126_0251981 | 3300048929 | Bacteria | 1471 |
| 585 | Ga0495678_000019 | 3300049459 | Bacteria | 269723 |
| 586 | Ga0495678_041224 | 3300049459 | Bacteria | 1849 |
| 587 | Ga0495682_0007017 | 3300049460 | Bacteria | 4514 |
| 588 | Ga0495682_0009237 | 3300049460 | Bacteria | 3856 |
| 589 | Ga0501031_0030712 | 3300049568 | Bacteria | 3505 |
| 590 | Ga0501031_0102052 | 3300049568 | Bacteria | 1872 |
| 591 | Ga0501032_0023180 | 3300049569 | Bacteria | 4295 |
| 592 | Ga0501032_0059078 | 3300049569 | Bacteria | 2574 |
| 593 | Ga0501033_0013311 | 3300049570 | Bacteria | 6268 |
| 594 | Ga0501033_0051516 | 3300049570 | Bacteria | 3051 |
| 595 | Ga0501033_0067769 | 3300049570 | Bacteria | 2625 |
| 596 | Ga0501033_0148602 | 3300049570 | Bacteria | 1691 |
| 597 | Ga0501034_0000192 | 3300049571 | Bacteria | 115486 |
| 598 | Ga0501034_0133380 | 3300049571 | Bacteria | 2466 |
| 599 | Ga0501034_0179948 | 3300049571 | Bacteria | 2079 |
| 600 | Ga0501036_0014906 | 3300049572 | Bacteria | 6485 |
| 601 | Ga0501036_0050469 | 3300049572 | Bacteria | 3523 |
| 602 | Ga0501036_0311277 | 3300049572 | Bacteria | 1316 |
| 603 | Ga0501037_0033294 | 3300049573 | Bacteria | 3807 |
| 604 | Ga0501037_0059645 | 3300049573 | Bacteria | 2783 |
| 605 | Ga0501037_0212898 | 3300049573 | Bacteria | 1362 |
| 606 | Ga0501038_0100136 | 3300049574 | Bacteria | 2415 |
| 607 | Ga0501038_0156167 | 3300049574 | Bacteria | 1857 |
| 608 | Ga0501043_0021893 | 3300049579 | Bacteria | 5013 |
| 609 | Ga0501043_0028026 | 3300049579 | Bacteria | 4420 |
| 610 | Ga0501043_0076697 | 3300049579 | Bacteria | 2626 |
| 611 | Ga0501043_0090005 | 3300049579 | Bacteria | 2412 |
| 612 | Ga0501043_0102993 | 3300049579 | Bacteria | 2243 |
| 613 | Ga0501046_0017220 | 3300049580 | Bacteria | 6038 |
| 614 | Ga0501046_0022689 | 3300049580 | Bacteria | 5169 |
| 615 | Ga0501046_0117653 | 3300049580 | Bacteria | 2024 |
| 616 | Ga0501046_0207844 | 3300049580 | Bacteria | 1454 |
| 617 | Ga0501046_0286264 | 3300049580 | Bacteria | 1206 |
| 618 | Ga0501047_0001922 | 3300049581 | Bacteria | 19965 |
| 619 | Ga0501047_0006510 | 3300049581 | Bacteria | 10994 |
| 620 | Ga0501047_0022027 | 3300049581 | Bacteria | 6120 |
| 621 | Ga0501047_0024890 | 3300049581 | Bacteria | 5748 |
| 622 | Ga0501047_0033102 | 3300049581 | Bacteria | 4990 |
| 623 | Ga0501047_0166643 | 3300049581 | Bacteria | 2073 |
| 624 | Ga0501047_0408958 | 3300049581 | Bacteria | 1189 |
| 625 | Ga0501048_0019797 | 3300049582 | Bacteria | 4935 |
| 626 | Ga0501048_0149062 | 3300049582 | Bacteria | 1654 |
| 627 | Ga0501069_0009946 | 3300049585 | Bacteria | 5029 |
| 628 | Ga0501069_0016129 | 3300049585 | Bacteria | 4008 |
| 629 | Ga0501070_0000146 | 3300049586 | Bacteria | 65391 |
| 630 | Ga0501070_0002845 | 3300049586 | Bacteria | 15102 |
| 631 | Ga0501070_0014993 | 3300049586 | Bacteria | 6521 |
| 632 | Ga0501070_0015050 | 3300049586 | Bacteria | 6510 |
| 633 | Ga0501070_0021836 | 3300049586 | Bacteria | 5363 |
| 634 | Ga0501070_0032970 | 3300049586 | Bacteria | 4332 |
| 635 | Ga0501070_0162074 | 3300049586 | Bacteria | 1843 |
| 636 | Ga0501070_0232154 | 3300049586 | Bacteria | 1511 |
| 637 | Ga0501071_0009504 | 3300049587 | Bacteria | 6480 |
| 638 | Ga0501073_0003754 | 3300049589 | Bacteria | 11416 |
| 639 | Ga0501073_0017456 | 3300049589 | Bacteria | 5198 |
| 640 | Ga0501074_0000885 | 3300049590 | Bacteria | 19134 |
| 641 | Ga0501074_0003630 | 3300049590 | Bacteria | 10956 |
| 642 | Ga0501074_0025187 | 3300049590 | Bacteria | 4322 |
| 643 | Ga0501074_0038209 | 3300049590 | Bacteria | 3479 |
| 644 | Ga0501076_0389984 | 3300049592 | Bacteria | 1145 |
| 645 | Ga0501077_0081389 | 3300049593 | Bacteria | 2051 |
| 646 | Ga0501079_0106154 | 3300049741 | Bacteria | 2179 |
| 647 | Ga0501079_0202514 | 3300049741 | Bacteria | 1550 |
| 648 | Ga0501080_0003851 | 3300049742 | Bacteria | 13256 |
| 649 | Ga0501080_0008369 | 3300049742 | Bacteria | 9368 |
| 650 | Ga0501080_0027011 | 3300049742 | Bacteria | 5337 |
| 651 | Ga0501080_0067297 | 3300049742 | Bacteria | 3331 |
| 652 | Ga0501080_0170188 | 3300049742 | Bacteria | 2009 |
| 653 | Ga0501083_0116240 | 3300049744 | Bacteria | 1756 |
| 654 | Ga0501035_0003194 | 3300049822 | Bacteria | 15714 |
| 655 | Ga0501035_0006993 | 3300049822 | Bacteria | 10538 |
| 656 | Ga0501035_0007555 | 3300049822 | Bacteria | 10156 |
| 657 | Ga0501035_0011460 | 3300049822 | Bacteria | 8221 |
| 658 | Ga0501035_0020740 | 3300049822 | Bacteria | 6039 |
| 659 | Ga0501035_0022696 | 3300049822 | Bacteria | 5764 |
| 660 | Ga0501035_0039145 | 3300049822 | Bacteria | 4291 |
| 661 | Ga0501035_0177315 | 3300049822 | Bacteria | 1838 |
| 662 | Ga0501035_0238564 | 3300049822 | Bacteria | 1547 |
| 663 | Ga0501035_0427597 | 3300049822 | Bacteria | 1099 |
| 664 | Ga0501044_0027845 | 3300049823 | Bacteria | 5966 |
| 665 | Ga0501044_0053889 | 3300049823 | Bacteria | 4136 |
| 666 | Ga0501044_0076810 | 3300049823 | Bacteria | 3388 |
| 667 | Ga0501044_0136080 | 3300049823 | Bacteria | 2448 |
| 668 | Ga0501044_0165656 | 3300049823 | Bacteria | 2184 |
| 669 | Ga0501044_0266144 | 3300049823 | Bacteria | 1651 |
| 670 | Ga0500643_000101 | 3300053087 | Bacteria | 88318 |
| 671 | Ga0500646_0003484 | 3300053090 | Bacteria | 4032 |
| 672 | Ga0500566_0126233 | 3300053094 | Bacteria | 1374 |
| 673 | Ga0500555_001045 | 3300053103 | Bacteria | 9341 |
| 674 | Ga0500614_013421 | 3300053123 | Bacteria | 1800 |
| 675 | Ga0500652_106012 | 3300053131 | Bacteria | 1175 |
| 676 | Ga0500568_0000645 | 3300053139 | Bacteria | 25189 |
| 677 | Ga0500620_029835 | 3300053155 | Bacteria | 1716 |
| 678 | Ga0501084_0279466 | 3300054114 | Bacteria | 1410 |
| 679 | Ga0501082_0000402 | 3300060353 | Bacteria | 38316 |
| 680 | Ga0501082_0019471 | 3300060353 | Bacteria | 5851 |
| 681 | Ga0466962_0004934 | 3300061719 | Bacteria | 6416 |
| 682 | Ga0466962_0005447 | 3300061719 | Bacteria | 6116 |
| 683 | 2538834375 | 2537561836 | Bacteria | 3910579 |
| 684 | 2643828764 | 2643221562 | Bacteria | 4048635 |
| 685 | 2687584838 | 2687453130 | Bacteria | 4227172 |
| 686 | 2721025481 | 2718218334 | Bacteria | 4765486 |
| 687 | 2735834545 | 2734482264 | Unclassified | 5014763 |
| 688 | 2739225997 | 2738543009 | Bacteria | 4944499 |
| 689 | 2739733249 | 2739367700 | Bacteria | 4747630 |
| 690 | 2884338827 | 2884338543 | Bacteria | 4610696 |
| 691 | 2884415657 | 2884411467 | Bacteria | 5246714 |
| 692 | 2919086482 | 2919085039 | Bacteria | 4532964 |
| 693 | 2928966982 | 2928963466 | Bacteria | 5165703 |
| 694 | 2939613475 | 2939611941 | Bacteria | 3892017 |
| 695 | Ga0070680_100002197 | |||
| 696 | JGI24741J21665_1000076 | |||
| 697 | JGI24741J21665_1005437 | |||
| 698 | JGI24740J21852_10000279 | |||
| 699 | JGI24740J21852_10005082 | |||
| 700 | JGI25156J39149_1002783 | |||
| 701 | JGI25156J39149_1009367 | |||
| 702 | JGI25162J39368_1001445 | |||
| 703 | JGI25162J39368_1003044 | |||
| 704 | JGI25154J39366_1004509 | |||
| 705 | JGI25157J39369_1000344 | |||
| 706 | JGI25157J39369_1001046 | |||
| 707 | JGI25163J39215_1000588 | |||
| 708 | JGI25164J39214_1000117 | |||
| 709 | JGI25164J39214_1000714 | |||
| 710 | JGI25164J39214_1000865 | |||
| 711 | JGI25165J46597_1000235 | |||
| 712 | JGI25165J46597_1001443 | |||
| 713 | JGI25165J46597_1001780 | |||
| 714 | Ga0055533_1001538 | |||
| 715 | Ga0055527_1003026 | |||
| 716 | Ga0055535_1000941 | |||
| 717 | Ga0055535_1001080 | |||
| 718 | Ga0055535_1001379 | |||
| 719 | Ga0055542_1000245 | |||
| 720 | Ga0055542_1001179 | |||
| 721 | Ga0055542_1001180 | |||
| 722 | Ga0055542_1001349 | |||
| 723 | Ga0055529_1000314 | |||
| 724 | Ga0055529_1001072 | |||
| 725 | Ga0055529_1002135 | |||
| 726 | Ga0070658_10002163 | |||
| 727 | Ga0070683_100015187 | |||
| 728 | Ga0070683_100015955 | |||
| 729 | Ga0070683_100293315 | |||
| 730 | Ga0070690_100029514 | |||
| 731 | Ga0070670_100227448 | |||
| 732 | Ga0068869_100124752 | |||
| 733 | Ga0070666_10000001 | |||
| 734 | Ga0070666_10052751 | |||
| 735 | Ga0070680_100000946 | |||
| 736 | Ga0070680_100100120 | |||
| 737 | Ga0070682_100014480 | |||
| 738 | Ga0070682_100014970 | |||
| 739 | Ga0070682_100015837 | |||
| 740 | Ga0070682_100045315 | |||
| 741 | Ga0068868_100016923 | |||
| 742 | Ga0068868_100266644 | |||
| 743 | Ga0070660_100046496 | |||
| 744 | Ga0070660_100049491 | |||
| 745 | Ga0070660_100163024 | |||
| 746 | Ga0070661_100002526 | |||
| 747 | Ga0070661_100003952 | |||
| 748 | Ga0070661_100034435 | |||
| 749 | Ga0070661_100096555 | |||
| 750 | Ga0070692_10000307 | |||
| 751 | Ga0070692_10000420 | |||
| 752 | Ga0070692_10159273 | |||
| 753 | Ga0070668_100064734 | |||
| 754 | Ga0070675_100074093 | |||
| 755 | Ga0070688_100125161 | |||
| 756 | Ga0070659_100013061 | |||
| 757 | Ga0070659_100028080 | |||
| 758 | Ga0070667_100013367 | |||
| 759 | Ga0070667_100139556 | |||
| 760 | Ga0070667_100317045 | |||
| 761 | Ga0070714_100000136 | |||
| 762 | Ga0070711_100024811 | |||
| 763 | Ga0070663_100035443 | |||
| 764 | Ga0070662_100065358 | |||
| 765 | Ga0070662_100175736 | |||
| 766 | Ga0070681_10000552 | |||
| 767 | Ga0070681_10003671 | |||
| 768 | Ga0070681_10004860 | |||
| 769 | Ga0070681_10007360 | |||
| 770 | Ga0070681_10039513 | |||
| 771 | Ga0070681_10045534 | |||
| 772 | Ga0070681_10207387 | |||
| 773 | Ga0068867_100308495 | |||
| 774 | Ga0070685_10002434 | |||
| 775 | Ga0070685_10013112 | |||
| 776 | Ga0070679_100002097 | |||
| 777 | Ga0070679_100003490 | |||
| 778 | Ga0070679_100012167 | |||
| 779 | Ga0070679_100049404 | |||
| 780 | Ga0070679_100160069 | |||
| 781 | Ga0070684_100008594 | |||
| 782 | Ga0070684_100010992 | |||
| 783 | Ga0070684_100388599 | |||
| 784 | Ga0068853_100002290 | |||
| 785 | Ga0068853_100015163 | |||
| 786 | Ga0068853_100044837 | |||
| 787 | Ga0068853_100059863 | |||
| 788 | Ga0068853_100063960 | |||
| 789 | Ga0068853_100073444 | |||
| 790 | Ga0068853_100214666 | |||
| 791 | Ga0070672_100029858 | |||
| 792 | Ga0070686_100035506 | |||
| 793 | Ga0070696_100034217 | |||
| 794 | Ga0070696_100154920 | |||
| 795 | Ga0070693_100006423 | |||
| 796 | Ga0070693_100010956 | |||
| 797 | Ga0070693_100019703 | |||
| 798 | Ga0070693_100101715 | |||
| 799 | Ga0070665_100000712 | |||
| 800 | Ga0070665_100009799 | |||
| 801 | Ga0070665_100026563 | |||
| 802 | Ga0068855_100016860 | |||
| 803 | Ga0068855_100108668 | |||
| 804 | Ga0068855_100123760 | |||
| 805 | Ga0068855_100254647 | |||
| 806 | Ga0068855_100493937 | |||
| 807 | Ga0068855_100505101 | |||
| 808 | Ga0070664_100146377 | |||
| 809 | Ga0068857_100068091 | |||
| 810 | Ga0068854_100000026 | |||
| 811 | Ga0068854_100003525 | |||
| 812 | Ga0068854_100006081 | |||
| 813 | Ga0068856_100003430 | |||
| 814 | Ga0068856_100003717 | |||
| 815 | Ga0068856_100086051 | |||
| 816 | Ga0068856_100154783 | |||
| 817 | Ga0068856_100258841 | |||
| 818 | Ga0068852_100002438 | |||
| 819 | Ga0068852_100027419 | |||
| 820 | Ga0068852_100046785 | |||
| 821 | Ga0068852_100077654 | |||
| 822 | Ga0068852_100081911 | |||
| 823 | Ga0068852_100093186 | |||
| 824 | Ga0068859_100185524 | |||
| 825 | Ga0068859_100194926 | |||
| 826 | Ga0068864_100001937 | |||
| 827 | Ga0068864_100169015 | |||
| 828 | Ga0068864_100441945 | |||
| 829 | Ga0068851_10003106 | |||
| 830 | Ga0068851_10027637 | |||
| 831 | Ga0068851_10050072 | |||
| 832 | Ga0068870_10063166 | |||
| 833 | Ga0068863_100113210 | |||
| 834 | Ga0068863_100179577 | |||
| 835 | Ga0068863_100312146 | |||
| 836 | Ga0068863_100333736 | |||
| 837 | Ga0068858_100003930 | |||
| 838 | Ga0068858_100072506 | |||
| 839 | Ga0068860_100000822 | |||
| 840 | Ga0068860_100012637 | |||
| 841 | Ga0097621_100052340 | |||
| 842 | Ga0097621_100069711 | |||
| 843 | Ga0097621_100122753 | |||
| 844 | Ga0068871_100450501 | |||
| 845 | Ga0068865_100003462 | |||
| 846 | Ga0068865_100025746 | |||
| 847 | Ga0068865_100050142 | |||
| 848 | Ga0097620_100185528 | |||
| 849 | Ga0097620_100194937 | |||
| 850 | Ga0105240_10003317 | |||
| 851 | Ga0105240_10035352 | |||
| 852 | Ga0105240_10076161 | |||
| 853 | Ga0105240_10115212 | |||
| 854 | Ga0105240_10173120 | |||
| 855 | Ga0105240_10289346 | |||
| 856 | Ga0105245_10479507 | |||
| 857 | Ga0105247_10000804 | |||
| 858 | Ga0105241_10036533 | |||
| 859 | Ga0105241_10212677 | |||
| 860 | Ga0105241_10535294 | |||
| 861 | Ga0105242_10153044 | |||
| 862 | Ga0105248_10190603 | |||
| 863 | Ga0105237_10000108 | |||
| 864 | Ga0105237_10022010 | |||
| 865 | Ga0105237_10060807 | |||
| 866 | Ga0105237_10168033 | |||
| 867 | Ga0105237_10224269 | |||
| 868 | Ga0105237_10663088 | |||
| 869 | Ga0105238_10000729 | |||
| 870 | Ga0105238_10001656 | |||
| 871 | Ga0105238_10023815 | |||
| 872 | Ga0105238_10029898 | |||
| 873 | Ga0105238_10033003 | |||
| 874 | Ga0105238_10042081 | |||
| 875 | Ga0105238_10059367 | |||
| 876 | Ga0105238_10063300 | |||
| 877 | Ga0105238_10314826 | |||
| 878 | Ga0105238_10492747 | |||
| 879 | Ga0105249_10011804 | |||
| 880 | Ga0105239_10000830 | |||
| 881 | Ga0105239_10011256 | |||
| 882 | Ga0105239_10059531 | |||
| 883 | Ga0105239_10082349 | |||
| 884 | Ga0105239_10212423 | |||
| 885 | Ga0105239_10416576 | |||
| 886 | Ga0105246_10024732 | |||
| 887 | Ga0157373_10002433 | |||
| 888 | Ga0157373_10005601 | |||
| 889 | Ga0157373_10020677 | |||
| 890 | Ga0157373_10040386 | |||
| 891 | Ga0157371_10005965 | |||
| 892 | Ga0157371_10008699 | |||
| 893 | Ga0157371_10033226 | |||
| 894 | Ga0157371_10161455 | |||
| 895 | Ga0157370_10001106 | |||
| 896 | Ga0157370_10007218 | |||
| 897 | Ga0157370_10008714 | |||
| 898 | Ga0157370_10010315 | |||
| 899 | Ga0157370_10115169 | |||
| 900 | Ga0157370_10167396 | |||
| 901 | Ga0157369_10001250 | |||
| 902 | Ga0157369_10006062 | |||
| 903 | Ga0157369_10022892 | |||
| 904 | Ga0157369_10130393 | |||
| 905 | Ga0157374_10077155 | |||
| 906 | Ga0157378_10069854 | |||
| 907 | Ga0157378_10268527 | |||
| 908 | Ga0163162_10000310 | |||
| 909 | Ga0163162_10000642 | |||
| 910 | Ga0163162_10087782 | |||
| 911 | Ga0163162_10224333 | |||
| 912 | Ga0157372_10007610 | |||
| 913 | Ga0157372_10009427 | |||
| 914 | Ga0157372_10011313 | |||
| 915 | Ga0157372_10021398 | |||
| 916 | Ga0157372_10029270 | |||
| 917 | Ga0157372_10059694 | |||
| 918 | Ga0157372_10094119 | |||
| 919 | Ga0157372_10813170 | |||
| 920 | Ga0157375_10031352 | |||
| 921 | Ga0157375_10226444 | |||
| 922 | Ga0163163_10001487 | |||
| 923 | Ga0163163_10056882 | |||
| 924 | Ga0157379_10013005 | |||
| 925 | Ga0157379_10305607 | |||
| 926 | Ga0157376_10014582 | |||
| 927 | Ga0157376_10037971 | |||
| 928 | Ga0157376_10045836 | |||
| 929 | Ga0157376_10074292 | |||
| 930 | Ga0182006_1000041 | |||
| 931 | Ga0182006_1000133 | |||
| 932 | Ga0182007_10003846 | |||
| 933 | Ga0182005_1000257 | |||
| 934 | Ga0182005_1002454 | |||
| 935 | Ga0183368_1002 | |||
| 936 | Ga0163161_10012913 | |||
| 937 | Ga0197907_10696324 | |||
| 938 | Ga0206356_10033220 | |||
| 939 | Ga0206356_10907506 | |||
| 940 | Ga0206356_11546151 | |||
| 941 | Ga0206354_10818447 | |||
| 942 | Ga0206354_10932484 | |||
| 943 | Ga0206354_11021742 | |||
| 944 | Ga0206353_10050604 | |||
| 945 | Ga0206353_10485823 | |||
| 946 | Ga0206353_10562421 | |||
| 947 | Ga0206353_10579021 | |||
| 948 | Ga0209760_100701 | |||
| 949 | Ga0209784_100053 | |||
| 950 | Ga0209566_100922 | |||
| 951 | Ga0209674_100014 | |||
| 952 | Ga0209672_100089 | |||
| 953 | Ga0209672_111421 | |||
| 954 | Ga0207427_100051 | |||
| 955 | Ga0207427_100061 | |||
| 956 | Ga0207427_100129 | |||
| 957 | Ga0209437_100037 | |||
| 958 | Ga0209437_100118 | |||
| 959 | Ga0209437_100152 | |||
| 960 | Ga0209437_100406 | |||
| 961 | Ga0209258_100090 | |||
| 962 | Ga0209258_100101 | |||
| 963 | Ga0209258_100138 | |||
| 964 | Ga0209258_100479 | |||
| 965 | Ga0209258_101737 | |||
| 966 | Ga0209646_1001427 | |||
| 967 | Ga0209646_1002026 | |||
| 968 | Ga0209646_1002739 | |||
| 969 | Ga0209026_1000104 | |||
| 970 | Ga0209026_1000294 | |||
| 971 | Ga0209026_1000553 | |||
| 972 | Ga0209148_1000001 | |||
| 973 | Ga0209148_1000002 | |||
| 974 | Ga0209148_1000065 | |||
| 975 | Ga0209148_1000079 | |||
| 976 | Ga0209759_1000165 | |||
| 977 | Ga0209759_1001467 | |||
| 978 | Ga0209759_1002925 | |||
| 979 | Ga0209759_1009463 | |||
| 980 | Ga0209233_1000002 | |||
| 981 | Ga0209233_1000046 | |||
| 982 | Ga0209233_1000099 | |||
| 983 | Ga0209233_1006812 | |||
| 984 | Ga0209233_1008159 | |||
| 985 | Ga0209455_1000016 | |||
| 986 | Ga0209455_1000079 | |||
| 987 | Ga0209455_1000189 | |||
| 988 | Ga0209455_1003693 | |||
| 989 | Ga0209051_1004768 | |||
| 990 | Ga0207656_10002191 | |||
| 991 | Ga0207656_10062171 | |||
| 992 | Ga0207710_10014465 | |||
| 993 | Ga0207680_10000139 | |||
| 994 | Ga0207680_10074224 | |||
| 995 | Ga0207680_10187221 | |||
| 996 | Ga0207647_10000002 | |||
| 997 | Ga0207647_10000175 | |||
| 998 | Ga0207647_10000224 | |||
| 999 | Ga0207647_10000525 | |||
| 1000 | Ga0207647_10002255 | |||
| 1001 | Ga0207647_10038965 | |||
| 1002 | Ga0207643_10012719 | |||
| 1003 | Ga0207705_10000198 | |||
| 1004 | Ga0207705_10001050 | |||
| 1005 | Ga0207705_10001085 | |||
| 1006 | Ga0207705_10001679 | |||
| 1007 | Ga0207705_10001682 | |||
| 1008 | Ga0207705_10005637 | |||
| 1009 | Ga0207705_10140855 | |||
| 1010 | Ga0207654_10003591 | |||
| 1011 | Ga0207707_10000020 | |||
| 1012 | Ga0207707_10000131 | |||
| 1013 | Ga0207707_10000136 | |||
| 1014 | Ga0207707_10000942 | |||
| 1015 | Ga0207707_10001255 | |||
| 1016 | Ga0207707_10001368 | |||
| 1017 | Ga0207707_10002269 | |||
| 1018 | Ga0207707_10003877 | |||
| 1019 | Ga0207707_10006101 | |||
| 1020 | Ga0207707_10032416 | |||
| 1021 | Ga0207707_10183288 | |||
| 1022 | Ga0207695_10000101 | |||
| 1023 | Ga0207695_10000418 | |||
| 1024 | Ga0207695_10000751 | |||
| 1025 | Ga0207695_10003587 | |||
| 1026 | Ga0207695_10003838 | |||
| 1027 | Ga0207695_10004386 | |||
| 1028 | Ga0207695_10019450 | |||
| 1029 | Ga0207695_10032954 | |||
| 1030 | Ga0207695_10057689 | |||
| 1031 | Ga0207695_10059440 | |||
| 1032 | Ga0207671_10001039 | |||
| 1033 | Ga0207671_10022465 | |||
| 1034 | Ga0207671_10063712 | |||
| 1035 | Ga0207660_10000594 | |||
| 1036 | Ga0207660_10001035 | |||
| 1037 | Ga0207660_10001057 | |||
| 1038 | Ga0207660_10001511 | |||
| 1039 | Ga0207660_10052034 | |||
| 1040 | Ga0207660_10141499 | |||
| 1041 | Ga0207657_10001821 | |||
| 1042 | Ga0207657_10004696 | |||
| 1043 | Ga0207657_10006034 | |||
| 1044 | Ga0207657_10011359 | |||
| 1045 | Ga0207657_10035064 | |||
| 1046 | Ga0207657_10098901 | |||
| 1047 | Ga0207657_10100370 | |||
| 1048 | Ga0207657_10196769 | |||
| 1049 | Ga0207649_10010581 | |||
| 1050 | Ga0207649_10015754 | |||
| 1051 | Ga0207649_10020685 | |||
| 1052 | Ga0207649_10023168 | |||
| 1053 | Ga0207649_10032787 | |||
| 1054 | Ga0207649_10218335 | |||
| 1055 | Ga0207652_10000037 | |||
| 1056 | Ga0207652_10000226 | |||
| 1057 | Ga0207652_10000902 | |||
| 1058 | Ga0207652_10001301 | |||
| 1059 | Ga0207652_10002104 | |||
| 1060 | Ga0207652_10007880 | |||
| 1061 | Ga0207694_10000336 | |||
| 1062 | Ga0207694_10002801 | |||
| 1063 | Ga0207694_10003401 | |||
| 1064 | Ga0207694_10003716 | |||
| 1065 | Ga0207694_10005085 | |||
| 1066 | Ga0207694_10043610 | |||
| 1067 | Ga0207694_10090234 | |||
| 1068 | Ga0207659_10090706 | |||
| 1069 | Ga0207664_10000150 | |||
| 1070 | Ga0207690_10001578 | |||
| 1071 | Ga0207690_10005495 | |||
| 1072 | Ga0207690_10008354 | |||
| 1073 | Ga0207690_10022761 | |||
| 1074 | Ga0207690_10023298 | |||
| 1075 | Ga0207690_10025875 | |||
| 1076 | Ga0207690_10125735 | |||
| 1077 | Ga0207690_10488052 | |||
| 1078 | Ga0207706_10010415 | |||
| 1079 | Ga0207706_10028042 | |||
| 1080 | Ga0207706_10269459 | |||
| 1081 | Ga0207670_10030810 | |||
| 1082 | Ga0207704_10228326 | |||
| 1083 | Ga0207691_10009722 | |||
| 1084 | Ga0207691_10036351 | |||
| 1085 | Ga0207689_10016937 | |||
| 1086 | Ga0207661_10005158 | |||
| 1087 | Ga0207661_10005219 | |||
| 1088 | Ga0207661_10016793 | |||
| 1089 | Ga0207679_10081290 | |||
| 1090 | Ga0207667_10000077 | |||
| 1091 | Ga0207667_10000739 | |||
| 1092 | Ga0207667_10004983 | |||
| 1093 | Ga0207667_10006687 | |||
| 1094 | Ga0207667_10010885 | |||
| 1095 | Ga0207667_10013352 | |||
| 1096 | Ga0207667_10031674 | |||
| 1097 | Ga0207667_10048246 | |||
| 1098 | Ga0207667_10143865 | |||
| 1099 | Ga0207667_10437060 | |||
| 1100 | Ga0207712_10000105 | |||
| 1101 | Ga0207640_10000032 | |||
| 1102 | Ga0207640_10000479 | |||
| 1103 | Ga0207640_10001610 | |||
| 1104 | Ga0207640_10001639 | |||
| 1105 | Ga0207640_10002761 | |||
| 1106 | Ga0207640_10055275 | |||
| 1107 | Ga0207640_10297027 | |||
| 1108 | Ga0207658_10025041 | |||
| 1109 | Ga0207703_10004097 | |||
| 1110 | Ga0207703_10026189 | |||
| 1111 | Ga0207639_10001251 | |||
| 1112 | Ga0207639_10004488 | |||
| 1113 | Ga0207639_10004560 | |||
| 1114 | Ga0207639_10005917 | |||
| 1115 | Ga0207639_10009206 | |||
| 1116 | Ga0207639_10036014 | |||
| 1117 | Ga0207639_10041665 | |||
| 1118 | Ga0207639_10086821 | |||
| 1119 | Ga0207639_10137212 | |||
| 1120 | Ga0207678_10001007 | |||
| 1121 | Ga0207678_10001852 | |||
| 1122 | Ga0207678_10003314 | |||
| 1123 | Ga0207678_10005388 | |||
| 1124 | Ga0207678_10008801 | |||
| 1125 | Ga0207678_10068948 | |||
| 1126 | Ga0207678_10078439 | |||
| 1127 | Ga0207702_10001658 | |||
| 1128 | Ga0207702_10007180 | |||
| 1129 | Ga0207702_10077386 | |||
| 1130 | Ga0207702_10544218 | |||
| 1131 | Ga0207641_10012492 | |||
| 1132 | Ga0207641_10020195 | |||
| 1133 | Ga0207641_10070822 | |||
| 1134 | Ga0207641_10076479 | |||
| 1135 | Ga0207648_10022355 | |||
| 1136 | Ga0207648_10287639 | |||
| 1137 | Ga0207676_10291396 | |||
| 1138 | Ga0207674_10004053 | |||
| 1139 | Ga0207674_10006924 | |||
| 1140 | Ga0207674_10014510 | |||
| 1141 | Ga0207674_10040168 | |||
| 1142 | Ga0207674_10076033 | |||
| 1143 | Ga0207674_10165082 | |||
| 1144 | Ga0207683_10009137 | |||
| 1145 | Ga0207698_10001009 | |||
| 1146 | Ga0207698_10004040 | |||
| 1147 | Ga0207698_10008897 | |||
| 1148 | Ga0207698_10011336 | |||
| 1149 | Ga0207698_10017935 | |||
| 1150 | Ga0268266_10000008 | |||
| 1151 | Ga0268266_10000011 | |||
| 1152 | Ga0268266_10082893 | |||
| 1153 | Ga0307508_10027843 | |||
| 1154 | Ga0316576_10035079 | |||
| 1155 | Ga0316578_10166865 | |||
| 1156 | Ga0307516_10052276 | |||
| 1157 | Ga0307405_10139831 | |||
| 1158 | Ga0307412_10003896 | |||
| 1159 | Ga0316593_10103114 | |||
| 1160 | Ga0307510_10004110 | |||
| 1161 | Ga0373944_0013530 | |||
| 1162 | Ga0373943_0203309 | |||
| 1163 | Ga0316574_0050891 | |||
| 1164 | Ga0316574_0116889 | |||
| 1165 | Ga0373924_0134581 | |||
| 1166 | Ga0373933_0010679 | |||
| 1167 | Ga0373937_0016801 | |||
| 1168 | Ga0316584_0047429 | |||
| 1169 | Ga0395899_0023623 | |||
| 1170 | Ga0395899_0036443 | |||
| 1171 | Ga0395899_0053699 | |||
| 1172 | Ga0395900_0003805 | |||
| 1173 | Ga0395900_0004421 | |||
| 1174 | Ga0395900_0124201 | |||
| 1175 | Ga0395900_0140270 | |||
| 1176 | Ga0395900_0504475 | |||
| 1177 | Ga0395898_0000013 | |||
| 1178 | Ga0395898_0006262 | |||
| 1179 | Ga0395901_0022120 | |||
| 1180 | Ga0395901_0050913 | |||
| 1181 | Ga0395901_0098919 | |||
| 1182 | Ga0395901_0160042 | |||
| 1183 | Ga0395901_0209158 | |||
| 1184 | Ga0400483_022784 | |||
| 1185 | Ga0400483_062577 | |||
| 1186 | Ga0400483_150507 | |||
| 1187 | Ga0400483_276618 | |||
| 1188 | Ga0400489_37299 | |||
| 1189 | Ga0439436_0000004 | |||
| 1190 | Ga0439465_0001501 | |||
| 1191 | Ga0439432_020495 | |||
| 1192 | Ga0466969_0037206 | |||
| 1193 | Ga0466966_0011070 | |||
| 1194 | Ga0466966_0017959 | |||
| 1195 | Ga0466961_0004762 | |||
| 1196 | Ga0466964_0005140 | |||
| 1197 | Ga0466971_0001794 | |||
| 1198 | Ga0466968_0000061 | |||
| 1199 | Ga0466970_0000496 | |||
| 1200 | Ga0466970_0003435 | |||
| 1201 | Ga0466960_0045412 | |||
| 1202 | Ga0466959_0021971 | |||
| 1203 | Ga0466959_0059609 | |||
| 1204 | Ga0466958_0012695 | |||
| 1205 | Ga0495617_000085 | |||
| 1206 | Ga0495617_001170 | |||
| 1207 | Ga0495629_0038732 | |||
| 1208 | Ga0495638_0000236 | |||
| 1209 | Ga0495638_0000754 | |||
| 1210 | Ga0495638_0001087 | |||
| 1211 | Ga0495650_0000191 | |||
| 1212 | Ga0495650_0012428 | |||
| 1213 | Ga0495584_0000457 | |||
| 1214 | Ga0495585_0003589 | |||
| 1215 | Ga0495607_0000131 | |||
| 1216 | Ga0495583_0012629 | |||
| 1217 | Ga0495606_0000016 | |||
| 1218 | Ga0495606_0001253 | |||
| 1219 | Ga0495606_0001443 | |||
| 1220 | Ga0495610_0003274 | |||
| 1221 | Ga0495616_0000401 | |||
| 1222 | Ga0495616_0002110 | |||
| 1223 | Ga0495620_0000365 | |||
| 1224 | Ga0495632_0000531 | |||
| 1225 | Ga0495632_0004712 | |||
| 1226 | Ga0495632_0018148 | |||
| 1227 | Ga0495632_0108904 | |||
| 1228 | Ga0495637_0005557 | |||
| 1229 | Ga0495609_0009588 | |||
| 1230 | Ga0495645_0142533 | |||
| 1231 | Ga0495668_0001761 | |||
| 1232 | Ga0495611_0000002 | |||
| 1233 | Ga0495625_0000002 | |||
| 1234 | Ga0495625_0044528 | |||
| 1235 | Ga0495658_0006050 | |||
| 1236 | Ga0495670_0000227 | |||
| 1237 | Ga0495670_0000599 | |||
| 1238 | Ga0495670_0018576 | |||
| 1239 | Ga0495671_0001204 | |||
| 1240 | Ga0495649_0000450 | |||
| 1241 | Ga0495649_0002369 | |||
| 1242 | Ga0495589_0000190 | |||
| 1243 | Ga0495660_0000437 | |||
| 1244 | Ga0495660_0000447 | |||
| 1245 | Ga0495683_0001059 | |||
| 1246 | Ga0495679_000003 | |||
| 1247 | Ga0495673_0000004 | |||
| 1248 | Ga0495673_0002144 | |||
| 1249 | Ga0495686_0000426 | |||
| 1250 | Ga0495686_0001228 | |||
| 1251 | Ga0496102_0068661 | |||
| 1252 | Ga0496104_0022187 | |||
| 1253 | Ga0496105_0002152 | |||
| 1254 | Ga0496106_0000168 | |||
| 1255 | Ga0496106_0364809 | |||
| 1256 | Ga0496113_0393183 | |||
| 1257 | Ga0496115_0000095 | |||
| 1258 | Ga0496115_0000729 | |||
| 1259 | Ga0496115_0024156 | |||
| 1260 | Ga0496115_0174095 | |||
| 1261 | Ga0496118_0003990 | |||
| 1262 | Ga0496119_0000966 | |||
| 1263 | Ga0496119_0039081 | |||
| 1264 | Ga0496120_0000409 | |||
| 1265 | Ga0496120_0001143 | |||
| 1266 | Ga0496121_0006433 | |||
| 1267 | Ga0496121_0008592 | |||
| 1268 | Ga0496121_0054584 | |||
| 1269 | Ga0496121_0129877 | |||
| 1270 | Ga0496123_0019361 | |||
| 1271 | Ga0496125_0023406 | |||
| 1272 | Ga0496125_0033120 | |||
| 1273 | Ga0496126_0022583 | |||
| 1274 | Ga0496126_0088204 | |||
| 1275 | Ga0496126_0088245 | |||
| 1276 | Ga0496126_0111159 | |||
| 1277 | Ga0496126_0121945 | |||
| 1278 | Ga0496126_0251981 | |||
| 1279 | Ga0495678_000019 | |||
| 1280 | Ga0495678_041224 | |||
| 1281 | Ga0495682_0007017 | |||
| 1282 | Ga0495682_0009237 | |||
| 1283 | Ga0501031_0030712 | |||
| 1284 | Ga0501031_0102052 | |||
| 1285 | Ga0501032_0023180 | |||
| 1286 | Ga0501032_0059078 | |||
| 1287 | Ga0501033_0013311 | |||
| 1288 | Ga0501033_0051516 | |||
| 1289 | Ga0501033_0067769 | |||
| 1290 | Ga0501033_0148602 | |||
| 1291 | Ga0501034_0000192 | |||
| 1292 | Ga0501034_0133380 | |||
| 1293 | Ga0501034_0179948 | |||
| 1294 | Ga0501036_0014906 | |||
| 1295 | Ga0501036_0050469 | |||
| 1296 | Ga0501036_0311277 | |||
| 1297 | Ga0501037_0033294 | |||
| 1298 | Ga0501037_0059645 | |||
| 1299 | Ga0501037_0212898 | |||
| 1300 | Ga0501038_0100136 | |||
| 1301 | Ga0501038_0156167 | |||
| 1302 | Ga0501043_0021893 | |||
| 1303 | Ga0501043_0028026 | |||
| 1304 | Ga0501043_0076697 | |||
| 1305 | Ga0501043_0090005 | |||
| 1306 | Ga0501043_0102993 | |||
| 1307 | Ga0501046_0017220 | |||
| 1308 | Ga0501046_0022689 | |||
| 1309 | Ga0501046_0117653 | |||
| 1310 | Ga0501046_0207844 | |||
| 1311 | Ga0501046_0286264 | |||
| 1312 | Ga0501047_0001922 | |||
| 1313 | Ga0501047_0006510 | |||
| 1314 | Ga0501047_0022027 | |||
| 1315 | Ga0501047_0024890 | |||
| 1316 | Ga0501047_0033102 | |||
| 1317 | Ga0501047_0166643 | |||
| 1318 | Ga0501047_0408958 | |||
| 1319 | Ga0501048_0019797 | |||
| 1320 | Ga0501048_0149062 | |||
| 1321 | Ga0501069_0009946 | |||
| 1322 | Ga0501069_0016129 | |||
| 1323 | Ga0501070_0000146 | |||
| 1324 | Ga0501070_0002845 | |||
| 1325 | Ga0501070_0014993 | |||
| 1326 | Ga0501070_0015050 | |||
| 1327 | Ga0501070_0021836 | |||
| 1328 | Ga0501070_0032970 | |||
| 1329 | Ga0501070_0162074 | |||
| 1330 | Ga0501070_0232154 | |||
| 1331 | Ga0501071_0009504 | |||
| 1332 | Ga0501073_0003754 | |||
| 1333 | Ga0501073_0017456 | |||
| 1334 | Ga0501074_0000885 | |||
| 1335 | Ga0501074_0003630 | |||
| 1336 | Ga0501074_0025187 | |||
| 1337 | Ga0501074_0038209 | |||
| 1338 | Ga0501076_0389984 | |||
| 1339 | Ga0501077_0081389 | |||
| 1340 | Ga0501079_0106154 | |||
| 1341 | Ga0501079_0202514 | |||
| 1342 | Ga0501080_0003851 | |||
| 1343 | Ga0501080_0008369 | |||
| 1344 | Ga0501080_0027011 | |||
| 1345 | Ga0501080_0067297 | |||
| 1346 | Ga0501080_0170188 | |||
| 1347 | Ga0501083_0116240 | |||
| 1348 | Ga0501035_0003194 | |||
| 1349 | Ga0501035_0006993 | |||
| 1350 | Ga0501035_0007555 | |||
| 1351 | Ga0501035_0011460 | |||
| 1352 | Ga0501035_0020740 | |||
| 1353 | Ga0501035_0022696 | |||
| 1354 | Ga0501035_0039145 | |||
| 1355 | Ga0501035_0177315 | |||
| 1356 | Ga0501035_0238564 | |||
| 1357 | Ga0501035_0427597 | |||
| 1358 | Ga0501044_0027845 | |||
| 1359 | Ga0501044_0053889 | |||
| 1360 | Ga0501044_0076810 | |||
| 1361 | Ga0501044_0136080 | |||
| 1362 | Ga0501044_0165656 | |||
| 1363 | Ga0501044_0266144 | |||
| 1364 | Ga0500643_000101 | |||
| 1365 | Ga0500646_0003484 | |||
| 1366 | Ga0500566_0126233 | |||
| 1367 | Ga0500555_001045 | |||
| 1368 | Ga0500614_013421 | |||
| 1369 | Ga0500652_106012 | |||
| 1370 | Ga0500568_0000645 | |||
| 1371 | Ga0500620_029835 | |||
| 1372 | Ga0501084_0279466 | |||
| 1373 | Ga0501082_0000402 | |||
| 1374 | Ga0501082_0019471 | |||
| 1375 | Ga0466962_0004934 | |||
| 1376 | Ga0466962_0005447 | |||
| 1377 | 2538834375 | |||
| 1378 | 2643828764 | |||
| 1379 | 2687584838 | |||
| 1380 | 2721025481 | |||
| 1381 | 2735834545 | |||
| 1382 | 2739225997 | |||
| 1383 | 2739733249 | |||
| 1384 | 2884338827 | |||
| 1385 | 2884415657 | |||
| 1386 | 2919086482 | |||
| 1387 | 2928966982 | |||
| 1388 | 2939613475 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uai-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa | 0.9662 | 4 | 309 |
| 3q0i-assembly1.cif.gz_A | methionyl-trna formyltransferase from vibrio cholerae | 0.9553 | 4 | 309 |
| 3r8x-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine | 0.9549 | 4 | 309 |
| 2fmt-assembly2.cif.gz_B | methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet | 0.9537 | 1 | 309 |
| 3tqq-assembly1.cif.gz_A | structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii | 0.9419 | 2 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9637 | 4 | 208 | 3.40.50.170 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9539 | 4 | 208 | 3.40.50.170 |
| 3rfoA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9479 | 4 | 208 | 3.40.50.170 |
| af_B4FRN6_28_246_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9372 | 1 | 208 | 3.40.50.170 |
| 3tqqA02 | Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain | 0.9361 | 210 | 309 | 3.10.25.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7K666-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9801 | 4 | 126 |
GO:0004479
GO:0005829 |
| AF-D8FIG2-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9786 | 4 | 208 |
GO:0004479
GO:0005829 |
| AF-A0A382L434-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9758 | 26 | 204 |
GO:0004479
GO:0005829 |
| AF-A0A7C5PBG2-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9739 | 46 | 306 |
GO:0004479
GO:0005829 |
| AF-D8FIG2-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9738 | 4 | 208 |
GO:0004479
GO:0005829 |