F475702

General Info

Members Datasets Scaffolds Average Seq Length
694 274 1388 311

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100002197|Ga0070680_1000021973
Length 338
Sequence MPGTRLRLVFAGTPDFAVPGLRACIEAGEVVAVYTQPDRPAGRGRKLAPSPVKQAALAAGLPVEQPESLKISETQARLRDWAPDLMVVIAYGLILPRKVLAIPRLGCWNLHASLLPRWRGAAPIQRAILAGDAETGVCLMQMEPGLDTGPVLLSESTPIRADDTGGTLHDRLADIGARVLRAGLQRVIAGESMSAMPQSGAGATYAHKLEKSEAELDFSRPAIELERKVRAFDPWPVAEADVAGERVRVWHALAVPSPESRETRRSCGSPSGPSASPMFAPASCLRSPSPGQIVAASKRGIDIVCGEGALRILKLQRAGGRVIGAADYVNARAGLRQA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
171 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
264 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
265 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
266 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
267 2734482264 Dyella sp. AD052 Isolate Unclassified
268 2738543009 Luteibacter sp. OK325 Isolate Unclassified
269 2739367700 Dyella sp. YR388 Isolate Unclassified
270 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
271 2884411467 Dyella sp. AD56 Isolate Rhizosphere
272 2919085039 Luteibacter sp. 1214 Isolate Unclassified
273 2928963466 Dyella japonica 1073 Isolate Unclassified
274 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 1.73
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 0
Rhizoplane 1.44
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100002197 3300005336 Bacteria 14383
2 JGI24741J21665_1000076 3300001915 Bacteria 24422
3 JGI24741J21665_1005437 3300001915 Bacteria 2662
4 JGI24740J21852_10000279 3300001979 Bacteria 21672
5 JGI24740J21852_10005082 3300001979 Bacteria 5586
6 JGI25156J39149_1002783 3300002705 Bacteria 6064
7 JGI25156J39149_1009367 3300002705 Bacteria 2388
8 JGI25162J39368_1001445 3300002737 Bacteria 12645
9 JGI25162J39368_1003044 3300002737 Bacteria 5436
10 JGI25154J39366_1004509 3300002738 Bacteria 2480
11 JGI25157J39369_1000344 3300002741 Bacteria 32837
12 JGI25157J39369_1001046 3300002741 Bacteria 12637
13 JGI25163J39215_1000588 3300002771 Bacteria 10200
14 JGI25164J39214_1000117 3300002772 Bacteria 76695
15 JGI25164J39214_1000714 3300002772 Bacteria 12645
16 JGI25164J39214_1000865 3300002772 Bacteria 10312
17 JGI25165J46597_1000235 3300003214 Bacteria 76684
18 JGI25165J46597_1001443 3300003214 Bacteria 12645
19 JGI25165J46597_1001780 3300003214 Bacteria 9280
20 Ga0055533_1001538 3300003756 Bacteria 6012
21 Ga0055527_1003026 3300003760 Bacteria 2614
22 Ga0055535_1000941 3300003761 Bacteria 19328
23 Ga0055535_1001080 3300003761 Bacteria 16755
24 Ga0055535_1001379 3300003761 Bacteria 12645
25 Ga0055542_1000245 3300003762 Bacteria 62120
26 Ga0055542_1001179 3300003762 Bacteria 14972
27 Ga0055542_1001180 3300003762 Bacteria 14953
28 Ga0055542_1001349 3300003762 Bacteria 12645
29 Ga0055529_1000314 3300003763 Bacteria 55435
30 Ga0055529_1001072 3300003763 Bacteria 12645
31 Ga0055529_1002135 3300003763 Bacteria 4157
32 Ga0070658_10002163 3300005327 Bacteria 16493
33 Ga0070683_100015187 3300005329 Bacteria 6760
34 Ga0070683_100015955 3300005329 Bacteria 6608
35 Ga0070683_100293315 3300005329 Bacteria 1547
36 Ga0070690_100029514 3300005330 Bacteria 3402
37 Ga0070670_100227448 3300005331 Bacteria 1623
38 Ga0068869_100124752 3300005334 Bacteria 1973
39 Ga0070666_10000001 3300005335 Bacteria 543080
40 Ga0070666_10052751 3300005335 Bacteria 2741
41 Ga0070680_100000946 3300005336 Bacteria 20577
42 Ga0070680_100100120 3300005336 Bacteria 2405
43 Ga0070682_100014480 3300005337 Bacteria 4559
44 Ga0070682_100014970 3300005337 Bacteria 4491
45 Ga0070682_100015837 3300005337 Bacteria 4375
46 Ga0070682_100045315 3300005337 Bacteria 2726
47 Ga0068868_100016923 3300005338 Bacteria 5424
48 Ga0068868_100266644 3300005338 Bacteria 1446
49 Ga0070660_100046496 3300005339 Bacteria 3327
50 Ga0070660_100049491 3300005339 Bacteria 3231
51 Ga0070660_100163024 3300005339 Bacteria 1797
52 Ga0070661_100002526 3300005344 Bacteria 12533
53 Ga0070661_100003952 3300005344 Bacteria 10199
54 Ga0070661_100034435 3300005344 Bacteria 3672
55 Ga0070661_100096555 3300005344 Bacteria 2193
56 Ga0070692_10000307 3300005345 Bacteria 13933
57 Ga0070692_10000420 3300005345 Bacteria 12798
58 Ga0070692_10159273 3300005345 Bacteria 1292
59 Ga0070668_100064734 3300005347 Bacteria 2835
60 Ga0070675_100074093 3300005354 Bacteria 2827
61 Ga0070688_100125161 3300005365 Bacteria 1727
62 Ga0070659_100013061 3300005366 Bacteria 6176
63 Ga0070659_100028080 3300005366 Bacteria 4342
64 Ga0070667_100013367 3300005367 Bacteria 6786
65 Ga0070667_100139556 3300005367 Bacteria 2121
66 Ga0070667_100317045 3300005367 Bacteria 1406
67 Ga0070714_100000136 3300005435 Bacteria 58402
68 Ga0070711_100024811 3300005439 Bacteria 3916
69 Ga0070663_100035443 3300005455 Bacteria 3463
70 Ga0070662_100065358 3300005457 Bacteria 2666
71 Ga0070662_100175736 3300005457 Bacteria 1685
72 Ga0070681_10000552 3300005458 Bacteria 30843
73 Ga0070681_10003671 3300005458 Bacteria 14393
74 Ga0070681_10004860 3300005458 Bacteria 12890
75 Ga0070681_10007360 3300005458 Bacteria 10759
76 Ga0070681_10039513 3300005458 Bacteria 4729
77 Ga0070681_10045534 3300005458 Bacteria 4389
78 Ga0070681_10207387 3300005458 Bacteria 1876
79 Ga0068867_100308495 3300005459 Bacteria 1307
80 Ga0070685_10002434 3300005466 Bacteria 9568
81 Ga0070685_10013112 3300005466 Bacteria 4364
82 Ga0070679_100002097 3300005530 Bacteria 17962
83 Ga0070679_100003490 3300005530 Bacteria 14393
84 Ga0070679_100012167 3300005530 Bacteria 8221
85 Ga0070679_100049404 3300005530 Bacteria 4189
86 Ga0070679_100160069 3300005530 Bacteria 2226
87 Ga0070684_100008594 3300005535 Bacteria 7998
88 Ga0070684_100010992 3300005535 Bacteria 7199
89 Ga0070684_100388599 3300005535 Bacteria 1286
90 Ga0068853_100002290 3300005539 Bacteria 14303
91 Ga0068853_100015163 3300005539 Bacteria 6336
92 Ga0068853_100044837 3300005539 Bacteria 3786
93 Ga0068853_100059863 3300005539 Bacteria 3290
94 Ga0068853_100063960 3300005539 Bacteria 3188
95 Ga0068853_100073444 3300005539 Bacteria 2982
96 Ga0068853_100214666 3300005539 Bacteria 1755
97 Ga0070672_100029858 3300005543 Bacteria 4092
98 Ga0070686_100035506 3300005544 Bacteria 3080
99 Ga0070696_100034217 3300005546 Bacteria 3495
100 Ga0070696_100154920 3300005546 Bacteria 1684
101 Ga0070693_100006423 3300005547 Bacteria 5697
102 Ga0070693_100010956 3300005547 Bacteria 4556
103 Ga0070693_100019703 3300005547 Bacteria 3543
104 Ga0070693_100101715 3300005547 Bacteria 1752
105 Ga0070665_100000712 3300005548 Bacteria 44327
106 Ga0070665_100009799 3300005548 Bacteria 9687
107 Ga0070665_100026563 3300005548 Bacteria 5829
108 Ga0068855_100016860 3300005563 Bacteria 8784
109 Ga0068855_100108668 3300005563 Bacteria 3185
110 Ga0068855_100123760 3300005563 Bacteria 2958
111 Ga0068855_100254647 3300005563 Bacteria 1957
112 Ga0068855_100493937 3300005563 Bacteria 1331
113 Ga0068855_100505101 3300005563 Bacteria 1313
114 Ga0070664_100146377 3300005564 Bacteria 2083
115 Ga0068857_100068091 3300005577 Bacteria 3169
116 Ga0068854_100000026 3300005578 Bacteria 118880
117 Ga0068854_100003525 3300005578 Bacteria 9775
118 Ga0068854_100006081 3300005578 Bacteria 7656
119 Ga0068856_100003430 3300005614 Bacteria 16024
120 Ga0068856_100003717 3300005614 Bacteria 15310
121 Ga0068856_100086051 3300005614 Bacteria 3123
122 Ga0068856_100154783 3300005614 Bacteria 2302
123 Ga0068856_100258841 3300005614 Bacteria 1755
124 Ga0068852_100002438 3300005616 Bacteria 12803
125 Ga0068852_100027419 3300005616 Bacteria 4642
126 Ga0068852_100046785 3300005616 Bacteria 3687
127 Ga0068852_100077654 3300005616 Bacteria 2936
128 Ga0068852_100081911 3300005616 Bacteria 2866
129 Ga0068852_100093186 3300005616 Bacteria 2699
130 Ga0068859_100185524 3300005617 Bacteria 2164
131 Ga0068859_100194926 3300005617 Bacteria 2110
132 Ga0068864_100001937 3300005618 Bacteria 17002
133 Ga0068864_100169015 3300005618 Bacteria 1992
134 Ga0068864_100441945 3300005618 Bacteria 1242
135 Ga0068851_10003106 3300005834 Bacteria 7357
136 Ga0068851_10027637 3300005834 Bacteria 2797
137 Ga0068851_10050072 3300005834 Bacteria 2120
138 Ga0068870_10063166 3300005840 Bacteria 1997
139 Ga0068863_100113210 3300005841 Bacteria 2584
140 Ga0068863_100179577 3300005841 Bacteria 2032
141 Ga0068863_100312146 3300005841 Bacteria 1526
142 Ga0068863_100333736 3300005841 Bacteria 1474
143 Ga0068858_100003930 3300005842 Bacteria 14672
144 Ga0068858_100072506 3300005842 Bacteria 3195
145 Ga0068860_100000822 3300005843 Bacteria 34721
146 Ga0068860_100012637 3300005843 Bacteria 8308
147 Ga0097621_100052340 3300006237 Bacteria 3326
148 Ga0097621_100069711 3300006237 Bacteria 2903
149 Ga0097621_100122753 3300006237 Bacteria 2205
150 Ga0068871_100450501 3300006358 Bacteria 1153
151 Ga0068865_100003462 3300006881 Bacteria 9456
152 Ga0068865_100025746 3300006881 Bacteria 3874
153 Ga0068865_100050142 3300006881 Bacteria 2882
154 Ga0097620_100185528 3300006931 Bacteria 2164
155 Ga0097620_100194937 3300006931 Bacteria 2110
156 Ga0105240_10003317 3300009093 Bacteria 25157
157 Ga0105240_10035352 3300009093 Bacteria 6440
158 Ga0105240_10076161 3300009093 Bacteria 4137
159 Ga0105240_10115212 3300009093 Bacteria 3245
160 Ga0105240_10173120 3300009093 Bacteria 2555
161 Ga0105240_10289346 3300009093 Bacteria 1879
162 Ga0105245_10479507 3300009098 Bacteria 1257
163 Ga0105247_10000804 3300009101 Bacteria 23935
164 Ga0105241_10036533 3300009174 Bacteria 3697
165 Ga0105241_10212677 3300009174 Bacteria 1621
166 Ga0105241_10535294 3300009174 Bacteria 1049
167 Ga0105242_10153044 3300009176 Bacteria 2013
168 Ga0105248_10190603 3300009177 Bacteria 2310
169 Ga0105237_10000108 3300009545 Bacteria 116481
170 Ga0105237_10022010 3300009545 Bacteria 6543
171 Ga0105237_10060807 3300009545 Bacteria 3778
172 Ga0105237_10168033 3300009545 Bacteria 2193
173 Ga0105237_10224269 3300009545 Bacteria 1880
174 Ga0105237_10663088 3300009545 Bacteria 1050
175 Ga0105238_10000729 3300009551 Bacteria 34322
176 Ga0105238_10001656 3300009551 Bacteria 22366
177 Ga0105238_10023815 3300009551 Bacteria 6241
178 Ga0105238_10029898 3300009551 Bacteria 5547
179 Ga0105238_10033003 3300009551 Bacteria 5268
180 Ga0105238_10042081 3300009551 Bacteria 4626
181 Ga0105238_10059367 3300009551 Bacteria 3832
182 Ga0105238_10063300 3300009551 Bacteria 3699
183 Ga0105238_10314826 3300009551 Bacteria 1550
184 Ga0105238_10492747 3300009551 Bacteria 1226
185 Ga0105249_10011804 3300009553 Bacteria 7681
186 Ga0105239_10000830 3300010375 Bacteria 43916
187 Ga0105239_10011256 3300010375 Bacteria 9979
188 Ga0105239_10059531 3300010375 Bacteria 4192
189 Ga0105239_10082349 3300010375 Bacteria 3543
190 Ga0105239_10212423 3300010375 Bacteria 2169
191 Ga0105239_10416576 3300010375 Bacteria 1521
192 Ga0105246_10024732 3300011119 Bacteria 3906
193 Ga0157373_10002433 3300013100 Bacteria 14173
194 Ga0157373_10005601 3300013100 Bacteria 9416
195 Ga0157373_10020677 3300013100 Bacteria 4781
196 Ga0157373_10040386 3300013100 Bacteria 3339
197 Ga0157371_10005965 3300013102 Bacteria 10162
198 Ga0157371_10008699 3300013102 Bacteria 8059
199 Ga0157371_10033226 3300013102 Bacteria 3708
200 Ga0157371_10161455 3300013102 Bacteria 1601
201 Ga0157370_10001106 3300013104 Bacteria 33789
202 Ga0157370_10007218 3300013104 Bacteria 12126
203 Ga0157370_10008714 3300013104 Bacteria 10912
204 Ga0157370_10010315 3300013104 Bacteria 9854
205 Ga0157370_10115169 3300013104 Bacteria 2511
206 Ga0157370_10167396 3300013104 Bacteria 2043
207 Ga0157369_10001250 3300013105 Bacteria 31665
208 Ga0157369_10006062 3300013105 Bacteria 14025
209 Ga0157369_10022892 3300013105 Bacteria 6967
210 Ga0157369_10130393 3300013105 Bacteria 2665
211 Ga0157374_10077155 3300013296 Bacteria 3152
212 Ga0157378_10069854 3300013297 Bacteria 3152
213 Ga0157378_10268527 3300013297 Bacteria 1640
214 Ga0163162_10000310 3300013306 Bacteria 45072
215 Ga0163162_10000642 3300013306 Bacteria 32380
216 Ga0163162_10087782 3300013306 Bacteria 3189
217 Ga0163162_10224333 3300013306 Bacteria 2009
218 Ga0157372_10007610 3300013307 Bacteria 11517
219 Ga0157372_10009427 3300013307 Bacteria 10387
220 Ga0157372_10011313 3300013307 Bacteria 9489
221 Ga0157372_10021398 3300013307 Bacteria 6987
222 Ga0157372_10029270 3300013307 Bacteria 6013
223 Ga0157372_10059694 3300013307 Bacteria 4267
224 Ga0157372_10094119 3300013307 Bacteria 3411
225 Ga0157372_10813170 3300013307 Bacteria 1085
226 Ga0157375_10031352 3300013308 Bacteria 5024
227 Ga0157375_10226444 3300013308 Bacteria 2028
228 Ga0163163_10001487 3300014325 Bacteria 19846
229 Ga0163163_10056882 3300014325 Bacteria 3866
230 Ga0157379_10013005 3300014968 Bacteria 7285
231 Ga0157379_10305607 3300014968 Bacteria 1450
232 Ga0157376_10014582 3300014969 Bacteria 5905
233 Ga0157376_10037971 3300014969 Bacteria 3916
234 Ga0157376_10045836 3300014969 Bacteria 3602
235 Ga0157376_10074292 3300014969 Bacteria 2898
236 Ga0182006_1000041 3300015261 Bacteria 203413
237 Ga0182006_1000133 3300015261 Bacteria 80418
238 Ga0182007_10003846 3300015262 Bacteria 6981
239 Ga0182005_1000257 3300015265 Bacteria 33567
240 Ga0182005_1002454 3300015265 Bacteria 6617
241 Ga0183368_1002 3300015687 Bacteria 1865598
242 Ga0163161_10012913 3300017792 Bacteria 5804
243 Ga0197907_10696324 3300020069 Bacteria 2433
244 Ga0206356_10033220 3300020070 Bacteria 2954
245 Ga0206356_10907506 3300020070 Bacteria 2184
246 Ga0206356_11546151 3300020070 Bacteria 3937
247 Ga0206354_10818447 3300020081 Bacteria 3035
248 Ga0206354_10932484 3300020081 Bacteria 4408
249 Ga0206354_11021742 3300020081 Bacteria 1863
250 Ga0206353_10050604 3300020082 Bacteria 3105
251 Ga0206353_10485823 3300020082 Bacteria 3438
252 Ga0206353_10562421 3300020082 Bacteria 1369
253 Ga0206353_10579021 3300020082 Bacteria 3894
254 Ga0209760_100701 3300025207 Bacteria 5170
255 Ga0209784_100053 3300025224 Bacteria 182075
256 Ga0209566_100922 3300025225 Bacteria 13688
257 Ga0209674_100014 3300025226 Bacteria 704989
258 Ga0209672_100089 3300025228 Bacteria 120658
259 Ga0209672_111421 3300025228 Bacteria 1150
260 Ga0207427_100051 3300025231 Bacteria 218792
261 Ga0207427_100061 3300025231 Bacteria 182815
262 Ga0207427_100129 3300025231 Bacteria 94644
263 Ga0209437_100037 3300025233 Bacteria 459730
264 Ga0209437_100118 3300025233 Bacteria 207534
265 Ga0209437_100152 3300025233 Bacteria 154551
266 Ga0209437_100406 3300025233 Bacteria 39888
267 Ga0209258_100090 3300025242 Bacteria 232619
268 Ga0209258_100101 3300025242 Bacteria 210252
269 Ga0209258_100138 3300025242 Bacteria 167495
270 Ga0209258_100479 3300025242 Bacteria 42065
271 Ga0209258_101737 3300025242 Bacteria 6756
272 Ga0209646_1001427 3300025246 Bacteria 6440
273 Ga0209646_1002026 3300025246 Bacteria 4832
274 Ga0209646_1002739 3300025246 Bacteria 3744
275 Ga0209026_1000104 3300025250 Bacteria 152614
276 Ga0209026_1000294 3300025250 Bacteria 55402
277 Ga0209026_1000553 3300025250 Bacteria 25735
278 Ga0209148_1000001 3300025254 Bacteria 2545271
279 Ga0209148_1000002 3300025254 Bacteria 2399500
280 Ga0209148_1000065 3300025254 Bacteria 344489
281 Ga0209148_1000079 3300025254 Bacteria 288992
282 Ga0209759_1000165 3300025256 Bacteria 113117
283 Ga0209759_1001467 3300025256 Bacteria 13162
284 Ga0209759_1002925 3300025256 Bacteria 7154
285 Ga0209759_1009463 3300025256 Bacteria 2944
286 Ga0209233_1000002 3300025261 Bacteria 2501366
287 Ga0209233_1000046 3300025261 Bacteria 470971
288 Ga0209233_1000099 3300025261 Bacteria 293995
289 Ga0209233_1006812 3300025261 Bacteria 3656
290 Ga0209233_1008159 3300025261 Bacteria 3263
291 Ga0209455_1000016 3300025272 Bacteria 753097
292 Ga0209455_1000079 3300025272 Bacteria 268778
293 Ga0209455_1000189 3300025272 Bacteria 92877
294 Ga0209455_1003693 3300025272 Bacteria 5298
295 Ga0209051_1004768 3300025303 Bacteria 8193
296 Ga0207656_10002191 3300025321 Bacteria 6536
297 Ga0207656_10062171 3300025321 Bacteria 1640
298 Ga0207710_10014465 3300025900 Bacteria 3329
299 Ga0207680_10000139 3300025903 Bacteria 34616
300 Ga0207680_10074224 3300025903 Bacteria 2117
301 Ga0207680_10187221 3300025903 Bacteria 1403
302 Ga0207647_10000002 3300025904 Bacteria 400771
303 Ga0207647_10000175 3300025904 Bacteria 51622
304 Ga0207647_10000224 3300025904 Bacteria 46793
305 Ga0207647_10000525 3300025904 Bacteria 30595
306 Ga0207647_10002255 3300025904 Bacteria 14694
307 Ga0207647_10038965 3300025904 Bacteria 3001
308 Ga0207643_10012719 3300025908 Bacteria 4549
309 Ga0207705_10000198 3300025909 Bacteria 61005
310 Ga0207705_10001050 3300025909 Bacteria 22453
311 Ga0207705_10001085 3300025909 Bacteria 22127
312 Ga0207705_10001679 3300025909 Bacteria 17622
313 Ga0207705_10001682 3300025909 Bacteria 17606
314 Ga0207705_10005637 3300025909 Bacteria 9353
315 Ga0207705_10140855 3300025909 Bacteria 1801
316 Ga0207654_10003591 3300025911 Bacteria 7842
317 Ga0207707_10000020 3300025912 Bacteria 205480
318 Ga0207707_10000131 3300025912 Bacteria 77593
319 Ga0207707_10000136 3300025912 Bacteria 76610
320 Ga0207707_10000942 3300025912 Bacteria 28059
321 Ga0207707_10001255 3300025912 Bacteria 23780
322 Ga0207707_10001368 3300025912 Bacteria 22608
323 Ga0207707_10002269 3300025912 Bacteria 17392
324 Ga0207707_10003877 3300025912 Bacteria 13260
325 Ga0207707_10006101 3300025912 Bacteria 10539
326 Ga0207707_10032416 3300025912 Bacteria 4573
327 Ga0207707_10183288 3300025912 Bacteria 1827
328 Ga0207695_10000101 3300025913 Bacteria 258504
329 Ga0207695_10000418 3300025913 Bacteria 94702
330 Ga0207695_10000751 3300025913 Bacteria 62399
331 Ga0207695_10003587 3300025913 Bacteria 21711
332 Ga0207695_10003838 3300025913 Bacteria 20806
333 Ga0207695_10004386 3300025913 Bacteria 19292
334 Ga0207695_10019450 3300025913 Bacteria 7822
335 Ga0207695_10032954 3300025913 Bacteria 5661
336 Ga0207695_10057689 3300025913 Bacteria 4033
337 Ga0207695_10059440 3300025913 Bacteria 3963
338 Ga0207671_10001039 3300025914 Bacteria 33742
339 Ga0207671_10022465 3300025914 Bacteria 4770
340 Ga0207671_10063712 3300025914 Bacteria 2740
341 Ga0207660_10000594 3300025917 Bacteria 24432
342 Ga0207660_10001035 3300025917 Bacteria 18403
343 Ga0207660_10001057 3300025917 Bacteria 18244
344 Ga0207660_10001511 3300025917 Bacteria 15659
345 Ga0207660_10052034 3300025917 Bacteria 2914
346 Ga0207660_10141499 3300025917 Bacteria 1839
347 Ga0207657_10001821 3300025919 Bacteria 22995
348 Ga0207657_10004696 3300025919 Bacteria 14420
349 Ga0207657_10006034 3300025919 Bacteria 12597
350 Ga0207657_10011359 3300025919 Bacteria 8846
351 Ga0207657_10035064 3300025919 Bacteria 4504
352 Ga0207657_10098901 3300025919 Bacteria 2424
353 Ga0207657_10100370 3300025919 Bacteria 2403
354 Ga0207657_10196769 3300025919 Bacteria 1623
355 Ga0207649_10010581 3300025920 Bacteria 5073
356 Ga0207649_10015754 3300025920 Bacteria 4249
357 Ga0207649_10020685 3300025920 Bacteria 3775
358 Ga0207649_10023168 3300025920 Bacteria 3593
359 Ga0207649_10032787 3300025920 Bacteria 3099
360 Ga0207649_10218335 3300025920 Bacteria 1357
361 Ga0207652_10000037 3300025921 Bacteria 134369
362 Ga0207652_10000226 3300025921 Bacteria 59362
363 Ga0207652_10000902 3300025921 Bacteria 28060
364 Ga0207652_10001301 3300025921 Bacteria 22199
365 Ga0207652_10002104 3300025921 Bacteria 17100
366 Ga0207652_10007880 3300025921 Bacteria 8551
367 Ga0207694_10000336 3300025924 Bacteria 44443
368 Ga0207694_10002801 3300025924 Bacteria 14074
369 Ga0207694_10003401 3300025924 Bacteria 12671
370 Ga0207694_10003716 3300025924 Bacteria 12087
371 Ga0207694_10005085 3300025924 Bacteria 10166
372 Ga0207694_10043610 3300025924 Bacteria 3462
373 Ga0207694_10090234 3300025924 Bacteria 2418
374 Ga0207659_10090706 3300025926 Bacteria 2282
375 Ga0207664_10000150 3300025929 Bacteria 56559
376 Ga0207690_10001578 3300025932 Bacteria 14250
377 Ga0207690_10005495 3300025932 Bacteria 7477
378 Ga0207690_10008354 3300025932 Bacteria 6145
379 Ga0207690_10022761 3300025932 Bacteria 3902
380 Ga0207690_10023298 3300025932 Bacteria 3862
381 Ga0207690_10025875 3300025932 Bacteria 3690
382 Ga0207690_10125735 3300025932 Bacteria 1869
383 Ga0207690_10488052 3300025932 Bacteria 995
384 Ga0207706_10010415 3300025933 Bacteria 8494
385 Ga0207706_10028042 3300025933 Bacteria 5030
386 Ga0207706_10269459 3300025933 Bacteria 1486
387 Ga0207670_10030810 3300025936 Bacteria 3429
388 Ga0207704_10228326 3300025938 Bacteria 1382
389 Ga0207691_10009722 3300025940 Bacteria 9229
390 Ga0207691_10036351 3300025940 Bacteria 4563
391 Ga0207689_10016937 3300025942 Bacteria 6166
392 Ga0207661_10005158 3300025944 Bacteria 9179
393 Ga0207661_10005219 3300025944 Bacteria 9131
394 Ga0207661_10016793 3300025944 Bacteria 5404
395 Ga0207679_10081290 3300025945 Bacteria 2477
396 Ga0207667_10000077 3300025949 Bacteria 166095
397 Ga0207667_10000739 3300025949 Bacteria 42543
398 Ga0207667_10004983 3300025949 Bacteria 16228
399 Ga0207667_10006687 3300025949 Bacteria 13940
400 Ga0207667_10010885 3300025949 Bacteria 10608
401 Ga0207667_10013352 3300025949 Bacteria 9402
402 Ga0207667_10031674 3300025949 Bacteria 5706
403 Ga0207667_10048246 3300025949 Bacteria 4504
404 Ga0207667_10143865 3300025949 Bacteria 2455
405 Ga0207667_10437060 3300025949 Bacteria 1330
406 Ga0207712_10000105 3300025961 Bacteria 95153
407 Ga0207640_10000032 3300025981 Bacteria 116582
408 Ga0207640_10000479 3300025981 Bacteria 24364
409 Ga0207640_10001610 3300025981 Bacteria 12117
410 Ga0207640_10001639 3300025981 Bacteria 11992
411 Ga0207640_10002761 3300025981 Bacteria 9396
412 Ga0207640_10055275 3300025981 Bacteria 2600
413 Ga0207640_10297027 3300025981 Bacteria 1276
414 Ga0207658_10025041 3300025986 Bacteria 4176
415 Ga0207703_10004097 3300026035 Bacteria 12028
416 Ga0207703_10026189 3300026035 Bacteria 4589
417 Ga0207639_10001251 3300026041 Bacteria 17212
418 Ga0207639_10004488 3300026041 Bacteria 9416
419 Ga0207639_10004560 3300026041 Bacteria 9331
420 Ga0207639_10005917 3300026041 Bacteria 8289
421 Ga0207639_10009206 3300026041 Bacteria 6808
422 Ga0207639_10036014 3300026041 Bacteria 3664
423 Ga0207639_10041665 3300026041 Bacteria 3437
424 Ga0207639_10086821 3300026041 Bacteria 2492
425 Ga0207639_10137212 3300026041 Bacteria 2033
426 Ga0207678_10001007 3300026067 Bacteria 25669
427 Ga0207678_10001852 3300026067 Bacteria 19350
428 Ga0207678_10003314 3300026067 Bacteria 14521
429 Ga0207678_10005388 3300026067 Bacteria 11460
430 Ga0207678_10008801 3300026067 Bacteria 8882
431 Ga0207678_10068948 3300026067 Bacteria 3033
432 Ga0207678_10078439 3300026067 Bacteria 2829
433 Ga0207702_10001658 3300026078 Bacteria 21995
434 Ga0207702_10007180 3300026078 Bacteria 9533
435 Ga0207702_10077386 3300026078 Bacteria 2877
436 Ga0207702_10544218 3300026078 Bacteria 1135
437 Ga0207641_10012492 3300026088 Bacteria 6960
438 Ga0207641_10020195 3300026088 Bacteria 5469
439 Ga0207641_10070822 3300026088 Bacteria 2997
440 Ga0207641_10076479 3300026088 Bacteria 2894
441 Ga0207648_10022355 3300026089 Bacteria 5682
442 Ga0207648_10287639 3300026089 Bacteria 1471
443 Ga0207676_10291396 3300026095 Bacteria 1486
444 Ga0207674_10004053 3300026116 Bacteria 17767
445 Ga0207674_10006924 3300026116 Bacteria 13282
446 Ga0207674_10014510 3300026116 Bacteria 8700
447 Ga0207674_10040168 3300026116 Bacteria 4849
448 Ga0207674_10076033 3300026116 Bacteria 3367
449 Ga0207674_10165082 3300026116 Bacteria 2168
450 Ga0207683_10009137 3300026121 Bacteria 8448
451 Ga0207698_10001009 3300026142 Bacteria 16385
452 Ga0207698_10004040 3300026142 Bacteria 8909
453 Ga0207698_10008897 3300026142 Bacteria 6366
454 Ga0207698_10011336 3300026142 Bacteria 5773
455 Ga0207698_10017935 3300026142 Bacteria 4812
456 Ga0268266_10000008 3300028379 Bacteria 1161875
457 Ga0268266_10000011 3300028379 Bacteria 757403
458 Ga0268266_10082893 3300028379 Bacteria 2798
459 Ga0307508_10027843 3300031616 Bacteria 5114
460 Ga0316576_10035079 3300031727 Bacteria 3579
461 Ga0316578_10166865 3300031728 Bacteria 1327
462 Ga0307516_10052276 3300031730 Bacteria 3999
463 Ga0307405_10139831 3300031731 Bacteria 1686
464 Ga0307412_10003896 3300031911 Bacteria 8306
465 Ga0316593_10103114 3300032168 Bacteria 1014
466 Ga0307510_10004110 3300033180 Bacteria 17078
467 Ga0373944_0013530 3300035089 Bacteria 2265
468 Ga0373943_0203309 3300035170 Bacteria 1097
469 Ga0316574_0050891 3300035398 Bacteria 2580
470 Ga0316574_0116889 3300035398 Bacteria 1711
471 Ga0373924_0134581 3300035410 Bacteria 1076
472 Ga0373933_0010679 3300035724 Bacteria 5036
473 Ga0373937_0016801 3300036401 Bacteria 6505
474 Ga0316584_0047429 3300036712 Bacteria 3209
475 Ga0395899_0023623 3300037312 Bacteria 4654
476 Ga0395899_0036443 3300037312 Bacteria 3689
477 Ga0395899_0053699 3300037312 Bacteria 2982
478 Ga0395900_0003805 3300037418 Bacteria 16142
479 Ga0395900_0004421 3300037418 Bacteria 14904
480 Ga0395900_0124201 3300037418 Bacteria 2647
481 Ga0395900_0140270 3300037418 Bacteria 2475
482 Ga0395900_0504475 3300037418 Bacteria 1160
483 Ga0395898_0000013 3300037466 Bacteria 458788
484 Ga0395898_0006262 3300037466 Bacteria 12730
485 Ga0395901_0022120 3300038443 Bacteria 6514
486 Ga0395901_0050913 3300038443 Bacteria 4303
487 Ga0395901_0098919 3300038443 Bacteria 3058
488 Ga0395901_0160042 3300038443 Bacteria 2365
489 Ga0395901_0209158 3300038443 Bacteria 2043
490 Ga0400483_022784 3300039062 Bacteria 6265
491 Ga0400483_062577 3300039062 Bacteria 66463
492 Ga0400483_150507 3300039062 Bacteria 2303
493 Ga0400483_276618 3300039062 Bacteria 37892
494 Ga0400489_37299 3300039093 Bacteria 63307
495 Ga0439436_0000004 3300041404 Bacteria 175137
496 Ga0439465_0001501 3300041413 Bacteria 7564
497 Ga0439432_020495 3300042006 Bacteria 2197
498 Ga0466969_0037206 3300044656 Bacteria 2456
499 Ga0466966_0011070 3300044684 Bacteria 5987
500 Ga0466966_0017959 3300044684 Bacteria 4670
501 Ga0466961_0004762 3300044693 Bacteria 8540
502 Ga0466964_0005140 3300044706 Bacteria 4847
503 Ga0466971_0001794 3300044719 Bacteria 9109
504 Ga0466968_0000061 3300044735 Bacteria 31791
505 Ga0466970_0000496 3300044765 Bacteria 19359
506 Ga0466970_0003435 3300044765 Bacteria 7711
507 Ga0466960_0045412 3300044901 Bacteria 2098
508 Ga0466959_0021971 3300045049 Bacteria 4712
509 Ga0466959_0059609 3300045049 Bacteria 2779
510 Ga0466958_0012695 3300045836 Bacteria 4777
511 Ga0495617_000085 3300046452 Bacteria 67837
512 Ga0495617_001170 3300046452 Bacteria 11853
513 Ga0495629_0038732 3300046459 Bacteria 3357
514 Ga0495638_0000236 3300046460 Bacteria 75732
515 Ga0495638_0000754 3300046460 Bacteria 34482
516 Ga0495638_0001087 3300046460 Bacteria 26471
517 Ga0495650_0000191 3300046471 Bacteria 132016
518 Ga0495650_0012428 3300046471 Bacteria 4582
519 Ga0495584_0000457 3300046491 Bacteria 28087
520 Ga0495585_0003589 3300046492 Bacteria 10405
521 Ga0495607_0000131 3300046501 Bacteria 80259
522 Ga0495583_0012629 3300046506 Bacteria 4764
523 Ga0495606_0000016 3300046507 Bacteria 284865
524 Ga0495606_0001253 3300046507 Bacteria 35422
525 Ga0495606_0001443 3300046507 Bacteria 31874
526 Ga0495610_0003274 3300046512 Bacteria 12764
527 Ga0495616_0000401 3300046513 Bacteria 33353
528 Ga0495616_0002110 3300046513 Bacteria 13330
529 Ga0495620_0000365 3300046515 Bacteria 31131
530 Ga0495632_0000531 3300046519 Bacteria 36042
531 Ga0495632_0004712 3300046519 Bacteria 9206
532 Ga0495632_0018148 3300046519 Bacteria 3867
533 Ga0495632_0108904 3300046519 Bacteria 1301
534 Ga0495637_0005557 3300046520 Bacteria 6401
535 Ga0495609_0009588 3300046538 Bacteria 4681
536 Ga0495645_0142533 3300046543 Bacteria 1671
537 Ga0495668_0001761 3300046616 Bacteria 19820
538 Ga0495611_0000002 3300046648 Bacteria 705677
539 Ga0495625_0000002 3300046660 Bacteria 813323
540 Ga0495625_0044528 3300046660 Bacteria 3213
541 Ga0495658_0006050 3300046683 Bacteria 5944
542 Ga0495670_0000227 3300046691 Bacteria 25531
543 Ga0495670_0000599 3300046691 Bacteria 17194
544 Ga0495670_0018576 3300046691 Bacteria 3423
545 Ga0495671_0001204 3300046692 Bacteria 17706
546 Ga0495649_0000450 3300046694 Bacteria 35527
547 Ga0495649_0002369 3300046694 Bacteria 13331
548 Ga0495589_0000190 3300046794 Bacteria 54374
549 Ga0495660_0000437 3300046810 Bacteria 34919
550 Ga0495660_0000447 3300046810 Bacteria 34412
551 Ga0495683_0001059 3300047323 Bacteria 19067
552 Ga0495679_000003 3300047446 Bacteria 787868
553 Ga0495673_0000004 3300047469 Bacteria 1354526
554 Ga0495673_0002144 3300047469 Bacteria 14333
555 Ga0495686_0000426 3300047472 Bacteria 66285
556 Ga0495686_0001228 3300047472 Bacteria 29296
557 Ga0496102_0068661 3300048905 Bacteria 3253
558 Ga0496104_0022187 3300048907 Bacteria 5832
559 Ga0496105_0002152 3300048908 Bacteria 14259
560 Ga0496106_0000168 3300048909 Bacteria 47597
561 Ga0496106_0364809 3300048909 Bacteria 1160
562 Ga0496113_0393183 3300048916 Bacteria 1113
563 Ga0496115_0000095 3300048918 Bacteria 82835
564 Ga0496115_0000729 3300048918 Bacteria 24348
565 Ga0496115_0024156 3300048918 Bacteria 4722
566 Ga0496115_0174095 3300048918 Bacteria 1779
567 Ga0496118_0003990 3300048921 Bacteria 17983
568 Ga0496119_0000966 3300048922 Bacteria 36886
569 Ga0496119_0039081 3300048922 Bacteria 3054
570 Ga0496120_0000409 3300048923 Bacteria 68984
571 Ga0496120_0001143 3300048923 Bacteria 34091
572 Ga0496121_0006433 3300048924 Bacteria 14585
573 Ga0496121_0008592 3300048924 Bacteria 11958
574 Ga0496121_0054584 3300048924 Bacteria 3336
575 Ga0496121_0129877 3300048924 Bacteria 1888
576 Ga0496123_0019361 3300048926 Bacteria 5368
577 Ga0496125_0023406 3300048928 Bacteria 5702
578 Ga0496125_0033120 3300048928 Bacteria 4579
579 Ga0496126_0022583 3300048929 Bacteria 6117
580 Ga0496126_0088204 3300048929 Bacteria 2733
581 Ga0496126_0088245 3300048929 Bacteria 2732
582 Ga0496126_0111159 3300048929 Bacteria 2386
583 Ga0496126_0121945 3300048929 Bacteria 2260
584 Ga0496126_0251981 3300048929 Bacteria 1471
585 Ga0495678_000019 3300049459 Bacteria 269723
586 Ga0495678_041224 3300049459 Bacteria 1849
587 Ga0495682_0007017 3300049460 Bacteria 4514
588 Ga0495682_0009237 3300049460 Bacteria 3856
589 Ga0501031_0030712 3300049568 Bacteria 3505
590 Ga0501031_0102052 3300049568 Bacteria 1872
591 Ga0501032_0023180 3300049569 Bacteria 4295
592 Ga0501032_0059078 3300049569 Bacteria 2574
593 Ga0501033_0013311 3300049570 Bacteria 6268
594 Ga0501033_0051516 3300049570 Bacteria 3051
595 Ga0501033_0067769 3300049570 Bacteria 2625
596 Ga0501033_0148602 3300049570 Bacteria 1691
597 Ga0501034_0000192 3300049571 Bacteria 115486
598 Ga0501034_0133380 3300049571 Bacteria 2466
599 Ga0501034_0179948 3300049571 Bacteria 2079
600 Ga0501036_0014906 3300049572 Bacteria 6485
601 Ga0501036_0050469 3300049572 Bacteria 3523
602 Ga0501036_0311277 3300049572 Bacteria 1316
603 Ga0501037_0033294 3300049573 Bacteria 3807
604 Ga0501037_0059645 3300049573 Bacteria 2783
605 Ga0501037_0212898 3300049573 Bacteria 1362
606 Ga0501038_0100136 3300049574 Bacteria 2415
607 Ga0501038_0156167 3300049574 Bacteria 1857
608 Ga0501043_0021893 3300049579 Bacteria 5013
609 Ga0501043_0028026 3300049579 Bacteria 4420
610 Ga0501043_0076697 3300049579 Bacteria 2626
611 Ga0501043_0090005 3300049579 Bacteria 2412
612 Ga0501043_0102993 3300049579 Bacteria 2243
613 Ga0501046_0017220 3300049580 Bacteria 6038
614 Ga0501046_0022689 3300049580 Bacteria 5169
615 Ga0501046_0117653 3300049580 Bacteria 2024
616 Ga0501046_0207844 3300049580 Bacteria 1454
617 Ga0501046_0286264 3300049580 Bacteria 1206
618 Ga0501047_0001922 3300049581 Bacteria 19965
619 Ga0501047_0006510 3300049581 Bacteria 10994
620 Ga0501047_0022027 3300049581 Bacteria 6120
621 Ga0501047_0024890 3300049581 Bacteria 5748
622 Ga0501047_0033102 3300049581 Bacteria 4990
623 Ga0501047_0166643 3300049581 Bacteria 2073
624 Ga0501047_0408958 3300049581 Bacteria 1189
625 Ga0501048_0019797 3300049582 Bacteria 4935
626 Ga0501048_0149062 3300049582 Bacteria 1654
627 Ga0501069_0009946 3300049585 Bacteria 5029
628 Ga0501069_0016129 3300049585 Bacteria 4008
629 Ga0501070_0000146 3300049586 Bacteria 65391
630 Ga0501070_0002845 3300049586 Bacteria 15102
631 Ga0501070_0014993 3300049586 Bacteria 6521
632 Ga0501070_0015050 3300049586 Bacteria 6510
633 Ga0501070_0021836 3300049586 Bacteria 5363
634 Ga0501070_0032970 3300049586 Bacteria 4332
635 Ga0501070_0162074 3300049586 Bacteria 1843
636 Ga0501070_0232154 3300049586 Bacteria 1511
637 Ga0501071_0009504 3300049587 Bacteria 6480
638 Ga0501073_0003754 3300049589 Bacteria 11416
639 Ga0501073_0017456 3300049589 Bacteria 5198
640 Ga0501074_0000885 3300049590 Bacteria 19134
641 Ga0501074_0003630 3300049590 Bacteria 10956
642 Ga0501074_0025187 3300049590 Bacteria 4322
643 Ga0501074_0038209 3300049590 Bacteria 3479
644 Ga0501076_0389984 3300049592 Bacteria 1145
645 Ga0501077_0081389 3300049593 Bacteria 2051
646 Ga0501079_0106154 3300049741 Bacteria 2179
647 Ga0501079_0202514 3300049741 Bacteria 1550
648 Ga0501080_0003851 3300049742 Bacteria 13256
649 Ga0501080_0008369 3300049742 Bacteria 9368
650 Ga0501080_0027011 3300049742 Bacteria 5337
651 Ga0501080_0067297 3300049742 Bacteria 3331
652 Ga0501080_0170188 3300049742 Bacteria 2009
653 Ga0501083_0116240 3300049744 Bacteria 1756
654 Ga0501035_0003194 3300049822 Bacteria 15714
655 Ga0501035_0006993 3300049822 Bacteria 10538
656 Ga0501035_0007555 3300049822 Bacteria 10156
657 Ga0501035_0011460 3300049822 Bacteria 8221
658 Ga0501035_0020740 3300049822 Bacteria 6039
659 Ga0501035_0022696 3300049822 Bacteria 5764
660 Ga0501035_0039145 3300049822 Bacteria 4291
661 Ga0501035_0177315 3300049822 Bacteria 1838
662 Ga0501035_0238564 3300049822 Bacteria 1547
663 Ga0501035_0427597 3300049822 Bacteria 1099
664 Ga0501044_0027845 3300049823 Bacteria 5966
665 Ga0501044_0053889 3300049823 Bacteria 4136
666 Ga0501044_0076810 3300049823 Bacteria 3388
667 Ga0501044_0136080 3300049823 Bacteria 2448
668 Ga0501044_0165656 3300049823 Bacteria 2184
669 Ga0501044_0266144 3300049823 Bacteria 1651
670 Ga0500643_000101 3300053087 Bacteria 88318
671 Ga0500646_0003484 3300053090 Bacteria 4032
672 Ga0500566_0126233 3300053094 Bacteria 1374
673 Ga0500555_001045 3300053103 Bacteria 9341
674 Ga0500614_013421 3300053123 Bacteria 1800
675 Ga0500652_106012 3300053131 Bacteria 1175
676 Ga0500568_0000645 3300053139 Bacteria 25189
677 Ga0500620_029835 3300053155 Bacteria 1716
678 Ga0501084_0279466 3300054114 Bacteria 1410
679 Ga0501082_0000402 3300060353 Bacteria 38316
680 Ga0501082_0019471 3300060353 Bacteria 5851
681 Ga0466962_0004934 3300061719 Bacteria 6416
682 Ga0466962_0005447 3300061719 Bacteria 6116
683 2538834375 2537561836 Bacteria 3910579
684 2643828764 2643221562 Bacteria 4048635
685 2687584838 2687453130 Bacteria 4227172
686 2721025481 2718218334 Bacteria 4765486
687 2735834545 2734482264 Unclassified 5014763
688 2739225997 2738543009 Bacteria 4944499
689 2739733249 2739367700 Bacteria 4747630
690 2884338827 2884338543 Bacteria 4610696
691 2884415657 2884411467 Bacteria 5246714
692 2919086482 2919085039 Bacteria 4532964
693 2928966982 2928963466 Bacteria 5165703
694 2939613475 2939611941 Bacteria 3892017
695 Ga0070680_100002197
696 JGI24741J21665_1000076
697 JGI24741J21665_1005437
698 JGI24740J21852_10000279
699 JGI24740J21852_10005082
700 JGI25156J39149_1002783
701 JGI25156J39149_1009367
702 JGI25162J39368_1001445
703 JGI25162J39368_1003044
704 JGI25154J39366_1004509
705 JGI25157J39369_1000344
706 JGI25157J39369_1001046
707 JGI25163J39215_1000588
708 JGI25164J39214_1000117
709 JGI25164J39214_1000714
710 JGI25164J39214_1000865
711 JGI25165J46597_1000235
712 JGI25165J46597_1001443
713 JGI25165J46597_1001780
714 Ga0055533_1001538
715 Ga0055527_1003026
716 Ga0055535_1000941
717 Ga0055535_1001080
718 Ga0055535_1001379
719 Ga0055542_1000245
720 Ga0055542_1001179
721 Ga0055542_1001180
722 Ga0055542_1001349
723 Ga0055529_1000314
724 Ga0055529_1001072
725 Ga0055529_1002135
726 Ga0070658_10002163
727 Ga0070683_100015187
728 Ga0070683_100015955
729 Ga0070683_100293315
730 Ga0070690_100029514
731 Ga0070670_100227448
732 Ga0068869_100124752
733 Ga0070666_10000001
734 Ga0070666_10052751
735 Ga0070680_100000946
736 Ga0070680_100100120
737 Ga0070682_100014480
738 Ga0070682_100014970
739 Ga0070682_100015837
740 Ga0070682_100045315
741 Ga0068868_100016923
742 Ga0068868_100266644
743 Ga0070660_100046496
744 Ga0070660_100049491
745 Ga0070660_100163024
746 Ga0070661_100002526
747 Ga0070661_100003952
748 Ga0070661_100034435
749 Ga0070661_100096555
750 Ga0070692_10000307
751 Ga0070692_10000420
752 Ga0070692_10159273
753 Ga0070668_100064734
754 Ga0070675_100074093
755 Ga0070688_100125161
756 Ga0070659_100013061
757 Ga0070659_100028080
758 Ga0070667_100013367
759 Ga0070667_100139556
760 Ga0070667_100317045
761 Ga0070714_100000136
762 Ga0070711_100024811
763 Ga0070663_100035443
764 Ga0070662_100065358
765 Ga0070662_100175736
766 Ga0070681_10000552
767 Ga0070681_10003671
768 Ga0070681_10004860
769 Ga0070681_10007360
770 Ga0070681_10039513
771 Ga0070681_10045534
772 Ga0070681_10207387
773 Ga0068867_100308495
774 Ga0070685_10002434
775 Ga0070685_10013112
776 Ga0070679_100002097
777 Ga0070679_100003490
778 Ga0070679_100012167
779 Ga0070679_100049404
780 Ga0070679_100160069
781 Ga0070684_100008594
782 Ga0070684_100010992
783 Ga0070684_100388599
784 Ga0068853_100002290
785 Ga0068853_100015163
786 Ga0068853_100044837
787 Ga0068853_100059863
788 Ga0068853_100063960
789 Ga0068853_100073444
790 Ga0068853_100214666
791 Ga0070672_100029858
792 Ga0070686_100035506
793 Ga0070696_100034217
794 Ga0070696_100154920
795 Ga0070693_100006423
796 Ga0070693_100010956
797 Ga0070693_100019703
798 Ga0070693_100101715
799 Ga0070665_100000712
800 Ga0070665_100009799
801 Ga0070665_100026563
802 Ga0068855_100016860
803 Ga0068855_100108668
804 Ga0068855_100123760
805 Ga0068855_100254647
806 Ga0068855_100493937
807 Ga0068855_100505101
808 Ga0070664_100146377
809 Ga0068857_100068091
810 Ga0068854_100000026
811 Ga0068854_100003525
812 Ga0068854_100006081
813 Ga0068856_100003430
814 Ga0068856_100003717
815 Ga0068856_100086051
816 Ga0068856_100154783
817 Ga0068856_100258841
818 Ga0068852_100002438
819 Ga0068852_100027419
820 Ga0068852_100046785
821 Ga0068852_100077654
822 Ga0068852_100081911
823 Ga0068852_100093186
824 Ga0068859_100185524
825 Ga0068859_100194926
826 Ga0068864_100001937
827 Ga0068864_100169015
828 Ga0068864_100441945
829 Ga0068851_10003106
830 Ga0068851_10027637
831 Ga0068851_10050072
832 Ga0068870_10063166
833 Ga0068863_100113210
834 Ga0068863_100179577
835 Ga0068863_100312146
836 Ga0068863_100333736
837 Ga0068858_100003930
838 Ga0068858_100072506
839 Ga0068860_100000822
840 Ga0068860_100012637
841 Ga0097621_100052340
842 Ga0097621_100069711
843 Ga0097621_100122753
844 Ga0068871_100450501
845 Ga0068865_100003462
846 Ga0068865_100025746
847 Ga0068865_100050142
848 Ga0097620_100185528
849 Ga0097620_100194937
850 Ga0105240_10003317
851 Ga0105240_10035352
852 Ga0105240_10076161
853 Ga0105240_10115212
854 Ga0105240_10173120
855 Ga0105240_10289346
856 Ga0105245_10479507
857 Ga0105247_10000804
858 Ga0105241_10036533
859 Ga0105241_10212677
860 Ga0105241_10535294
861 Ga0105242_10153044
862 Ga0105248_10190603
863 Ga0105237_10000108
864 Ga0105237_10022010
865 Ga0105237_10060807
866 Ga0105237_10168033
867 Ga0105237_10224269
868 Ga0105237_10663088
869 Ga0105238_10000729
870 Ga0105238_10001656
871 Ga0105238_10023815
872 Ga0105238_10029898
873 Ga0105238_10033003
874 Ga0105238_10042081
875 Ga0105238_10059367
876 Ga0105238_10063300
877 Ga0105238_10314826
878 Ga0105238_10492747
879 Ga0105249_10011804
880 Ga0105239_10000830
881 Ga0105239_10011256
882 Ga0105239_10059531
883 Ga0105239_10082349
884 Ga0105239_10212423
885 Ga0105239_10416576
886 Ga0105246_10024732
887 Ga0157373_10002433
888 Ga0157373_10005601
889 Ga0157373_10020677
890 Ga0157373_10040386
891 Ga0157371_10005965
892 Ga0157371_10008699
893 Ga0157371_10033226
894 Ga0157371_10161455
895 Ga0157370_10001106
896 Ga0157370_10007218
897 Ga0157370_10008714
898 Ga0157370_10010315
899 Ga0157370_10115169
900 Ga0157370_10167396
901 Ga0157369_10001250
902 Ga0157369_10006062
903 Ga0157369_10022892
904 Ga0157369_10130393
905 Ga0157374_10077155
906 Ga0157378_10069854
907 Ga0157378_10268527
908 Ga0163162_10000310
909 Ga0163162_10000642
910 Ga0163162_10087782
911 Ga0163162_10224333
912 Ga0157372_10007610
913 Ga0157372_10009427
914 Ga0157372_10011313
915 Ga0157372_10021398
916 Ga0157372_10029270
917 Ga0157372_10059694
918 Ga0157372_10094119
919 Ga0157372_10813170
920 Ga0157375_10031352
921 Ga0157375_10226444
922 Ga0163163_10001487
923 Ga0163163_10056882
924 Ga0157379_10013005
925 Ga0157379_10305607
926 Ga0157376_10014582
927 Ga0157376_10037971
928 Ga0157376_10045836
929 Ga0157376_10074292
930 Ga0182006_1000041
931 Ga0182006_1000133
932 Ga0182007_10003846
933 Ga0182005_1000257
934 Ga0182005_1002454
935 Ga0183368_1002
936 Ga0163161_10012913
937 Ga0197907_10696324
938 Ga0206356_10033220
939 Ga0206356_10907506
940 Ga0206356_11546151
941 Ga0206354_10818447
942 Ga0206354_10932484
943 Ga0206354_11021742
944 Ga0206353_10050604
945 Ga0206353_10485823
946 Ga0206353_10562421
947 Ga0206353_10579021
948 Ga0209760_100701
949 Ga0209784_100053
950 Ga0209566_100922
951 Ga0209674_100014
952 Ga0209672_100089
953 Ga0209672_111421
954 Ga0207427_100051
955 Ga0207427_100061
956 Ga0207427_100129
957 Ga0209437_100037
958 Ga0209437_100118
959 Ga0209437_100152
960 Ga0209437_100406
961 Ga0209258_100090
962 Ga0209258_100101
963 Ga0209258_100138
964 Ga0209258_100479
965 Ga0209258_101737
966 Ga0209646_1001427
967 Ga0209646_1002026
968 Ga0209646_1002739
969 Ga0209026_1000104
970 Ga0209026_1000294
971 Ga0209026_1000553
972 Ga0209148_1000001
973 Ga0209148_1000002
974 Ga0209148_1000065
975 Ga0209148_1000079
976 Ga0209759_1000165
977 Ga0209759_1001467
978 Ga0209759_1002925
979 Ga0209759_1009463
980 Ga0209233_1000002
981 Ga0209233_1000046
982 Ga0209233_1000099
983 Ga0209233_1006812
984 Ga0209233_1008159
985 Ga0209455_1000016
986 Ga0209455_1000079
987 Ga0209455_1000189
988 Ga0209455_1003693
989 Ga0209051_1004768
990 Ga0207656_10002191
991 Ga0207656_10062171
992 Ga0207710_10014465
993 Ga0207680_10000139
994 Ga0207680_10074224
995 Ga0207680_10187221
996 Ga0207647_10000002
997 Ga0207647_10000175
998 Ga0207647_10000224
999 Ga0207647_10000525
1000 Ga0207647_10002255
1001 Ga0207647_10038965
1002 Ga0207643_10012719
1003 Ga0207705_10000198
1004 Ga0207705_10001050
1005 Ga0207705_10001085
1006 Ga0207705_10001679
1007 Ga0207705_10001682
1008 Ga0207705_10005637
1009 Ga0207705_10140855
1010 Ga0207654_10003591
1011 Ga0207707_10000020
1012 Ga0207707_10000131
1013 Ga0207707_10000136
1014 Ga0207707_10000942
1015 Ga0207707_10001255
1016 Ga0207707_10001368
1017 Ga0207707_10002269
1018 Ga0207707_10003877
1019 Ga0207707_10006101
1020 Ga0207707_10032416
1021 Ga0207707_10183288
1022 Ga0207695_10000101
1023 Ga0207695_10000418
1024 Ga0207695_10000751
1025 Ga0207695_10003587
1026 Ga0207695_10003838
1027 Ga0207695_10004386
1028 Ga0207695_10019450
1029 Ga0207695_10032954
1030 Ga0207695_10057689
1031 Ga0207695_10059440
1032 Ga0207671_10001039
1033 Ga0207671_10022465
1034 Ga0207671_10063712
1035 Ga0207660_10000594
1036 Ga0207660_10001035
1037 Ga0207660_10001057
1038 Ga0207660_10001511
1039 Ga0207660_10052034
1040 Ga0207660_10141499
1041 Ga0207657_10001821
1042 Ga0207657_10004696
1043 Ga0207657_10006034
1044 Ga0207657_10011359
1045 Ga0207657_10035064
1046 Ga0207657_10098901
1047 Ga0207657_10100370
1048 Ga0207657_10196769
1049 Ga0207649_10010581
1050 Ga0207649_10015754
1051 Ga0207649_10020685
1052 Ga0207649_10023168
1053 Ga0207649_10032787
1054 Ga0207649_10218335
1055 Ga0207652_10000037
1056 Ga0207652_10000226
1057 Ga0207652_10000902
1058 Ga0207652_10001301
1059 Ga0207652_10002104
1060 Ga0207652_10007880
1061 Ga0207694_10000336
1062 Ga0207694_10002801
1063 Ga0207694_10003401
1064 Ga0207694_10003716
1065 Ga0207694_10005085
1066 Ga0207694_10043610
1067 Ga0207694_10090234
1068 Ga0207659_10090706
1069 Ga0207664_10000150
1070 Ga0207690_10001578
1071 Ga0207690_10005495
1072 Ga0207690_10008354
1073 Ga0207690_10022761
1074 Ga0207690_10023298
1075 Ga0207690_10025875
1076 Ga0207690_10125735
1077 Ga0207690_10488052
1078 Ga0207706_10010415
1079 Ga0207706_10028042
1080 Ga0207706_10269459
1081 Ga0207670_10030810
1082 Ga0207704_10228326
1083 Ga0207691_10009722
1084 Ga0207691_10036351
1085 Ga0207689_10016937
1086 Ga0207661_10005158
1087 Ga0207661_10005219
1088 Ga0207661_10016793
1089 Ga0207679_10081290
1090 Ga0207667_10000077
1091 Ga0207667_10000739
1092 Ga0207667_10004983
1093 Ga0207667_10006687
1094 Ga0207667_10010885
1095 Ga0207667_10013352
1096 Ga0207667_10031674
1097 Ga0207667_10048246
1098 Ga0207667_10143865
1099 Ga0207667_10437060
1100 Ga0207712_10000105
1101 Ga0207640_10000032
1102 Ga0207640_10000479
1103 Ga0207640_10001610
1104 Ga0207640_10001639
1105 Ga0207640_10002761
1106 Ga0207640_10055275
1107 Ga0207640_10297027
1108 Ga0207658_10025041
1109 Ga0207703_10004097
1110 Ga0207703_10026189
1111 Ga0207639_10001251
1112 Ga0207639_10004488
1113 Ga0207639_10004560
1114 Ga0207639_10005917
1115 Ga0207639_10009206
1116 Ga0207639_10036014
1117 Ga0207639_10041665
1118 Ga0207639_10086821
1119 Ga0207639_10137212
1120 Ga0207678_10001007
1121 Ga0207678_10001852
1122 Ga0207678_10003314
1123 Ga0207678_10005388
1124 Ga0207678_10008801
1125 Ga0207678_10068948
1126 Ga0207678_10078439
1127 Ga0207702_10001658
1128 Ga0207702_10007180
1129 Ga0207702_10077386
1130 Ga0207702_10544218
1131 Ga0207641_10012492
1132 Ga0207641_10020195
1133 Ga0207641_10070822
1134 Ga0207641_10076479
1135 Ga0207648_10022355
1136 Ga0207648_10287639
1137 Ga0207676_10291396
1138 Ga0207674_10004053
1139 Ga0207674_10006924
1140 Ga0207674_10014510
1141 Ga0207674_10040168
1142 Ga0207674_10076033
1143 Ga0207674_10165082
1144 Ga0207683_10009137
1145 Ga0207698_10001009
1146 Ga0207698_10004040
1147 Ga0207698_10008897
1148 Ga0207698_10011336
1149 Ga0207698_10017935
1150 Ga0268266_10000008
1151 Ga0268266_10000011
1152 Ga0268266_10082893
1153 Ga0307508_10027843
1154 Ga0316576_10035079
1155 Ga0316578_10166865
1156 Ga0307516_10052276
1157 Ga0307405_10139831
1158 Ga0307412_10003896
1159 Ga0316593_10103114
1160 Ga0307510_10004110
1161 Ga0373944_0013530
1162 Ga0373943_0203309
1163 Ga0316574_0050891
1164 Ga0316574_0116889
1165 Ga0373924_0134581
1166 Ga0373933_0010679
1167 Ga0373937_0016801
1168 Ga0316584_0047429
1169 Ga0395899_0023623
1170 Ga0395899_0036443
1171 Ga0395899_0053699
1172 Ga0395900_0003805
1173 Ga0395900_0004421
1174 Ga0395900_0124201
1175 Ga0395900_0140270
1176 Ga0395900_0504475
1177 Ga0395898_0000013
1178 Ga0395898_0006262
1179 Ga0395901_0022120
1180 Ga0395901_0050913
1181 Ga0395901_0098919
1182 Ga0395901_0160042
1183 Ga0395901_0209158
1184 Ga0400483_022784
1185 Ga0400483_062577
1186 Ga0400483_150507
1187 Ga0400483_276618
1188 Ga0400489_37299
1189 Ga0439436_0000004
1190 Ga0439465_0001501
1191 Ga0439432_020495
1192 Ga0466969_0037206
1193 Ga0466966_0011070
1194 Ga0466966_0017959
1195 Ga0466961_0004762
1196 Ga0466964_0005140
1197 Ga0466971_0001794
1198 Ga0466968_0000061
1199 Ga0466970_0000496
1200 Ga0466970_0003435
1201 Ga0466960_0045412
1202 Ga0466959_0021971
1203 Ga0466959_0059609
1204 Ga0466958_0012695
1205 Ga0495617_000085
1206 Ga0495617_001170
1207 Ga0495629_0038732
1208 Ga0495638_0000236
1209 Ga0495638_0000754
1210 Ga0495638_0001087
1211 Ga0495650_0000191
1212 Ga0495650_0012428
1213 Ga0495584_0000457
1214 Ga0495585_0003589
1215 Ga0495607_0000131
1216 Ga0495583_0012629
1217 Ga0495606_0000016
1218 Ga0495606_0001253
1219 Ga0495606_0001443
1220 Ga0495610_0003274
1221 Ga0495616_0000401
1222 Ga0495616_0002110
1223 Ga0495620_0000365
1224 Ga0495632_0000531
1225 Ga0495632_0004712
1226 Ga0495632_0018148
1227 Ga0495632_0108904
1228 Ga0495637_0005557
1229 Ga0495609_0009588
1230 Ga0495645_0142533
1231 Ga0495668_0001761
1232 Ga0495611_0000002
1233 Ga0495625_0000002
1234 Ga0495625_0044528
1235 Ga0495658_0006050
1236 Ga0495670_0000227
1237 Ga0495670_0000599
1238 Ga0495670_0018576
1239 Ga0495671_0001204
1240 Ga0495649_0000450
1241 Ga0495649_0002369
1242 Ga0495589_0000190
1243 Ga0495660_0000437
1244 Ga0495660_0000447
1245 Ga0495683_0001059
1246 Ga0495679_000003
1247 Ga0495673_0000004
1248 Ga0495673_0002144
1249 Ga0495686_0000426
1250 Ga0495686_0001228
1251 Ga0496102_0068661
1252 Ga0496104_0022187
1253 Ga0496105_0002152
1254 Ga0496106_0000168
1255 Ga0496106_0364809
1256 Ga0496113_0393183
1257 Ga0496115_0000095
1258 Ga0496115_0000729
1259 Ga0496115_0024156
1260 Ga0496115_0174095
1261 Ga0496118_0003990
1262 Ga0496119_0000966
1263 Ga0496119_0039081
1264 Ga0496120_0000409
1265 Ga0496120_0001143
1266 Ga0496121_0006433
1267 Ga0496121_0008592
1268 Ga0496121_0054584
1269 Ga0496121_0129877
1270 Ga0496123_0019361
1271 Ga0496125_0023406
1272 Ga0496125_0033120
1273 Ga0496126_0022583
1274 Ga0496126_0088204
1275 Ga0496126_0088245
1276 Ga0496126_0111159
1277 Ga0496126_0121945
1278 Ga0496126_0251981
1279 Ga0495678_000019
1280 Ga0495678_041224
1281 Ga0495682_0007017
1282 Ga0495682_0009237
1283 Ga0501031_0030712
1284 Ga0501031_0102052
1285 Ga0501032_0023180
1286 Ga0501032_0059078
1287 Ga0501033_0013311
1288 Ga0501033_0051516
1289 Ga0501033_0067769
1290 Ga0501033_0148602
1291 Ga0501034_0000192
1292 Ga0501034_0133380
1293 Ga0501034_0179948
1294 Ga0501036_0014906
1295 Ga0501036_0050469
1296 Ga0501036_0311277
1297 Ga0501037_0033294
1298 Ga0501037_0059645
1299 Ga0501037_0212898
1300 Ga0501038_0100136
1301 Ga0501038_0156167
1302 Ga0501043_0021893
1303 Ga0501043_0028026
1304 Ga0501043_0076697
1305 Ga0501043_0090005
1306 Ga0501043_0102993
1307 Ga0501046_0017220
1308 Ga0501046_0022689
1309 Ga0501046_0117653
1310 Ga0501046_0207844
1311 Ga0501046_0286264
1312 Ga0501047_0001922
1313 Ga0501047_0006510
1314 Ga0501047_0022027
1315 Ga0501047_0024890
1316 Ga0501047_0033102
1317 Ga0501047_0166643
1318 Ga0501047_0408958
1319 Ga0501048_0019797
1320 Ga0501048_0149062
1321 Ga0501069_0009946
1322 Ga0501069_0016129
1323 Ga0501070_0000146
1324 Ga0501070_0002845
1325 Ga0501070_0014993
1326 Ga0501070_0015050
1327 Ga0501070_0021836
1328 Ga0501070_0032970
1329 Ga0501070_0162074
1330 Ga0501070_0232154
1331 Ga0501071_0009504
1332 Ga0501073_0003754
1333 Ga0501073_0017456
1334 Ga0501074_0000885
1335 Ga0501074_0003630
1336 Ga0501074_0025187
1337 Ga0501074_0038209
1338 Ga0501076_0389984
1339 Ga0501077_0081389
1340 Ga0501079_0106154
1341 Ga0501079_0202514
1342 Ga0501080_0003851
1343 Ga0501080_0008369
1344 Ga0501080_0027011
1345 Ga0501080_0067297
1346 Ga0501080_0170188
1347 Ga0501083_0116240
1348 Ga0501035_0003194
1349 Ga0501035_0006993
1350 Ga0501035_0007555
1351 Ga0501035_0011460
1352 Ga0501035_0020740
1353 Ga0501035_0022696
1354 Ga0501035_0039145
1355 Ga0501035_0177315
1356 Ga0501035_0238564
1357 Ga0501035_0427597
1358 Ga0501044_0027845
1359 Ga0501044_0053889
1360 Ga0501044_0076810
1361 Ga0501044_0136080
1362 Ga0501044_0165656
1363 Ga0501044_0266144
1364 Ga0500643_000101
1365 Ga0500646_0003484
1366 Ga0500566_0126233
1367 Ga0500555_001045
1368 Ga0500614_013421
1369 Ga0500652_106012
1370 Ga0500568_0000645
1371 Ga0500620_029835
1372 Ga0501084_0279466
1373 Ga0501082_0000402
1374 Ga0501082_0019471
1375 Ga0466962_0004934
1376 Ga0466962_0005447
1377 2538834375
1378 2643828764
1379 2687584838
1380 2721025481
1381 2735834545
1382 2739225997
1383 2739733249
1384 2884338827
1385 2884415657
1386 2919086482
1387 2928966982
1388 2939613475

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

208

333

0.97

PF00551

Formyl_trans_N

Formyl transferase

6

184

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9662 4 309
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.9553 4 309
3r8x-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine 0.9549 4 309
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9537 1 309
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9419 2 309
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9637 4 208 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9539 4 208 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9479 4 208 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9372 1 208 3.40.50.170
3tqqA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9361 210 309 3.10.25.10
ID Description Score Start End GO Terms
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9801 4 126 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9786 4 208 GO:0004479
GO:0005829
AF-A0A382L434-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9758 26 204 GO:0004479
GO:0005829
AF-A0A7C5PBG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9739 46 306 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9738 4 208 GO:0004479
GO:0005829

Map