F475703

General Info

Members Datasets Scaffolds Average Seq Length
694 218 1388 244

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100002487|Ga0070680_1000024879
Length 292
Sequence MQQSPADRKPGAWHGGISFHFTQFVAINARFVAAVAGDRDRWLLVIADERTGLHPMINKLQDSRAVLLGAVAIFGIGLTTSGYALGDGFRRSKMAEHRTVTVRGVSERNVTADLATWSVNFSHQGTELAPVQQSVDQQAGAVRAFFLHAGFRPDEVTDSNVALSREQARDRDGNPVGPQKLTVSRSIQLRTTDVMKARAAYARQAELLRDGVELSGTNITYTFTRLNALKPQMIAEATRNARDSAEQFARDSGVDVGRIKTASQGYFSVGARDGETPFQKVRVVTTIDYDLG

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 4.76
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100002487 3300005336 Bacteria 13653
2 JGI24736J21556_1000860 3300001904 Bacteria 5586
3 JGI24736J21556_1011492 3300001904 Bacteria 1441
4 JGI24740J21852_10003212 3300001979 Bacteria 7212
5 JGI24740J21852_10009227 3300001979 Bacteria 3875
6 JGI24739J22299_10002407 3300001989 Bacteria 7217
7 JGI24737J22298_10000206 3300001990 Bacteria 19194
8 JGI24737J22298_10002181 3300001990 Bacteria 6973
9 JGI24737J22298_10005581 3300001990 Bacteria 4334
10 JGI24737J22298_10035006 3300001990 Unclassified 1555
11 JGI24735J21928_10065870 3300002067 Bacteria 1039
12 JGI24738J21930_10003464 3300002075 Bacteria 3974
13 JGI24751J29686_10022676 3300002459 Bacteria 1302
14 Ga0070658_10000374 3300005327 Bacteria 38937
15 Ga0070658_10078686 3300005327 Bacteria 2707
16 Ga0070658_10227861 3300005327 Bacteria 1577
17 Ga0070658_10389950 3300005327 Bacteria 1195
18 Ga0070676_10071131 3300005328 Bacteria 2089
19 Ga0070676_10109020 3300005328 Bacteria 1721
20 Ga0070683_100004192 3300005329 Bacteria 11822
21 Ga0070683_100004286 3300005329 Bacteria 11715
22 Ga0070683_100091962 3300005329 Bacteria 2849
23 Ga0070683_100268231 3300005329 Bacteria 1624
24 Ga0070690_100011455 3300005330 Bacteria 5188
25 Ga0070690_100043855 3300005330 Bacteria 2837
26 Ga0070670_100020797 3300005331 Bacteria 5643
27 Ga0070670_100035076 3300005331 Bacteria 4317
28 Ga0070670_100096550 3300005331 Bacteria 2542
29 Ga0068869_100026860 3300005334 Bacteria 4009
30 Ga0068869_100382019 3300005334 Bacteria 1154
31 Ga0070666_10002899 3300005335 Bacteria 10361
32 Ga0070666_10003596 3300005335 Bacteria 9395
33 Ga0070666_10046219 3300005335 Bacteria 2920
34 Ga0070666_10160634 3300005335 Bacteria 1570
35 Ga0068868_100011585 3300005338 Bacteria 6423
36 Ga0068868_100058677 3300005338 Bacteria 3042
37 Ga0070660_100000209 3300005339 Bacteria 39223
38 Ga0070660_100008889 3300005339 Bacteria 7044
39 Ga0070660_100010377 3300005339 Bacteria 6584
40 Ga0070660_100038948 3300005339 Bacteria 3611
41 Ga0070660_100048047 3300005339 Bacteria 3276
42 Ga0070660_100068086 3300005339 Bacteria 2774
43 Ga0070660_100229713 3300005339 Bacteria 1510
44 Ga0070689_100096995 3300005340 Bacteria 2331
45 Ga0070691_10017346 3300005341 Bacteria 3312
46 Ga0070661_100000674 3300005344 Bacteria 25042
47 Ga0070661_100020645 3300005344 Bacteria 4698
48 Ga0070661_100023394 3300005344 Bacteria 4427
49 Ga0070661_100117586 3300005344 Bacteria 1989
50 Ga0070661_100289088 3300005344 Bacteria 1273
51 Ga0070661_100348981 3300005344 Bacteria 1160
52 Ga0070661_100364924 3300005344 Bacteria 1136
53 Ga0070692_10165400 3300005345 Bacteria 1271
54 Ga0070668_100290580 3300005347 Bacteria 1368
55 Ga0070668_100301499 3300005347 Bacteria 1344
56 Ga0070669_100073080 3300005353 Bacteria 2540
57 Ga0070669_100149851 3300005353 Bacteria 1805
58 Ga0070669_100242683 3300005353 Bacteria 1432
59 Ga0070669_100412754 3300005353 Unclassified 1107
60 Ga0070675_100092185 3300005354 Bacteria 2540
61 Ga0070675_100167195 3300005354 Bacteria 1895
62 Ga0070671_100000051 3300005355 Bacteria 79207
63 Ga0070671_100015829 3300005355 Bacteria 6092
64 Ga0070671_100019572 3300005355 Bacteria 5511
65 Ga0070671_100024555 3300005355 Bacteria 4936
66 Ga0070671_100086223 3300005355 Bacteria 2626
67 Ga0070671_100386390 3300005355 Bacteria 1196
68 Ga0070674_100041864 3300005356 Bacteria 3108
69 Ga0070673_100020869 3300005364 Bacteria 4734
70 Ga0070673_100084178 3300005364 Bacteria 2586
71 Ga0070673_100223968 3300005364 Bacteria 1629
72 Ga0070673_100338461 3300005364 Bacteria 1333
73 Ga0070673_100436242 3300005364 Bacteria 1176
74 Ga0070659_100002073 3300005366 Bacteria 14279
75 Ga0070659_100006211 3300005366 Bacteria 8630
76 Ga0070659_100010232 3300005366 Bacteria 6897
77 Ga0070659_100027912 3300005366 Bacteria 4353
78 Ga0070659_100054020 3300005366 Bacteria 3163
79 Ga0070659_100075531 3300005366 Bacteria 2686
80 Ga0070659_100090021 3300005366 Bacteria 2459
81 Ga0070659_100121139 3300005366 Bacteria 2119
82 Ga0070659_100152593 3300005366 Bacteria 1885
83 Ga0070667_100003327 3300005367 Bacteria 13729
84 Ga0070667_100005560 3300005367 Bacteria 10519
85 Ga0070667_100016148 3300005367 Bacteria 6176
86 Ga0070667_100017654 3300005367 Bacteria 5912
87 Ga0070667_100033003 3300005367 Bacteria 4322
88 Ga0070667_100151191 3300005367 Bacteria 2039
89 Ga0070667_100283007 3300005367 Bacteria 1489
90 Ga0070714_100072199 3300005435 Bacteria 2987
91 Ga0070714_100433266 3300005435 Bacteria 1247
92 Ga0070694_100097451 3300005444 Bacteria 2074
93 Ga0070663_100002265 3300005455 Bacteria 10780
94 Ga0070663_100005111 3300005455 Bacteria 7764
95 Ga0070663_100035009 3300005455 Bacteria 3481
96 Ga0070663_100037461 3300005455 Bacteria 3376
97 Ga0070663_100039702 3300005455 Bacteria 3291
98 Ga0070663_100164834 3300005455 Bacteria 1709
99 Ga0070678_100001634 3300005456 Bacteria 11998
100 Ga0070678_100065757 3300005456 Bacteria 2693
101 Ga0070678_100217152 3300005456 Bacteria 1587
102 Ga0070662_100000012 3300005457 Bacteria 129380
103 Ga0070662_100001989 3300005457 Bacteria 12527
104 Ga0070662_100007131 3300005457 Bacteria 7235
105 Ga0070662_100017289 3300005457 Bacteria 4859
106 Ga0070662_100030255 3300005457 Bacteria 3786
107 Ga0070662_100058990 3300005457 Bacteria 2794
108 Ga0070662_100328148 3300005457 Bacteria 1249
109 Ga0070681_10075543 3300005458 Bacteria 3329
110 Ga0070681_10100600 3300005458 Bacteria 2837
111 Ga0068867_100090339 3300005459 Bacteria 2323
112 Ga0070679_100012507 3300005530 Bacteria 8114
113 Ga0070684_100026091 3300005535 Bacteria 4918
114 Ga0070684_100050441 3300005535 Bacteria 3615
115 Ga0068853_100000032 3300005539 Bacteria 114306
116 Ga0068853_100032630 3300005539 Bacteria 4413
117 Ga0068853_100034987 3300005539 Bacteria 4265
118 Ga0068853_100063845 3300005539 Bacteria 3191
119 Ga0068853_100470551 3300005539 Bacteria 1184
120 Ga0070672_100065703 3300005543 Bacteria 2870
121 Ga0070672_100068098 3300005543 Bacteria 2823
122 Ga0070672_100093410 3300005543 Bacteria 2430
123 Ga0070686_100033806 3300005544 Bacteria 3145
124 Ga0070695_100087712 3300005545 Bacteria 2070
125 Ga0070696_100041707 3300005546 Bacteria 3171
126 Ga0070693_100000342 3300005547 Bacteria 21210
127 Ga0070665_100004860 3300005548 Bacteria 13963
128 Ga0070665_100080183 3300005548 Bacteria 3269
129 Ga0070665_100250497 3300005548 Bacteria 1772
130 Ga0068855_100000591 3300005563 Bacteria 44412
131 Ga0068855_100363437 3300005563 Bacteria 1592
132 Ga0070664_100002849 3300005564 Bacteria 13993
133 Ga0070664_100003755 3300005564 Bacteria 12249
134 Ga0070664_100033073 3300005564 Bacteria 4328
135 Ga0070664_100038934 3300005564 Bacteria 4003
136 Ga0070664_100059468 3300005564 Bacteria 3251
137 Ga0070664_100205037 3300005564 Bacteria 1761
138 Ga0068857_100030612 3300005577 Bacteria 4753
139 Ga0068857_100098701 3300005577 Bacteria 2619
140 Ga0068857_100098770 3300005577 Bacteria 2618
141 Ga0068857_100203186 3300005577 Bacteria 1806
142 Ga0068854_100003822 3300005578 Bacteria 9425
143 Ga0068854_100006478 3300005578 Bacteria 7451
144 Ga0068854_100030779 3300005578 Bacteria 3725
145 Ga0068854_100041663 3300005578 Bacteria 3245
146 Ga0068854_100111318 3300005578 Bacteria 2065
147 Ga0068854_100329468 3300005578 Unclassified 1244
148 Ga0068854_100362387 3300005578 Bacteria 1190
149 Ga0068854_100435437 3300005578 Unclassified 1092
150 Ga0068856_100000190 3300005614 Bacteria 64644
151 Ga0068856_100008997 3300005614 Bacteria 9716
152 Ga0068856_100020187 3300005614 Bacteria 6472
153 Ga0068856_100168386 3300005614 Bacteria 2202
154 Ga0068856_100288991 3300005614 Bacteria 1656
155 Ga0068856_100362644 3300005614 Bacteria 1468
156 Ga0068856_100472056 3300005614 Bacteria 1275
157 Ga0068856_100503116 3300005614 Bacteria 1233
158 Ga0068852_100000395 3300005616 Bacteria 29245
159 Ga0068852_100002073 3300005616 Bacteria 13696
160 Ga0068852_100011614 3300005616 Bacteria 6643
161 Ga0068852_100021744 3300005616 Bacteria 5131
162 Ga0068852_100033583 3300005616 Bacteria 4262
163 Ga0068852_100038929 3300005616 Bacteria 4000
164 Ga0068852_100051506 3300005616 Bacteria 3533
165 Ga0068852_100111621 3300005616 Bacteria 2486
166 Ga0068852_100144821 3300005616 Bacteria 2203
167 Ga0068852_100367013 3300005616 Bacteria 1409
168 Ga0068852_100688457 3300005616 Bacteria 1032
169 Ga0068852_100987114 3300005616 Bacteria 861
170 Ga0068859_100000685 3300005617 Bacteria 34047
171 Ga0068859_100040131 3300005617 Bacteria 4698
172 Ga0068859_100094812 3300005617 Bacteria 3037
173 Ga0068859_100134690 3300005617 Bacteria 2542
174 Ga0068864_100000847 3300005618 Bacteria 25807
175 Ga0068864_100014893 3300005618 Bacteria 6460
176 Ga0068864_100025847 3300005618 Bacteria 4947
177 Ga0068864_100027356 3300005618 Bacteria 4816
178 Ga0068864_100028530 3300005618 Bacteria 4719
179 Ga0068864_100035162 3300005618 Bacteria 4265
180 Ga0068864_100200485 3300005618 Bacteria 1833
181 Ga0068851_10156790 3300005834 Bacteria 1248
182 Ga0068851_10213467 3300005834 Bacteria 1082
183 Ga0068863_100005917 3300005841 Bacteria 11996
184 Ga0068863_100026328 3300005841 Bacteria 5549
185 Ga0068863_100095885 3300005841 Bacteria 2816
186 Ga0068863_100341354 3300005841 Bacteria 1457
187 Ga0068863_100345183 3300005841 Bacteria 1449
188 Ga0068863_100562437 3300005841 Bacteria 1127
189 Ga0068858_100002934 3300005842 Bacteria 17162
190 Ga0068858_100006170 3300005842 Bacteria 11688
191 Ga0068858_100030883 3300005842 Bacteria 4976
192 Ga0068860_100001106 3300005843 Bacteria 29651
193 Ga0068860_100006941 3300005843 Bacteria 11350
194 Ga0068860_100048248 3300005843 Bacteria 4058
195 Ga0068860_100080459 3300005843 Bacteria 3098
196 Ga0068860_100102330 3300005843 Bacteria 2733
197 Ga0068862_100007304 3300005844 Bacteria 9173
198 Ga0068862_100218759 3300005844 Bacteria 1723
199 Ga0068862_100288246 3300005844 Bacteria 1507
200 Ga0068862_100295291 3300005844 Bacteria 1489
201 Ga0081539_10013686 3300005985 Bacteria 6093
202 Ga0075364_10133843 3300006051 Bacteria 1665
203 Ga0075366_10058074 3300006195 Bacteria 2298
204 Ga0097621_100007674 3300006237 Bacteria 7737
205 Ga0097621_100010890 3300006237 Bacteria 6675
206 Ga0097621_100024788 3300006237 Bacteria 4688
207 Ga0068871_100040659 3300006358 Bacteria 3725
208 Ga0068871_100081349 3300006358 Bacteria 2683
209 Ga0075428_100052052 3300006844 Bacteria 4489
210 Ga0075433_10022199 3300006852 Bacteria 5327
211 Ga0075434_100514904 3300006871 Bacteria 1217
212 Ga0068865_100013945 3300006881 Bacteria 5097
213 Ga0068865_100122730 3300006881 Bacteria 1934
214 Ga0097620_100000685 3300006931 Bacteria 34047
215 Ga0097620_100040129 3300006931 Bacteria 4698
216 Ga0097620_100094807 3300006931 Bacteria 3037
217 Ga0097620_100134695 3300006931 Bacteria 2542
218 Ga0105250_10011311 3300009092 Bacteria 3703
219 Ga0105240_10131645 3300009093 Bacteria 2999
220 Ga0105240_10195563 3300009093 Bacteria 2375
221 Ga0105240_10199702 3300009093 Bacteria 2344
222 Ga0105240_10623354 3300009093 Bacteria 1185
223 Ga0105240_10850364 3300009093 Bacteria 985
224 Ga0111539_10010849 3300009094 Bacteria 11468
225 Ga0111539_10189288 3300009094 Bacteria 2402
226 Ga0105245_10025012 3300009098 Bacteria 5248
227 Ga0105247_10111114 3300009101 Bacteria 1764
228 Ga0105247_10250903 3300009101 Bacteria 1210
229 Ga0105241_10181613 3300009174 Bacteria 1746
230 Ga0105241_10191322 3300009174 Bacteria 1703
231 Ga0105248_10000083 3300009177 Bacteria 110619
232 Ga0105248_10001290 3300009177 Bacteria 27898
233 Ga0105248_10010504 3300009177 Bacteria 10196
234 Ga0105248_10011986 3300009177 Bacteria 9560
235 Ga0105248_10049177 3300009177 Bacteria 4729
236 Ga0105248_10161135 3300009177 Bacteria 2530
237 Ga0105248_10207723 3300009177 Bacteria 2206
238 Ga0105248_10242124 3300009177 Bacteria 2030
239 Ga0105248_10285227 3300009177 Bacteria 1859
240 Ga0105248_10309349 3300009177 Bacteria 1779
241 Ga0105237_10027386 3300009545 Bacteria 5819
242 Ga0105238_10005371 3300009551 Bacteria 12662
243 Ga0105238_10060953 3300009551 Bacteria 3776
244 Ga0105238_10243798 3300009551 Bacteria 1775
245 Ga0105238_10249062 3300009551 Bacteria 1754
246 Ga0105238_10546767 3300009551 Bacteria 1162
247 Ga0105249_10004218 3300009553 Bacteria 12422
248 Ga0105249_10037568 3300009553 Bacteria 4395
249 Ga0105249_10166104 3300009553 Bacteria 2137
250 Ga0105246_10001236 3300011119 Bacteria 14986
251 Ga0105246_10036939 3300011119 Bacteria 3275
252 Ga0105246_10076875 3300011119 Bacteria 2366
253 Ga0157373_10024739 3300013100 Bacteria 4348
254 Ga0157373_10027921 3300013100 Bacteria 4072
255 Ga0157373_10051701 3300013100 Bacteria 2925
256 Ga0157373_10092002 3300013100 Bacteria 2136
257 Ga0157373_10249882 3300013100 Bacteria 1254
258 Ga0157373_10250776 3300013100 Bacteria 1252
259 Ga0157371_10013378 3300013102 Bacteria 6234
260 Ga0157371_10031719 3300013102 Bacteria 3806
261 Ga0157371_10051752 3300013102 Bacteria 2918
262 Ga0157371_10065439 3300013102 Bacteria 2575
263 Ga0157371_10071293 3300013102 Bacteria 2459
264 Ga0157371_10114036 3300013102 Bacteria 1919
265 Ga0157371_10157227 3300013102 Bacteria 1623
266 Ga0157370_10011909 3300013104 Bacteria 9067
267 Ga0157370_10072675 3300013104 Bacteria 3245
268 Ga0157370_10215047 3300013104 Bacteria 1781
269 Ga0157370_10229904 3300013104 Bacteria 1717
270 Ga0157370_10427516 3300013104 Bacteria 1218
271 Ga0157369_10010429 3300013105 Bacteria 10588
272 Ga0157369_10273282 3300013105 Bacteria 1761
273 Ga0157369_10340916 3300013105 Bacteria 1557
274 Ga0157369_10514565 3300013105 Bacteria 1238
275 Ga0157369_10948914 3300013105 Bacteria 881
276 Ga0157374_10282994 3300013296 Bacteria 1637
277 Ga0163162_10037700 3300013306 Bacteria 4825
278 Ga0163162_10055061 3300013306 Bacteria 4003
279 Ga0163162_10076703 3300013306 Bacteria 3405
280 Ga0163162_10258811 3300013306 Bacteria 1872
281 Ga0163162_10966056 3300013306 Bacteria 962
282 Ga0157372_10006659 3300013307 Bacteria 12294
283 Ga0157372_10112642 3300013307 Bacteria 3117
284 Ga0157372_10113320 3300013307 Bacteria 3108
285 Ga0157372_10224796 3300013307 Bacteria 2176
286 Ga0157372_10425486 3300013307 Bacteria 1547
287 Ga0157375_10011059 3300013308 Bacteria 7958
288 Ga0157375_10572402 3300013308 Bacteria 1290
289 Ga0157375_10675911 3300013308 Bacteria 1187
290 Ga0157375_10779563 3300013308 Bacteria 1106
291 Ga0163163_10000307 3300014325 Bacteria 48168
292 Ga0163163_10000364 3300014325 Bacteria 43563
293 Ga0163163_10048670 3300014325 Bacteria 4169
294 Ga0182008_10040504 3300014497 Bacteria 2326
295 Ga0157377_10010129 3300014745 Bacteria 4651
296 Ga0157377_10025871 3300014745 Bacteria 3134
297 Ga0157379_10005320 3300014968 Bacteria 11057
298 Ga0157379_10029113 3300014968 Bacteria 4912
299 Ga0157376_10050828 3300014969 Bacteria 3441
300 Ga0163161_10070128 3300017792 Bacteria 2563
301 Ga0163161_10091575 3300017792 Bacteria 2250
302 Ga0213873_10000026 3300021358 Bacteria 74525
303 Ga0213876_10000149 3300021384 Bacteria 74548
304 Ga0207656_10014925 3300025321 Bacteria 3002
305 Ga0207656_10068538 3300025321 Bacteria 1572
306 Ga0207696_1009256 3300025711 Bacteria 3683
307 Ga0207682_10052406 3300025893 Bacteria 1691
308 Ga0207642_10189578 3300025899 Bacteria 1127
309 Ga0207688_10017938 3300025901 Bacteria 3851
310 Ga0207688_10051977 3300025901 Bacteria 2295
311 Ga0207688_10234151 3300025901 Bacteria 1109
312 Ga0207680_10001044 3300025903 Bacteria 13083
313 Ga0207680_10022148 3300025903 Bacteria 3451
314 Ga0207680_10049246 3300025903 Bacteria 2507
315 Ga0207647_10003750 3300025904 Bacteria 11358
316 Ga0207647_10005204 3300025904 Bacteria 9570
317 Ga0207647_10005744 3300025904 Bacteria 9057
318 Ga0207647_10008197 3300025904 Bacteria 7506
319 Ga0207647_10009701 3300025904 Bacteria 6830
320 Ga0207647_10011192 3300025904 Bacteria 6304
321 Ga0207645_10087331 3300025907 Bacteria 2004
322 Ga0207643_10279038 3300025908 Bacteria 1036
323 Ga0207705_10000072 3300025909 Bacteria 126043
324 Ga0207705_10028274 3300025909 Bacteria 3997
325 Ga0207705_10086331 3300025909 Bacteria 2293
326 Ga0207705_10150560 3300025909 Bacteria 1743
327 Ga0207705_10194114 3300025909 Bacteria 1536
328 Ga0207705_10211186 3300025909 Unclassified 1472
329 Ga0207705_10213417 3300025909 Bacteria 1464
330 Ga0207705_10466551 3300025909 Bacteria 980
331 Ga0207654_10126056 3300025911 Bacteria 1614
332 Ga0207707_10053862 3300025912 Bacteria 3502
333 Ga0207707_10256549 3300025912 Bacteria 1518
334 Ga0207695_10005583 3300025913 Bacteria 16616
335 Ga0207695_10057521 3300025913 Bacteria 4039
336 Ga0207695_10159247 3300025913 Bacteria 2190
337 Ga0207671_10062809 3300025914 Bacteria 2759
338 Ga0207671_10476750 3300025914 Unclassified 994
339 Ga0207660_10005019 3300025917 Bacteria 8627
340 Ga0207657_10000496 3300025919 Bacteria 41552
341 Ga0207657_10004492 3300025919 Bacteria 14748
342 Ga0207657_10007401 3300025919 Bacteria 11255
343 Ga0207657_10010662 3300025919 Bacteria 9153
344 Ga0207657_10016875 3300025919 Bacteria 7027
345 Ga0207657_10023986 3300025919 Bacteria 5664
346 Ga0207657_10104098 3300025919 Bacteria 2352
347 Ga0207657_10148386 3300025919 Bacteria 1912
348 Ga0207657_10206631 3300025919 Bacteria 1577
349 Ga0207657_10292917 3300025919 Bacteria 1290
350 Ga0207657_10362631 3300025919 Bacteria 1142
351 Ga0207649_10000158 3300025920 Bacteria 55609
352 Ga0207649_10015462 3300025920 Bacteria 4288
353 Ga0207649_10018836 3300025920 Bacteria 3936
354 Ga0207649_10022700 3300025920 Bacteria 3626
355 Ga0207649_10038266 3300025920 Bacteria 2903
356 Ga0207649_10069176 3300025920 Bacteria 2247
357 Ga0207649_10070606 3300025920 Bacteria 2228
358 Ga0207649_10074251 3300025920 Bacteria 2181
359 Ga0207652_10001167 3300025921 Bacteria 23590
360 Ga0207652_10392457 3300025921 Bacteria 1252
361 Ga0207681_10060659 3300025923 Bacteria 2597
362 Ga0207681_10094042 3300025923 Bacteria 2147
363 Ga0207681_10153041 3300025923 Bacteria 1730
364 Ga0207681_10487160 3300025923 Bacteria 1008
365 Ga0207694_10014607 3300025924 Bacteria 5921
366 Ga0207694_10033272 3300025924 Bacteria 3950
367 Ga0207694_10056766 3300025924 Bacteria 3042
368 Ga0207650_10035924 3300025925 Bacteria 3602
369 Ga0207650_10048060 3300025925 Bacteria 3145
370 Ga0207650_10055340 3300025925 Bacteria 2945
371 Ga0207659_10085399 3300025926 Bacteria 2345
372 Ga0207659_10462465 3300025926 Bacteria 1070
373 Ga0207687_10036409 3300025927 Bacteria 3353
374 Ga0207664_10066793 3300025929 Bacteria 2884
375 Ga0207664_10298966 3300025929 Bacteria 1416
376 Ga0207644_10000358 3300025931 Bacteria 29705
377 Ga0207644_10004758 3300025931 Bacteria 8826
378 Ga0207644_10012673 3300025931 Bacteria 5603
379 Ga0207644_10014155 3300025931 Bacteria 5335
380 Ga0207644_10017452 3300025931 Bacteria 4846
381 Ga0207644_10200857 3300025931 Bacteria 1572
382 Ga0207644_10239710 3300025931 Bacteria 1443
383 Ga0207690_10001410 3300025932 Bacteria 15127
384 Ga0207690_10005347 3300025932 Bacteria 7567
385 Ga0207690_10009277 3300025932 Bacteria 5846
386 Ga0207690_10012196 3300025932 Bacteria 5143
387 Ga0207690_10012238 3300025932 Bacteria 5133
388 Ga0207690_10061001 3300025932 Bacteria 2562
389 Ga0207690_10109229 3300025932 Bacteria 1989
390 Ga0207690_10182730 3300025932 Bacteria 1580
391 Ga0207706_10000041 3300025933 Bacteria 130090
392 Ga0207706_10003120 3300025933 Bacteria 15935
393 Ga0207706_10003298 3300025933 Bacteria 15456
394 Ga0207706_10006675 3300025933 Bacteria 10670
395 Ga0207706_10009215 3300025933 Bacteria 9068
396 Ga0207706_10120168 3300025933 Bacteria 2310
397 Ga0207706_10140011 3300025933 Bacteria 2128
398 Ga0207706_10330774 3300025933 Bacteria 1326
399 Ga0207706_10514097 3300025933 Bacteria 1033
400 Ga0207686_10118151 3300025934 Bacteria 1800
401 Ga0207670_10152691 3300025936 Bacteria 1715
402 Ga0207669_10365623 3300025937 Bacteria 1119
403 Ga0207669_10387807 3300025937 Bacteria 1090
404 Ga0207704_10025449 3300025938 Bacteria 3229
405 Ga0207704_10075647 3300025938 Bacteria 2154
406 Ga0207704_10077073 3300025938 Bacteria 2139
407 Ga0207691_10008814 3300025940 Bacteria 9676
408 Ga0207691_10036319 3300025940 Bacteria 4565
409 Ga0207691_10214401 3300025940 Bacteria 1671
410 Ga0207691_10392387 3300025940 Bacteria 1184
411 Ga0207711_10000831 3300025941 Bacteria 30006
412 Ga0207711_10001208 3300025941 Bacteria 24465
413 Ga0207711_10231617 3300025941 Bacteria 1692
414 Ga0207711_10391174 3300025941 Bacteria 1291
415 Ga0207689_10006035 3300025942 Bacteria 10707
416 Ga0207689_10273219 3300025942 Bacteria 1399
417 Ga0207661_10002967 3300025944 Bacteria 11736
418 Ga0207661_10062691 3300025944 Bacteria 3008
419 Ga0207661_10108965 3300025944 Bacteria 2339
420 Ga0207661_10327354 3300025944 Bacteria 1378
421 Ga0207661_10411280 3300025944 Bacteria 1228
422 Ga0207679_10003505 3300025945 Bacteria 9706
423 Ga0207679_10009869 3300025945 Bacteria 6130
424 Ga0207679_10032405 3300025945 Bacteria 3668
425 Ga0207679_10083585 3300025945 Bacteria 2447
426 Ga0207679_10093476 3300025945 Bacteria 2332
427 Ga0207679_10388146 3300025945 Bacteria 1225
428 Ga0207667_10002008 3300025949 Bacteria 25533
429 Ga0207667_10005995 3300025949 Bacteria 14785
430 Ga0207667_10012442 3300025949 Bacteria 9805
431 Ga0207667_10032089 3300025949 Bacteria 5662
432 Ga0207667_10176662 3300025949 Bacteria 2193
433 Ga0207651_10012725 3300025960 Bacteria 4777
434 Ga0207651_10013225 3300025960 Bacteria 4712
435 Ga0207651_10026456 3300025960 Bacteria 3625
436 Ga0207651_10099280 3300025960 Bacteria 2155
437 Ga0207651_10160391 3300025960 Bacteria 1762
438 Ga0207712_10000819 3300025961 Bacteria 22891
439 Ga0207712_10036062 3300025961 Bacteria 3365
440 Ga0207712_10132626 3300025961 Bacteria 1900
441 Ga0207668_10058871 3300025972 Bacteria 2688
442 Ga0207668_10123654 3300025972 Bacteria 1963
443 Ga0207668_10259742 3300025972 Bacteria 1415
444 Ga0207668_10336102 3300025972 Unclassified 1258
445 Ga0207640_10008226 3300025981 Bacteria 5783
446 Ga0207640_10033277 3300025981 Bacteria 3206
447 Ga0207640_10051605 3300025981 Bacteria 2674
448 Ga0207640_10055178 3300025981 Bacteria 2601
449 Ga0207640_10249382 3300025981 Bacteria 1377
450 Ga0207658_10002673 3300025986 Bacteria 12909
451 Ga0207658_10003158 3300025986 Bacteria 11766
452 Ga0207658_10006868 3300025986 Bacteria 7753
453 Ga0207658_10067674 3300025986 Bacteria 2691
454 Ga0207658_10128706 3300025986 Bacteria 2031
455 Ga0207658_10162842 3300025986 Bacteria 1830
456 Ga0207658_10194400 3300025986 Bacteria 1689
457 Ga0207658_10403866 3300025986 Bacteria 1201
458 Ga0207677_10013551 3300026023 Bacteria 4730
459 Ga0207677_10072400 3300026023 Bacteria 2436
460 Ga0207677_10082245 3300026023 Bacteria 2314
461 Ga0207677_10254093 3300026023 Bacteria 1429
462 Ga0207677_10612451 3300026023 Bacteria 957
463 Ga0207703_10001930 3300026035 Bacteria 18356
464 Ga0207703_10023804 3300026035 Bacteria 4817
465 Ga0207703_10026334 3300026035 Bacteria 4576
466 Ga0207703_10096134 3300026035 Bacteria 2500
467 Ga0207639_10000074 3300026041 Bacteria 91671
468 Ga0207639_10009793 3300026041 Bacteria 6621
469 Ga0207639_10079762 3300026041 Bacteria 2588
470 Ga0207639_10332602 3300026041 Bacteria 1352
471 Ga0207639_10381282 3300026041 Bacteria 1266
472 Ga0207639_10477176 3300026041 Bacteria 1136
473 Ga0207639_10625304 3300026041 Unclassified 995
474 Ga0207639_10655951 3300026041 Unclassified 971
475 Ga0207678_10005554 3300026067 Bacteria 11268
476 Ga0207678_10009642 3300026067 Bacteria 8492
477 Ga0207678_10015630 3300026067 Bacteria 6673
478 Ga0207678_10029713 3300026067 Bacteria 4772
479 Ga0207678_10053563 3300026067 Bacteria 3477
480 Ga0207678_10349832 3300026067 Bacteria 1274
481 Ga0207702_10003674 3300026078 Bacteria 13889
482 Ga0207702_10004666 3300026078 Bacteria 12107
483 Ga0207702_10008508 3300026078 Bacteria 8652
484 Ga0207702_10027944 3300026078 Bacteria 4687
485 Ga0207702_10033340 3300026078 Bacteria 4301
486 Ga0207702_10052679 3300026078 Bacteria 3444
487 Ga0207702_10060585 3300026078 Bacteria 3226
488 Ga0207702_10386382 3300026078 Bacteria 1347
489 Ga0207641_10000502 3300026088 Bacteria 44127
490 Ga0207641_10036006 3300026088 Bacteria 4129
491 Ga0207641_10036013 3300026088 Bacteria 4128
492 Ga0207641_10269953 3300026088 Bacteria 1596
493 Ga0207641_10801892 3300026088 Bacteria 931
494 Ga0207648_10018551 3300026089 Bacteria 6297
495 Ga0207648_10489826 3300026089 Bacteria 1124
496 Ga0207648_10713128 3300026089 Bacteria 930
497 Ga0207676_10006711 3300026095 Bacteria 8141
498 Ga0207676_10008921 3300026095 Bacteria 7134
499 Ga0207676_10015461 3300026095 Bacteria 5506
500 Ga0207676_10021484 3300026095 Bacteria 4735
501 Ga0207676_10032734 3300026095 Bacteria 3921
502 Ga0207676_10051296 3300026095 Bacteria 3220
503 Ga0207676_10069199 3300026095 Bacteria 2826
504 Ga0207676_10114033 3300026095 Bacteria 2267
505 Ga0207676_10336525 3300026095 Bacteria 1391
506 Ga0207674_10000086 3300026116 Bacteria 100722
507 Ga0207674_10001687 3300026116 Bacteria 28359
508 Ga0207674_10001715 3300026116 Bacteria 28037
509 Ga0207674_10004612 3300026116 Bacteria 16545
510 Ga0207674_10005367 3300026116 Bacteria 15246
511 Ga0207674_10011675 3300026116 Bacteria 9862
512 Ga0207674_10140847 3300026116 Bacteria 2371
513 Ga0207674_10145971 3300026116 Bacteria 2324
514 Ga0207675_100480570 3300026118 Bacteria 1235
515 Ga0207675_100527904 3300026118 Bacteria 1177
516 Ga0207683_10023087 3300026121 Bacteria 5346
517 Ga0207683_10180294 3300026121 Bacteria 1915
518 Ga0207683_10249516 3300026121 Bacteria 1620
519 Ga0207698_10001441 3300026142 Bacteria 13822
520 Ga0207698_10001717 3300026142 Bacteria 12776
521 Ga0207698_10005004 3300026142 Bacteria 8130
522 Ga0207698_10007457 3300026142 Bacteria 6849
523 Ga0207698_10040073 3300026142 Bacteria 3476
524 Ga0207698_10056284 3300026142 Bacteria 3036
525 Ga0207698_10074066 3300026142 Bacteria 2714
526 Ga0207698_10097061 3300026142 Bacteria 2431
527 Ga0207698_10144724 3300026142 Bacteria 2054
528 Ga0207698_10176080 3300026142 Bacteria 1889
529 Ga0207698_10369135 3300026142 Bacteria 1361
530 Ga0207428_10102317 3300027907 Bacteria 2212
531 Ga0268266_10002799 3300028379 Bacteria 18189
532 Ga0268266_10152684 3300028379 Bacteria 2083
533 Ga0268265_10002045 3300028380 Bacteria 15816
534 Ga0268265_10005838 3300028380 Bacteria 8396
535 Ga0268265_10063086 3300028380 Bacteria 2849
536 Ga0268265_10085025 3300028380 Bacteria 2509
537 Ga0268265_10136209 3300028380 Bacteria 2049
538 Ga0268265_10149298 3300028380 Bacteria 1969
539 Ga0268264_10000410 3300028381 Bacteria 60680
540 Ga0268264_10000418 3300028381 Bacteria 59942
541 Ga0268264_10003670 3300028381 Bacteria 13190
542 Ga0268264_10004427 3300028381 Bacteria 11983
543 Ga0268264_10049649 3300028381 Bacteria 3491
544 Ga0268264_10511985 3300028381 Bacteria 1172
545 Ga0268264_10621349 3300028381 Bacteria 1067
546 Ga0307513_10123908 3300031456 Bacteria 2544
547 Ga0307408_100232462 3300031548 Bacteria 1511
548 Ga0307408_100250383 3300031548 Bacteria 1461
549 Ga0307405_10021649 3300031731 Bacteria 3618
550 Ga0307405_10219804 3300031731 Bacteria 1393
551 Ga0307413_10264948 3300031824 Bacteria 1283
552 Ga0307410_10035163 3300031852 Bacteria 3251
553 Ga0307410_10042014 3300031852 Bacteria 3019
554 Ga0307410_10112127 3300031852 Bacteria 1975
555 Ga0307406_10102189 3300031901 Bacteria 1955
556 Ga0307412_10236533 3300031911 Bacteria 1410
557 Ga0307409_100346347 3300031995 Bacteria 1400
558 Ga0307416_100001278 3300032002 Bacteria 13552
559 Ga0307416_100177520 3300032002 Bacteria 1992
560 Ga0307416_100241703 3300032002 Bacteria 1750
561 Ga0307416_100701371 3300032002 Bacteria 1101
562 Ga0307416_100933041 3300032002 Bacteria 969
563 Ga0307411_10106225 3300032005 Bacteria 1998
564 Ga0307411_10229684 3300032005 Bacteria 1445
565 Ga0307415_100001974 3300032126 Bacteria 10092
566 Ga0307415_100056765 3300032126 Bacteria 2687
567 Ga0373931_0038155 3300035691 Bacteria 2512
568 Ga0373933_0090176 3300035724 Bacteria 1891
569 Ga0373925_0658624 3300037068 Bacteria 863
570 Ga0395899_0004923 3300037312 Bacteria 10387
571 Ga0395899_0045863 3300037312 Bacteria 3257
572 Ga0395899_0052855 3300037312 Bacteria 3010
573 Ga0395899_0098289 3300037312 Bacteria 2115
574 Ga0395899_0373106 3300037312 Bacteria 950
575 Ga0395900_0014124 3300037418 Bacteria 8155
576 Ga0395900_0015350 3300037418 Bacteria 7808
577 Ga0395900_0016744 3300037418 Bacteria 7479
578 Ga0395900_0031945 3300037418 Bacteria 5411
579 Ga0395900_0132063 3300037418 Bacteria 2558
580 Ga0395900_0240308 3300037418 Bacteria 1817
581 Ga0395900_0628422 3300037418 Bacteria 1012
582 Ga0395898_0002701 3300037466 Bacteria 20519
583 Ga0395898_0098661 3300037466 Bacteria 2805
584 Ga0395898_0184991 3300037466 Bacteria 1990
585 Ga0395898_0259829 3300037466 Bacteria 1656
586 Ga0395898_0526763 3300037466 Bacteria 1123
587 Ga0395898_0676200 3300037466 Bacteria 974
588 Ga0395905_0003223 3300037471 Bacteria 17551
589 Ga0395905_0008041 3300037471 Bacteria 10420
590 Ga0395905_0010915 3300037471 Bacteria 8793
591 Ga0395905_0011911 3300037471 Bacteria 8387
592 Ga0395905_0014089 3300037471 Bacteria 7644
593 Ga0395905_0027561 3300037471 Bacteria 5357
594 Ga0395905_0030456 3300037471 Bacteria 5085
595 Ga0395905_0037798 3300037471 Bacteria 4531
596 Ga0395905_0039129 3300037471 Bacteria 4449
597 Ga0395905_0056905 3300037471 Bacteria 3657
598 Ga0395905_0066738 3300037471 Bacteria 3370
599 Ga0395905_0072172 3300037471 Bacteria 3236
600 Ga0395905_0093632 3300037471 Bacteria 2818
601 Ga0395905_0217798 3300037471 Bacteria 1787
602 Ga0395905_0231037 3300037471 Bacteria 1729
603 Ga0395905_0301022 3300037471 Bacteria 1491
604 Ga0395905_0595573 3300037471 Bacteria 1007
605 Ga0395901_0002307 3300038443 Bacteria 19441
606 Ga0395901_0006240 3300038443 Bacteria 12082
607 Ga0395901_0017583 3300038443 Bacteria 7299
608 Ga0395901_0029510 3300038443 Bacteria 5648
609 Ga0395901_0049375 3300038443 Bacteria 4371
610 Ga0395901_0069941 3300038443 Bacteria 3656
611 Ga0395901_0070253 3300038443 Bacteria 3648
612 Ga0395901_0110468 3300038443 Bacteria 2886
613 Ga0395901_0128414 3300038443 Bacteria 2664
614 Ga0395901_0162507 3300038443 Bacteria 2345
615 Ga0395901_0190719 3300038443 Bacteria 2149
616 Ga0395901_0465348 3300038443 Bacteria 1291
617 Ga0436365_1025078 3300039437 Bacteria 33251
618 Ga0436362_0376260 3300039453 Bacteria 74620
619 Ga0439445_0001282 3300042004 Bacteria 5440
620 Ga0450892_005517 3300042130 Bacteria 1041
621 Ga0450905_007099 3300042142 Bacteria 1522
622 Ga0450889_000164 3300042144 Bacteria 6977
623 Ga0439458_0000109 3300042157 Bacteria 16485
624 Ga0439458_0000434 3300042157 Bacteria 10555
625 Ga0466965_0183342 3300044683 Bacteria 1105
626 Ga0466961_0051697 3300044693 Bacteria 2624
627 Ga0466963_0006830 3300044694 Bacteria 6791
628 Ga0466963_0016446 3300044694 Bacteria 4600
629 Ga0466963_0209321 3300044694 Bacteria 1364
630 Ga0466971_0045859 3300044719 Bacteria 1964
631 Ga0466971_0090815 3300044719 Bacteria 1398
632 Ga0466957_0015521 3300044842 Bacteria 4448
633 Ga0466957_0015544 3300044842 Bacteria 4445
634 Ga0466957_0309128 3300044842 Bacteria 1064
635 Ga0466957_0378222 3300044842 Bacteria 965
636 Ga0466960_0032729 3300044901 Bacteria 2410
637 Ga0466959_0244682 3300045049 Bacteria 1238
638 Ga0466958_0016344 3300045836 Bacteria 4272
639 Ga0466958_0179789 3300045836 Bacteria 1342
640 Ga0466967_0008915 3300045976 Bacteria 7403
641 Ga0466967_0019275 3300045976 Bacteria 5482
642 Ga0466967_0148126 3300045976 Bacteria 2191
643 Ga0466967_0152179 3300045976 Bacteria 2163
644 Ga0466967_0881734 3300045976 Bacteria 889
645 Ga0466967_1012951 3300045976 Bacteria 827
646 Ga0495668_0021740 3300046616 Bacteria 3673
647 Ga0495602_0109187 3300048088 Bacteria 2251
648 Ga0496100_0096199 3300048903 Bacteria 2031
649 Ga0496101_0002532 3300048904 Bacteria 11226
650 Ga0496102_0022374 3300048905 Bacteria 5601
651 Ga0496103_0031204 3300048906 Bacteria 3246
652 Ga0496103_0086960 3300048906 Bacteria 1970
653 Ga0496104_0256167 3300048907 Bacteria 1663
654 Ga0496105_0026043 3300048908 Bacteria 4767
655 Ga0496105_0237985 3300048908 Bacteria 1478
656 Ga0496105_0302986 3300048908 Bacteria 1284
657 Ga0496107_0037609 3300048910 Bacteria 3473
658 Ga0496107_0042345 3300048910 Bacteria 3270
659 Ga0496107_0086374 3300048910 Bacteria 2290
660 Ga0496108_0239397 3300048911 Bacteria 1578
661 Ga0496108_0250582 3300048911 Bacteria 1540
662 Ga0496109_0023599 3300048912 Bacteria 5460
663 Ga0496109_0252855 3300048912 Bacteria 1659
664 Ga0496110_0031758 3300048913 Bacteria 4558
665 Ga0496110_0095264 3300048913 Bacteria 2666
666 Ga0496110_0102982 3300048913 Bacteria 2560
667 Ga0496110_0145914 3300048913 Bacteria 2140
668 Ga0496110_0254485 3300048913 Bacteria 1598
669 Ga0496110_0505732 3300048913 Bacteria 1100
670 Ga0496111_0020675 3300048914 Bacteria 4586
671 Ga0496111_0039667 3300048914 Bacteria 3377
672 Ga0496111_0093525 3300048914 Bacteria 2204
673 Ga0496111_0099358 3300048914 Bacteria 2137
674 Ga0496112_0006417 3300048915 Bacteria 10321
675 Ga0496112_0055464 3300048915 Bacteria 3896
676 Ga0496112_0056604 3300048915 Bacteria 3859
677 Ga0496113_0011674 3300048916 Bacteria 5875
678 Ga0496113_0042430 3300048916 Bacteria 3361
679 Ga0496113_0438517 3300048916 Bacteria 1049
680 Ga0496114_0504219 3300048917 Bacteria 1070
681 Ga0501067_0031476 3300049583 Bacteria 2944
682 Ga0501068_0099051 3300049584 Bacteria 1806
683 Ga0501074_0059470 3300049590 Bacteria 2753
684 Ga0501080_0011952 3300049742 Bacteria 7953
685 nmdc:mga00v17_129740_c1 3300050491 Bacteria 1610
686 nmdc:mga07m45_166949_c1 3300050496 Bacteria 1278
687 nmdc:mga0qj67_215851_c1 3300050509 Bacteria 1557
688 nmdc:mga08y16_132594_c1 3300050511 Bacteria 2590
689 nmdc:mga0n895_476320_c1 3300050512 Bacteria 1259
690 nmdc:mga0a205_7550_c1 3300050515 Bacteria 9853
691 Ga0495612_0058747 3300053078 Bacteria 1590
692 Ga0495655_0001821 3300053083 Bacteria 3322
693 Ga0500658_0000105 3300053134 Bacteria 38951
694 Ga0466962_0068623 3300061719 Bacteria 1693
695 Ga0070680_100002487
696 JGI24736J21556_1000860
697 JGI24736J21556_1011492
698 JGI24740J21852_10003212
699 JGI24740J21852_10009227
700 JGI24739J22299_10002407
701 JGI24737J22298_10000206
702 JGI24737J22298_10002181
703 JGI24737J22298_10005581
704 JGI24737J22298_10035006
705 JGI24735J21928_10065870
706 JGI24738J21930_10003464
707 JGI24751J29686_10022676
708 Ga0070658_10000374
709 Ga0070658_10078686
710 Ga0070658_10227861
711 Ga0070658_10389950
712 Ga0070676_10071131
713 Ga0070676_10109020
714 Ga0070683_100004192
715 Ga0070683_100004286
716 Ga0070683_100091962
717 Ga0070683_100268231
718 Ga0070690_100011455
719 Ga0070690_100043855
720 Ga0070670_100020797
721 Ga0070670_100035076
722 Ga0070670_100096550
723 Ga0068869_100026860
724 Ga0068869_100382019
725 Ga0070666_10002899
726 Ga0070666_10003596
727 Ga0070666_10046219
728 Ga0070666_10160634
729 Ga0068868_100011585
730 Ga0068868_100058677
731 Ga0070660_100000209
732 Ga0070660_100008889
733 Ga0070660_100010377
734 Ga0070660_100038948
735 Ga0070660_100048047
736 Ga0070660_100068086
737 Ga0070660_100229713
738 Ga0070689_100096995
739 Ga0070691_10017346
740 Ga0070661_100000674
741 Ga0070661_100020645
742 Ga0070661_100023394
743 Ga0070661_100117586
744 Ga0070661_100289088
745 Ga0070661_100348981
746 Ga0070661_100364924
747 Ga0070692_10165400
748 Ga0070668_100290580
749 Ga0070668_100301499
750 Ga0070669_100073080
751 Ga0070669_100149851
752 Ga0070669_100242683
753 Ga0070669_100412754
754 Ga0070675_100092185
755 Ga0070675_100167195
756 Ga0070671_100000051
757 Ga0070671_100015829
758 Ga0070671_100019572
759 Ga0070671_100024555
760 Ga0070671_100086223
761 Ga0070671_100386390
762 Ga0070674_100041864
763 Ga0070673_100020869
764 Ga0070673_100084178
765 Ga0070673_100223968
766 Ga0070673_100338461
767 Ga0070673_100436242
768 Ga0070659_100002073
769 Ga0070659_100006211
770 Ga0070659_100010232
771 Ga0070659_100027912
772 Ga0070659_100054020
773 Ga0070659_100075531
774 Ga0070659_100090021
775 Ga0070659_100121139
776 Ga0070659_100152593
777 Ga0070667_100003327
778 Ga0070667_100005560
779 Ga0070667_100016148
780 Ga0070667_100017654
781 Ga0070667_100033003
782 Ga0070667_100151191
783 Ga0070667_100283007
784 Ga0070714_100072199
785 Ga0070714_100433266
786 Ga0070694_100097451
787 Ga0070663_100002265
788 Ga0070663_100005111
789 Ga0070663_100035009
790 Ga0070663_100037461
791 Ga0070663_100039702
792 Ga0070663_100164834
793 Ga0070678_100001634
794 Ga0070678_100065757
795 Ga0070678_100217152
796 Ga0070662_100000012
797 Ga0070662_100001989
798 Ga0070662_100007131
799 Ga0070662_100017289
800 Ga0070662_100030255
801 Ga0070662_100058990
802 Ga0070662_100328148
803 Ga0070681_10075543
804 Ga0070681_10100600
805 Ga0068867_100090339
806 Ga0070679_100012507
807 Ga0070684_100026091
808 Ga0070684_100050441
809 Ga0068853_100000032
810 Ga0068853_100032630
811 Ga0068853_100034987
812 Ga0068853_100063845
813 Ga0068853_100470551
814 Ga0070672_100065703
815 Ga0070672_100068098
816 Ga0070672_100093410
817 Ga0070686_100033806
818 Ga0070695_100087712
819 Ga0070696_100041707
820 Ga0070693_100000342
821 Ga0070665_100004860
822 Ga0070665_100080183
823 Ga0070665_100250497
824 Ga0068855_100000591
825 Ga0068855_100363437
826 Ga0070664_100002849
827 Ga0070664_100003755
828 Ga0070664_100033073
829 Ga0070664_100038934
830 Ga0070664_100059468
831 Ga0070664_100205037
832 Ga0068857_100030612
833 Ga0068857_100098701
834 Ga0068857_100098770
835 Ga0068857_100203186
836 Ga0068854_100003822
837 Ga0068854_100006478
838 Ga0068854_100030779
839 Ga0068854_100041663
840 Ga0068854_100111318
841 Ga0068854_100329468
842 Ga0068854_100362387
843 Ga0068854_100435437
844 Ga0068856_100000190
845 Ga0068856_100008997
846 Ga0068856_100020187
847 Ga0068856_100168386
848 Ga0068856_100288991
849 Ga0068856_100362644
850 Ga0068856_100472056
851 Ga0068856_100503116
852 Ga0068852_100000395
853 Ga0068852_100002073
854 Ga0068852_100011614
855 Ga0068852_100021744
856 Ga0068852_100033583
857 Ga0068852_100038929
858 Ga0068852_100051506
859 Ga0068852_100111621
860 Ga0068852_100144821
861 Ga0068852_100367013
862 Ga0068852_100688457
863 Ga0068852_100987114
864 Ga0068859_100000685
865 Ga0068859_100040131
866 Ga0068859_100094812
867 Ga0068859_100134690
868 Ga0068864_100000847
869 Ga0068864_100014893
870 Ga0068864_100025847
871 Ga0068864_100027356
872 Ga0068864_100028530
873 Ga0068864_100035162
874 Ga0068864_100200485
875 Ga0068851_10156790
876 Ga0068851_10213467
877 Ga0068863_100005917
878 Ga0068863_100026328
879 Ga0068863_100095885
880 Ga0068863_100341354
881 Ga0068863_100345183
882 Ga0068863_100562437
883 Ga0068858_100002934
884 Ga0068858_100006170
885 Ga0068858_100030883
886 Ga0068860_100001106
887 Ga0068860_100006941
888 Ga0068860_100048248
889 Ga0068860_100080459
890 Ga0068860_100102330
891 Ga0068862_100007304
892 Ga0068862_100218759
893 Ga0068862_100288246
894 Ga0068862_100295291
895 Ga0081539_10013686
896 Ga0075364_10133843
897 Ga0075366_10058074
898 Ga0097621_100007674
899 Ga0097621_100010890
900 Ga0097621_100024788
901 Ga0068871_100040659
902 Ga0068871_100081349
903 Ga0075428_100052052
904 Ga0075433_10022199
905 Ga0075434_100514904
906 Ga0068865_100013945
907 Ga0068865_100122730
908 Ga0097620_100000685
909 Ga0097620_100040129
910 Ga0097620_100094807
911 Ga0097620_100134695
912 Ga0105250_10011311
913 Ga0105240_10131645
914 Ga0105240_10195563
915 Ga0105240_10199702
916 Ga0105240_10623354
917 Ga0105240_10850364
918 Ga0111539_10010849
919 Ga0111539_10189288
920 Ga0105245_10025012
921 Ga0105247_10111114
922 Ga0105247_10250903
923 Ga0105241_10181613
924 Ga0105241_10191322
925 Ga0105248_10000083
926 Ga0105248_10001290
927 Ga0105248_10010504
928 Ga0105248_10011986
929 Ga0105248_10049177
930 Ga0105248_10161135
931 Ga0105248_10207723
932 Ga0105248_10242124
933 Ga0105248_10285227
934 Ga0105248_10309349
935 Ga0105237_10027386
936 Ga0105238_10005371
937 Ga0105238_10060953
938 Ga0105238_10243798
939 Ga0105238_10249062
940 Ga0105238_10546767
941 Ga0105249_10004218
942 Ga0105249_10037568
943 Ga0105249_10166104
944 Ga0105246_10001236
945 Ga0105246_10036939
946 Ga0105246_10076875
947 Ga0157373_10024739
948 Ga0157373_10027921
949 Ga0157373_10051701
950 Ga0157373_10092002
951 Ga0157373_10249882
952 Ga0157373_10250776
953 Ga0157371_10013378
954 Ga0157371_10031719
955 Ga0157371_10051752
956 Ga0157371_10065439
957 Ga0157371_10071293
958 Ga0157371_10114036
959 Ga0157371_10157227
960 Ga0157370_10011909
961 Ga0157370_10072675
962 Ga0157370_10215047
963 Ga0157370_10229904
964 Ga0157370_10427516
965 Ga0157369_10010429
966 Ga0157369_10273282
967 Ga0157369_10340916
968 Ga0157369_10514565
969 Ga0157369_10948914
970 Ga0157374_10282994
971 Ga0163162_10037700
972 Ga0163162_10055061
973 Ga0163162_10076703
974 Ga0163162_10258811
975 Ga0163162_10966056
976 Ga0157372_10006659
977 Ga0157372_10112642
978 Ga0157372_10113320
979 Ga0157372_10224796
980 Ga0157372_10425486
981 Ga0157375_10011059
982 Ga0157375_10572402
983 Ga0157375_10675911
984 Ga0157375_10779563
985 Ga0163163_10000307
986 Ga0163163_10000364
987 Ga0163163_10048670
988 Ga0182008_10040504
989 Ga0157377_10010129
990 Ga0157377_10025871
991 Ga0157379_10005320
992 Ga0157379_10029113
993 Ga0157376_10050828
994 Ga0163161_10070128
995 Ga0163161_10091575
996 Ga0213873_10000026
997 Ga0213876_10000149
998 Ga0207656_10014925
999 Ga0207656_10068538
1000 Ga0207696_1009256
1001 Ga0207682_10052406
1002 Ga0207642_10189578
1003 Ga0207688_10017938
1004 Ga0207688_10051977
1005 Ga0207688_10234151
1006 Ga0207680_10001044
1007 Ga0207680_10022148
1008 Ga0207680_10049246
1009 Ga0207647_10003750
1010 Ga0207647_10005204
1011 Ga0207647_10005744
1012 Ga0207647_10008197
1013 Ga0207647_10009701
1014 Ga0207647_10011192
1015 Ga0207645_10087331
1016 Ga0207643_10279038
1017 Ga0207705_10000072
1018 Ga0207705_10028274
1019 Ga0207705_10086331
1020 Ga0207705_10150560
1021 Ga0207705_10194114
1022 Ga0207705_10211186
1023 Ga0207705_10213417
1024 Ga0207705_10466551
1025 Ga0207654_10126056
1026 Ga0207707_10053862
1027 Ga0207707_10256549
1028 Ga0207695_10005583
1029 Ga0207695_10057521
1030 Ga0207695_10159247
1031 Ga0207671_10062809
1032 Ga0207671_10476750
1033 Ga0207660_10005019
1034 Ga0207657_10000496
1035 Ga0207657_10004492
1036 Ga0207657_10007401
1037 Ga0207657_10010662
1038 Ga0207657_10016875
1039 Ga0207657_10023986
1040 Ga0207657_10104098
1041 Ga0207657_10148386
1042 Ga0207657_10206631
1043 Ga0207657_10292917
1044 Ga0207657_10362631
1045 Ga0207649_10000158
1046 Ga0207649_10015462
1047 Ga0207649_10018836
1048 Ga0207649_10022700
1049 Ga0207649_10038266
1050 Ga0207649_10069176
1051 Ga0207649_10070606
1052 Ga0207649_10074251
1053 Ga0207652_10001167
1054 Ga0207652_10392457
1055 Ga0207681_10060659
1056 Ga0207681_10094042
1057 Ga0207681_10153041
1058 Ga0207681_10487160
1059 Ga0207694_10014607
1060 Ga0207694_10033272
1061 Ga0207694_10056766
1062 Ga0207650_10035924
1063 Ga0207650_10048060
1064 Ga0207650_10055340
1065 Ga0207659_10085399
1066 Ga0207659_10462465
1067 Ga0207687_10036409
1068 Ga0207664_10066793
1069 Ga0207664_10298966
1070 Ga0207644_10000358
1071 Ga0207644_10004758
1072 Ga0207644_10012673
1073 Ga0207644_10014155
1074 Ga0207644_10017452
1075 Ga0207644_10200857
1076 Ga0207644_10239710
1077 Ga0207690_10001410
1078 Ga0207690_10005347
1079 Ga0207690_10009277
1080 Ga0207690_10012196
1081 Ga0207690_10012238
1082 Ga0207690_10061001
1083 Ga0207690_10109229
1084 Ga0207690_10182730
1085 Ga0207706_10000041
1086 Ga0207706_10003120
1087 Ga0207706_10003298
1088 Ga0207706_10006675
1089 Ga0207706_10009215
1090 Ga0207706_10120168
1091 Ga0207706_10140011
1092 Ga0207706_10330774
1093 Ga0207706_10514097
1094 Ga0207686_10118151
1095 Ga0207670_10152691
1096 Ga0207669_10365623
1097 Ga0207669_10387807
1098 Ga0207704_10025449
1099 Ga0207704_10075647
1100 Ga0207704_10077073
1101 Ga0207691_10008814
1102 Ga0207691_10036319
1103 Ga0207691_10214401
1104 Ga0207691_10392387
1105 Ga0207711_10000831
1106 Ga0207711_10001208
1107 Ga0207711_10231617
1108 Ga0207711_10391174
1109 Ga0207689_10006035
1110 Ga0207689_10273219
1111 Ga0207661_10002967
1112 Ga0207661_10062691
1113 Ga0207661_10108965
1114 Ga0207661_10327354
1115 Ga0207661_10411280
1116 Ga0207679_10003505
1117 Ga0207679_10009869
1118 Ga0207679_10032405
1119 Ga0207679_10083585
1120 Ga0207679_10093476
1121 Ga0207679_10388146
1122 Ga0207667_10002008
1123 Ga0207667_10005995
1124 Ga0207667_10012442
1125 Ga0207667_10032089
1126 Ga0207667_10176662
1127 Ga0207651_10012725
1128 Ga0207651_10013225
1129 Ga0207651_10026456
1130 Ga0207651_10099280
1131 Ga0207651_10160391
1132 Ga0207712_10000819
1133 Ga0207712_10036062
1134 Ga0207712_10132626
1135 Ga0207668_10058871
1136 Ga0207668_10123654
1137 Ga0207668_10259742
1138 Ga0207668_10336102
1139 Ga0207640_10008226
1140 Ga0207640_10033277
1141 Ga0207640_10051605
1142 Ga0207640_10055178
1143 Ga0207640_10249382
1144 Ga0207658_10002673
1145 Ga0207658_10003158
1146 Ga0207658_10006868
1147 Ga0207658_10067674
1148 Ga0207658_10128706
1149 Ga0207658_10162842
1150 Ga0207658_10194400
1151 Ga0207658_10403866
1152 Ga0207677_10013551
1153 Ga0207677_10072400
1154 Ga0207677_10082245
1155 Ga0207677_10254093
1156 Ga0207677_10612451
1157 Ga0207703_10001930
1158 Ga0207703_10023804
1159 Ga0207703_10026334
1160 Ga0207703_10096134
1161 Ga0207639_10000074
1162 Ga0207639_10009793
1163 Ga0207639_10079762
1164 Ga0207639_10332602
1165 Ga0207639_10381282
1166 Ga0207639_10477176
1167 Ga0207639_10625304
1168 Ga0207639_10655951
1169 Ga0207678_10005554
1170 Ga0207678_10009642
1171 Ga0207678_10015630
1172 Ga0207678_10029713
1173 Ga0207678_10053563
1174 Ga0207678_10349832
1175 Ga0207702_10003674
1176 Ga0207702_10004666
1177 Ga0207702_10008508
1178 Ga0207702_10027944
1179 Ga0207702_10033340
1180 Ga0207702_10052679
1181 Ga0207702_10060585
1182 Ga0207702_10386382
1183 Ga0207641_10000502
1184 Ga0207641_10036006
1185 Ga0207641_10036013
1186 Ga0207641_10269953
1187 Ga0207641_10801892
1188 Ga0207648_10018551
1189 Ga0207648_10489826
1190 Ga0207648_10713128
1191 Ga0207676_10006711
1192 Ga0207676_10008921
1193 Ga0207676_10015461
1194 Ga0207676_10021484
1195 Ga0207676_10032734
1196 Ga0207676_10051296
1197 Ga0207676_10069199
1198 Ga0207676_10114033
1199 Ga0207676_10336525
1200 Ga0207674_10000086
1201 Ga0207674_10001687
1202 Ga0207674_10001715
1203 Ga0207674_10004612
1204 Ga0207674_10005367
1205 Ga0207674_10011675
1206 Ga0207674_10140847
1207 Ga0207674_10145971
1208 Ga0207675_100480570
1209 Ga0207675_100527904
1210 Ga0207683_10023087
1211 Ga0207683_10180294
1212 Ga0207683_10249516
1213 Ga0207698_10001441
1214 Ga0207698_10001717
1215 Ga0207698_10005004
1216 Ga0207698_10007457
1217 Ga0207698_10040073
1218 Ga0207698_10056284
1219 Ga0207698_10074066
1220 Ga0207698_10097061
1221 Ga0207698_10144724
1222 Ga0207698_10176080
1223 Ga0207698_10369135
1224 Ga0207428_10102317
1225 Ga0268266_10002799
1226 Ga0268266_10152684
1227 Ga0268265_10002045
1228 Ga0268265_10005838
1229 Ga0268265_10063086
1230 Ga0268265_10085025
1231 Ga0268265_10136209
1232 Ga0268265_10149298
1233 Ga0268264_10000410
1234 Ga0268264_10000418
1235 Ga0268264_10003670
1236 Ga0268264_10004427
1237 Ga0268264_10049649
1238 Ga0268264_10511985
1239 Ga0268264_10621349
1240 Ga0307513_10123908
1241 Ga0307408_100232462
1242 Ga0307408_100250383
1243 Ga0307405_10021649
1244 Ga0307405_10219804
1245 Ga0307413_10264948
1246 Ga0307410_10035163
1247 Ga0307410_10042014
1248 Ga0307410_10112127
1249 Ga0307406_10102189
1250 Ga0307412_10236533
1251 Ga0307409_100346347
1252 Ga0307416_100001278
1253 Ga0307416_100177520
1254 Ga0307416_100241703
1255 Ga0307416_100701371
1256 Ga0307416_100933041
1257 Ga0307411_10106225
1258 Ga0307411_10229684
1259 Ga0307415_100001974
1260 Ga0307415_100056765
1261 Ga0373931_0038155
1262 Ga0373933_0090176
1263 Ga0373925_0658624
1264 Ga0395899_0004923
1265 Ga0395899_0045863
1266 Ga0395899_0052855
1267 Ga0395899_0098289
1268 Ga0395899_0373106
1269 Ga0395900_0014124
1270 Ga0395900_0015350
1271 Ga0395900_0016744
1272 Ga0395900_0031945
1273 Ga0395900_0132063
1274 Ga0395900_0240308
1275 Ga0395900_0628422
1276 Ga0395898_0002701
1277 Ga0395898_0098661
1278 Ga0395898_0184991
1279 Ga0395898_0259829
1280 Ga0395898_0526763
1281 Ga0395898_0676200
1282 Ga0395905_0003223
1283 Ga0395905_0008041
1284 Ga0395905_0010915
1285 Ga0395905_0011911
1286 Ga0395905_0014089
1287 Ga0395905_0027561
1288 Ga0395905_0030456
1289 Ga0395905_0037798
1290 Ga0395905_0039129
1291 Ga0395905_0056905
1292 Ga0395905_0066738
1293 Ga0395905_0072172
1294 Ga0395905_0093632
1295 Ga0395905_0217798
1296 Ga0395905_0231037
1297 Ga0395905_0301022
1298 Ga0395905_0595573
1299 Ga0395901_0002307
1300 Ga0395901_0006240
1301 Ga0395901_0017583
1302 Ga0395901_0029510
1303 Ga0395901_0049375
1304 Ga0395901_0069941
1305 Ga0395901_0070253
1306 Ga0395901_0110468
1307 Ga0395901_0128414
1308 Ga0395901_0162507
1309 Ga0395901_0190719
1310 Ga0395901_0465348
1311 Ga0436365_1025078
1312 Ga0436362_0376260
1313 Ga0439445_0001282
1314 Ga0450892_005517
1315 Ga0450905_007099
1316 Ga0450889_000164
1317 Ga0439458_0000109
1318 Ga0439458_0000434
1319 Ga0466965_0183342
1320 Ga0466961_0051697
1321 Ga0466963_0006830
1322 Ga0466963_0016446
1323 Ga0466963_0209321
1324 Ga0466971_0045859
1325 Ga0466971_0090815
1326 Ga0466957_0015521
1327 Ga0466957_0015544
1328 Ga0466957_0309128
1329 Ga0466957_0378222
1330 Ga0466960_0032729
1331 Ga0466959_0244682
1332 Ga0466958_0016344
1333 Ga0466958_0179789
1334 Ga0466967_0008915
1335 Ga0466967_0019275
1336 Ga0466967_0148126
1337 Ga0466967_0152179
1338 Ga0466967_0881734
1339 Ga0466967_1012951
1340 Ga0495668_0021740
1341 Ga0495602_0109187
1342 Ga0496100_0096199
1343 Ga0496101_0002532
1344 Ga0496102_0022374
1345 Ga0496103_0031204
1346 Ga0496103_0086960
1347 Ga0496104_0256167
1348 Ga0496105_0026043
1349 Ga0496105_0237985
1350 Ga0496105_0302986
1351 Ga0496107_0037609
1352 Ga0496107_0042345
1353 Ga0496107_0086374
1354 Ga0496108_0239397
1355 Ga0496108_0250582
1356 Ga0496109_0023599
1357 Ga0496109_0252855
1358 Ga0496110_0031758
1359 Ga0496110_0095264
1360 Ga0496110_0102982
1361 Ga0496110_0145914
1362 Ga0496110_0254485
1363 Ga0496110_0505732
1364 Ga0496111_0020675
1365 Ga0496111_0039667
1366 Ga0496111_0093525
1367 Ga0496111_0099358
1368 Ga0496112_0006417
1369 Ga0496112_0055464
1370 Ga0496112_0056604
1371 Ga0496113_0011674
1372 Ga0496113_0042430
1373 Ga0496113_0438517
1374 Ga0496114_0504219
1375 Ga0501067_0031476
1376 Ga0501068_0099051
1377 Ga0501074_0059470
1378 Ga0501080_0011952
1379 nmdc:mga00v17_129740_c1
1380 nmdc:mga07m45_166949_c1
1381 nmdc:mga0qj67_215851_c1
1382 nmdc:mga08y16_132594_c1
1383 nmdc:mga0n895_476320_c1
1384 nmdc:mga0a205_7550_c1
1385 Ga0495612_0058747
1386 Ga0495655_0001821
1387 Ga0500658_0000105
1388 Ga0466962_0068623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

100

289

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c51-assembly1.cif.gz_A crystal structure of a simpl-like protein from campylobacter jejuni (native protein) 0.8486 42 234
7c51-assembly1.cif.gz_A crystal structure of a simpl-like protein from campylobacter jejuni (native protein) 0.8278 42 234
1nfh-assembly1.cif.gz_B-2 structure of a sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of dna-binding 0.62 63 132
6usf-assembly1.cif.gz_D cryoem structure of human alpha4beta2 nicotinic acetylcholine receptor with varenicline in complex with anti-bril synthetic antibody bak5 0.6131 96 134
2z7c-assembly1.cif.gz_A crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii 0.6064 63 136
ID Description Score Start End Superfamily
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.8144 61 163 3.30.70.2970
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7932 61 163 3.30.70.2970
af_P0ADS6_28_138_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7665 53 152 3.30.70.2970
4hvzA01 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Protein of unknown function (DUF541), domain 1 0.7235 172 237 3.30.110.170
4hvzD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7158 58 163 3.30.70.2970
ID Description Score Start End GO Terms
AF-A0A825DZM8-F1-model_v4 deleted 0.8799 43 236
AF-A0A2V9KZB7-F1-model_v4 SIMPL domain-containing protein 0.8768 43 149 GO:0006974
AF-A0A512TKN6-F1-model_v4 Uncharacterized protein 0.8595 55 152 GO:0006974
AF-A0A825DZM8-F1-model_v4 deleted 0.8467 43 236
AF-A0A7X6Y2C3-F1-model_v4 SIMPL domain-containing protein 0.8324 55 165 GO:0006974

Map