F475705

General Info

Members Datasets Scaffolds Average Seq Length
694 333 660 294

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100002872|Ga0070669_1000028725
Length 350
Sequence MSNVAKENRQVAKNAKNGSSSQFAWGAFVVLATLASWRLFLIDVGLWTLDFGRYTSRMPKKAKSSIVKVGLIQMSCDVKPESNLKKAIARIGAAAKDGAQIVCLQELFRSQYFCQTEDIELFKLAETIPGPTTEALSKVAKQKKVVVLASLFEKRAAGVYHNTTVVIDADGKIAGKYRKMHIPDDPLYYEKFYFTPGDLGFQTHDTRYGKVGALVCWDQWFPEAARLTALSGAEFIFYPTAIGWLPDEEEEMNQAQHSAWETIQRAHAIANGVYVVVVNRVGSEGKLNFWGQSFVADPFGRIIAKASADKEEVLVVDCDLSKIDETRQNWPFLRDRRIDAYDKLLFRYGA

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
13 2818991444 Filimonas endophytica 3197 Isolate Unclassified
14 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
15 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
21 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
22 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
23 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
24 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
25 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
26 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
27 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
28 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
29 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
30 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
31 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
32 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
33 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
34 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
35 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
222 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
290 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
291 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
292 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
293 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
294 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
295 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
296 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
299 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
300 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
306 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
307 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
308 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
309 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 0
Isolates 4.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 5.33
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017553 3300003203 Bacteria 2957
2 rootH1_10020237 3300003323 Bacteria 65963
3 Ga0055535_1002886 3300003761 Bacteria 5371
4 JGI25405J52794_10001158 3300003911 Unclassified 4248
5 Ga0065704_10164034 3300005289 Bacteria 1335
6 Ga0065715_10006451 3300005293 Bacteria 5913
7 Ga0065715_10089620 3300005293 Bacteria 9209
8 Ga0065715_10117683 3300005293 Bacteria 2339
9 Ga0065707_10093950 3300005295 Bacteria 3545
10 Ga0070683_100001813 3300005329 Bacteria 16645
11 Ga0070690_100012968 3300005330 Bacteria 4914
12 Ga0070690_100126325 3300005330 Bacteria 1722
13 Ga0070690_100386338 3300005330 Bacteria 1024
14 Ga0070670_100000627 3300005331 Bacteria 27660
15 Ga0068869_100061880 3300005334 Bacteria 2746
16 Ga0070666_10068584 3300005335 Bacteria 2410
17 Ga0070680_100004850 3300005336 Bacteria 10127
18 Ga0070680_100309159 3300005336 Bacteria 1341
19 Ga0070689_100058933 3300005340 Bacteria 2983
20 Ga0070689_100146791 3300005340 Bacteria 1900
21 Ga0070687_100007543 3300005343 Bacteria 4543
22 Ga0070661_100092937 3300005344 Bacteria 2235
23 Ga0070668_100001641 3300005347 Bacteria 16221
24 Ga0070669_100002872 3300005353 Bacteria 12434
25 Ga0070669_100384374 3300005353 Unclassified 1145
26 Ga0070675_100019916 3300005354 Bacteria 5353
27 Ga0070675_100090677 3300005354 Bacteria 2560
28 Ga0070671_100004792 3300005355 Bacteria 10756
29 Ga0070671_100031873 3300005355 Bacteria 4357
30 Ga0070674_100397773 3300005356 Bacteria 1125
31 Ga0070701_10036431 3300005438 Bacteria 2479
32 Ga0070705_100088294 3300005440 Bacteria 1924
33 Ga0070700_100322806 3300005441 Bacteria 1135
34 Ga0070694_100004077 3300005444 Bacteria 8761
35 Ga0070694_100058148 3300005444 Bacteria 2630
36 Ga0070694_100360290 3300005444 Bacteria 1129
37 Ga0070708_100002791 3300005445 Bacteria 13573
38 Ga0070708_100064266 3300005445 Bacteria 3287
39 Ga0070708_100111663 3300005445 Bacteria 2513
40 Ga0070708_100349753 3300005445 Bacteria 1393
41 Ga0070708_100446023 3300005445 Bacteria 1221
42 Ga0070662_100176828 3300005457 Bacteria 1680
43 Ga0070681_10010848 3300005458 Bacteria 9006
44 Ga0070681_10037535 3300005458 Bacteria 4861
45 Ga0068867_100005794 3300005459 Bacteria 8767
46 Ga0068867_100197967 3300005459 Bacteria 1607
47 Ga0070706_100002873 3300005467 Bacteria 17160
48 Ga0070706_100015182 3300005467 Bacteria 7112
49 Ga0070706_100019100 3300005467 Bacteria 6323
50 Ga0070706_100036187 3300005467 Bacteria 4559
51 Ga0070706_100051539 3300005467 Bacteria 3798
52 Ga0070706_100167031 3300005467 Bacteria 2055
53 Ga0070706_100179575 3300005467 Bacteria 1976
54 Ga0070707_100000045 3300005468 Bacteria 106487
55 Ga0070707_100006816 3300005468 Bacteria 10579
56 Ga0070707_100013735 3300005468 Bacteria 7583
57 Ga0070707_100022535 3300005468 Bacteria 5954
58 Ga0070707_100023166 3300005468 Bacteria 5874
59 Ga0070707_100159444 3300005468 Bacteria 2198
60 Ga0070698_100002158 3300005471 Bacteria 21843
61 Ga0070698_100012022 3300005471 Bacteria 9177
62 Ga0070698_100051081 3300005471 Bacteria 4212
63 Ga0070698_100077257 3300005471 Bacteria 3329
64 Ga0070698_100080457 3300005471 Bacteria 3253
65 Ga0070698_100134799 3300005471 Bacteria 2424
66 Ga0070698_100137108 3300005471 Bacteria 2400
67 Ga0070699_100001557 3300005518 Bacteria 20982
68 Ga0070699_100002982 3300005518 Bacteria 15032
69 Ga0070699_100004839 3300005518 Bacteria 11879
70 Ga0070699_100009207 3300005518 Bacteria 8562
71 Ga0070699_100044011 3300005518 Bacteria 3864
72 Ga0070699_100049357 3300005518 Bacteria 3642
73 Ga0070699_100071779 3300005518 Bacteria 3012
74 Ga0070699_100113368 3300005518 Bacteria 2382
75 Ga0070699_100175259 3300005518 Bacteria 1901
76 Ga0070699_100270689 3300005518 Bacteria 1520
77 Ga0070699_100351971 3300005518 Bacteria 1327
78 Ga0070699_100392168 3300005518 Bacteria 1255
79 Ga0070679_100000835 3300005530 Bacteria 26788
80 Ga0070679_100038328 3300005530 Bacteria 4764
81 Ga0070684_100137639 3300005535 Bacteria 2207
82 Ga0070684_100440174 3300005535 Bacteria 1204
83 Ga0070697_100001314 3300005536 Bacteria 18777
84 Ga0070697_100028520 3300005536 Bacteria 4470
85 Ga0070697_100035944 3300005536 Bacteria 3999
86 Ga0070697_100131419 3300005536 Bacteria 2100
87 Ga0070697_100145624 3300005536 Bacteria 1994
88 Ga0070697_100148064 3300005536 Bacteria 1977
89 Ga0070697_100180457 3300005536 Bacteria 1789
90 Ga0070697_100205289 3300005536 Bacteria 1676
91 Ga0070697_100301228 3300005536 Bacteria 1378
92 Ga0068853_100104395 3300005539 Bacteria 2509
93 Ga0070695_100024430 3300005545 Bacteria 3723
94 Ga0070695_100035005 3300005545 Bacteria 3153
95 Ga0070695_100156100 3300005545 Bacteria 1597
96 Ga0070696_100016442 3300005546 Bacteria 4982
97 Ga0070696_100025301 3300005546 Bacteria 4034
98 Ga0070696_100046391 3300005546 Bacteria 3013
99 Ga0070696_100104612 3300005546 Bacteria 2033
100 Ga0070696_100110518 3300005546 Bacteria 1979
101 Ga0070696_100131459 3300005546 Bacteria 1821
102 Ga0070696_100132797 3300005546 Bacteria 1813
103 Ga0070696_100169631 3300005546 Bacteria 1612
104 Ga0070696_100172075 3300005546 Bacteria 1601
105 Ga0070704_100001281 3300005549 Bacteria 13282
106 Ga0070704_100009376 3300005549 Bacteria 5911
107 Ga0070704_100546313 3300005549 Unclassified 1012
108 Ga0068855_100259558 3300005563 Bacteria 1936
109 Ga0068855_100329260 3300005563 Bacteria 1686
110 Ga0070664_100018737 3300005564 Bacteria 5693
111 Ga0070664_100039669 3300005564 Bacteria 3968
112 Ga0070664_100048786 3300005564 Bacteria 3579
113 Ga0070664_100060725 3300005564 Bacteria 3220
114 Ga0070664_100332565 3300005564 Bacteria 1378
115 Ga0068857_100082844 3300005577 Bacteria 2866
116 Ga0068857_100296379 3300005577 Bacteria 1490
117 Ga0068857_100358341 3300005577 Bacteria 1352
118 Ga0068856_100000473 3300005614 Bacteria 44407
119 Ga0068856_100003024 3300005614 Bacteria 17232
120 Ga0068852_100003713 3300005616 Bacteria 10697
121 Ga0068859_100037658 3300005617 Bacteria 4854
122 Ga0068859_100144853 3300005617 Bacteria 2450
123 Ga0068859_100371247 3300005617 Bacteria 1526
124 Ga0068861_100059682 3300005719 Bacteria 2921
125 Ga0068863_100037968 3300005841 Bacteria 4584
126 Ga0068863_100103833 3300005841 Bacteria 2703
127 Ga0068863_100105987 3300005841 Bacteria 2674
128 Ga0068862_100123682 3300005844 Bacteria 2282
129 Ga0068862_100136793 3300005844 Bacteria 2172
130 Ga0081455_10009457 3300005937 Bacteria 10026
131 Ga0081455_10013960 3300005937 Bacteria 7896
132 Ga0081538_10094815 3300005981 Bacteria 1527
133 Ga0081540_1012288 3300005983 Bacteria 5652
134 Ga0081539_10000165 3300005985 Bacteria 153824
135 Ga0075365_10068373 3300006038 Bacteria 2387
136 Ga0097621_100001261 3300006237 Bacteria 17505
137 Ga0068871_100000595 3300006358 Bacteria 24865
138 Ga0075428_100021270 3300006844 Bacteria 7184
139 Ga0075428_100060213 3300006844 Unclassified 4158
140 Ga0075428_100075578 3300006844 Bacteria 3678
141 Ga0075428_100223257 3300006844 Bacteria 2034
142 Ga0075428_100300955 3300006844 Bacteria 1724
143 Ga0075428_100396734 3300006844 Bacteria 1479
144 Ga0075428_100582826 3300006844 Bacteria 1195
145 Ga0075430_100159235 3300006846 Bacteria 1879
146 Ga0075430_100188162 3300006846 Bacteria 1716
147 Ga0075430_100232029 3300006846 Bacteria 1530
148 Ga0075430_100272011 3300006846 Bacteria 1402
149 Ga0075431_100003197 3300006847 Bacteria 15840
150 Ga0075431_100092611 3300006847 Bacteria 3120
151 Ga0075431_100119848 3300006847 Bacteria 2715
152 Ga0075433_10017655 3300006852 Bacteria 5918
153 Ga0075433_10020618 3300006852 Bacteria 5516
154 Ga0075433_10026609 3300006852 Bacteria 4900
155 Ga0075433_10042875 3300006852 Bacteria 3927
156 Ga0075434_100001332 3300006871 Bacteria 20677
157 Ga0075434_100001798 3300006871 Bacteria 18527
158 Ga0075434_100003487 3300006871 Bacteria 14068
159 Ga0075434_100088339 3300006871 Bacteria 3101
160 Ga0075434_100112272 3300006871 Bacteria 2737
161 Ga0075434_100163467 3300006871 Bacteria 2246
162 Ga0075434_100275978 3300006871 Bacteria 1700
163 Ga0075434_100343304 3300006871 Unclassified 1514
164 Ga0075429_100002455 3300006880 Bacteria 15595
165 Ga0075429_100031893 3300006880 Bacteria 4581
166 Ga0068865_100011650 3300006881 Bacteria 5510
167 Ga0068865_100095624 3300006881 Bacteria 2165
168 Ga0075436_100120776 3300006914 Bacteria 1833
169 Ga0097620_100037660 3300006931 Bacteria 4854
170 Ga0097620_100144853 3300006931 Bacteria 2450
171 Ga0097620_100371246 3300006931 Bacteria 1526
172 Ga0075435_100073387 3300007076 Bacteria 2797
173 Ga0075435_100125847 3300007076 Bacteria 2142
174 Ga0099794_10054272 3300007265 Bacteria 1934
175 Ga0099795_10032439 3300007788 Bacteria 1806
176 Ga0105240_10041597 3300009093 Bacteria 5864
177 Ga0105240_10250305 3300009093 Bacteria 2050
178 Ga0105240_10716734 3300009093 Bacteria 1090
179 Ga0111539_10140445 3300009094 Bacteria 2828
180 Ga0111539_10191418 3300009094 Bacteria 2387
181 Ga0105245_10199749 3300009098 Bacteria 1920
182 Ga0114129_10000471 3300009147 Bacteria 48410
183 Ga0114129_10004244 3300009147 Bacteria 20246
184 Ga0114129_10011573 3300009147 Bacteria 12561
185 Ga0114129_10012802 3300009147 Bacteria 11939
186 Ga0114129_10013955 3300009147 Bacteria 11446
187 Ga0114129_10060823 3300009147 Bacteria 5280
188 Ga0114129_10119826 3300009147 Bacteria 3624
189 Ga0114129_10199460 3300009147 Bacteria 2711
190 Ga0114129_10214100 3300009147 Unclassified 2603
191 Ga0114129_10298367 3300009147 Bacteria 2149
192 Ga0114129_10302777 3300009147 Bacteria 2130
193 Ga0114129_10423889 3300009147 Bacteria 1750
194 Ga0114129_10633964 3300009147 Bacteria 1381
195 Ga0114129_10758921 3300009147 Bacteria 1241
196 Ga0114129_10924821 3300009147 Bacteria 1103
197 Ga0105243_10067097 3300009148 Bacteria 2887
198 Ga0105241_10109328 3300009174 Bacteria 2211
199 Ga0105242_10107827 3300009176 Bacteria 2370
200 Ga0105242_10321417 3300009176 Bacteria 1419
201 Ga0105248_10058087 3300009177 Bacteria 4344
202 Ga0105248_10115325 3300009177 Bacteria 3030
203 Ga0105248_10940561 3300009177 Bacteria 976
204 Ga0105238_10113345 3300009551 Bacteria 2691
205 Ga0105249_10047816 3300009553 Bacteria 3899
206 Ga0105249_10082000 3300009553 Bacteria 3000
207 Ga0105249_10199025 3300009553 Bacteria 1960
208 Ga0105249_10259414 3300009553 Bacteria 1726
209 Ga0105239_10045653 3300010375 Bacteria 4802
210 Ga0105246_10095480 3300011119 Bacteria 2153
211 Ga0157370_10184222 3300013104 Bacteria 1939
212 Ga0157370_10260508 3300013104 Bacteria 1603
213 Ga0157369_10330011 3300013105 Bacteria 1585
214 Ga0157378_10014580 3300013297 Bacteria 6882
215 Ga0163162_10018625 3300013306 Bacteria 6803
216 Ga0157372_10099038 3300013307 Bacteria 3325
217 Ga0157372_10145147 3300013307 Bacteria 2737
218 Ga0157375_10033155 3300013308 Bacteria 4904
219 Ga0163163_10045914 3300014325 Bacteria 4289
220 Ga0163163_10240115 3300014325 Bacteria 1861
221 Ga0157380_10000393 3300014326 Bacteria 26369
222 Ga0157380_10017721 3300014326 Bacteria 5275
223 Ga0157380_10035130 3300014326 Bacteria 3871
224 Ga0157380_10440568 3300014326 Bacteria 1248
225 Ga0157379_10096565 3300014968 Bacteria 2652
226 Ga0163161_10130339 3300017792 Bacteria 1896
227 Ga0163161_10134815 3300017792 Bacteria 1866
228 Ga0213875_10005665 3300021388 Bacteria 6668
229 Ga0213875_10014305 3300021388 Bacteria 3873
230 Ga0207642_10044462 3300025899 Bacteria 1966
231 Ga0207680_10047463 3300025903 Bacteria 2545
232 Ga0207680_10192392 3300025903 Bacteria 1386
233 Ga0207705_10000043 3300025909 Bacteria 181491
234 Ga0207684_10009643 3300025910 Bacteria 8515
235 Ga0207684_10015581 3300025910 Bacteria 6542
236 Ga0207684_10121265 3300025910 Bacteria 2242
237 Ga0207684_10239799 3300025910 Bacteria 1564
238 Ga0207654_10224827 3300025911 Bacteria 1247
239 Ga0207707_10051144 3300025912 Bacteria 3598
240 Ga0207695_10102907 3300025913 Bacteria 2848
241 Ga0207695_10168951 3300025913 Bacteria 2114
242 Ga0207695_10279927 3300025913 Bacteria 1562
243 Ga0207671_10187354 3300025914 Bacteria 1612
244 Ga0207660_10068472 3300025917 Bacteria 2574
245 Ga0207652_10031743 3300025921 Bacteria 4436
246 Ga0207652_10144919 3300025921 Bacteria 2125
247 Ga0207646_10000097 3300025922 Bacteria 117004
248 Ga0207646_10000740 3300025922 Bacteria 42433
249 Ga0207646_10008320 3300025922 Bacteria 10409
250 Ga0207646_10026722 3300025922 Bacteria 5265
251 Ga0207646_10050144 3300025922 Bacteria 3736
252 Ga0207646_10113995 3300025922 Bacteria 2427
253 Ga0207646_10241582 3300025922 Bacteria 1631
254 Ga0207646_10271632 3300025922 Bacteria 1532
255 Ga0207681_10000701 3300025923 Bacteria 21997
256 Ga0207681_10045260 3300025923 Bacteria 2954
257 Ga0207650_10003875 3300025925 Bacteria 10222
258 Ga0207687_10127735 3300025927 Bacteria 1911
259 Ga0207700_10236148 3300025928 Bacteria 1557
260 Ga0207644_10126894 3300025931 Bacteria 1948
261 Ga0207706_10047479 3300025933 Bacteria 3798
262 Ga0207706_10198997 3300025933 Bacteria 1757
263 Ga0207706_10307931 3300025933 Bacteria 1379
264 Ga0207686_10001945 3300025934 Bacteria 11406
265 Ga0207709_10076521 3300025935 Bacteria 2142
266 Ga0207670_10128100 3300025936 Bacteria 1855
267 Ga0207670_10405811 3300025936 Bacteria 1090
268 Ga0207669_10376585 3300025937 Bacteria 1105
269 Ga0207704_10012729 3300025938 Bacteria 4182
270 Ga0207704_10552675 3300025938 Bacteria 936
271 Ga0207691_10275914 3300025940 Bacteria 1447
272 Ga0207711_10085795 3300025941 Bacteria 2759
273 Ga0207711_10114391 3300025941 Bacteria 2403
274 Ga0207689_10000202 3300025942 Bacteria 52492
275 Ga0207689_10026688 3300025942 Bacteria 4838
276 Ga0207661_10063581 3300025944 Bacteria 2989
277 Ga0207661_10374121 3300025944 Bacteria 1289
278 Ga0207679_10024234 3300025945 Bacteria 4160
279 Ga0207679_10025186 3300025945 Bacteria 4089
280 Ga0207679_10322883 3300025945 Bacteria 1337
281 Ga0207667_10002765 3300025949 Bacteria 21699
282 Ga0207712_10060720 3300025961 Bacteria 2681
283 Ga0207712_10218773 3300025961 Bacteria 1521
284 Ga0207668_10082116 3300025972 Bacteria 2340
285 Ga0207668_10230959 3300025972 Bacteria 1492
286 Ga0207677_10124398 3300026023 Bacteria 1946
287 Ga0207703_10417582 3300026035 Bacteria 1248
288 Ga0207639_10041302 3300026041 Bacteria 3449
289 Ga0207639_10254152 3300026041 Bacteria 1534
290 Ga0207678_10021640 3300026067 Bacteria 5639
291 Ga0207678_10059162 3300026067 Bacteria 3297
292 Ga0207708_10085564 3300026075 Bacteria 2425
293 Ga0207708_10343866 3300026075 Bacteria 1222
294 Ga0207702_10000240 3300026078 Bacteria 63855
295 Ga0207641_10023735 3300026088 Bacteria 5054
296 Ga0207641_10091721 3300026088 Bacteria 2659
297 Ga0207641_10291233 3300026088 Bacteria 1539
298 Ga0207648_10010403 3300026089 Bacteria 8820
299 Ga0207648_10200981 3300026089 Bacteria 1767
300 Ga0207676_10151076 3300026095 Bacteria 2000
301 Ga0207674_10304519 3300026116 Bacteria 1543
302 Ga0207675_100054009 3300026118 Bacteria 3748
303 Ga0207675_100203857 3300026118 Bacteria 1900
304 Ga0207675_100366535 3300026118 Bacteria 1414
305 Ga0207428_10414976 3300027907 Bacteria 984
306 Ga0268265_10010200 3300028380 Bacteria 6342
307 Ga0268265_10268609 3300028380 Bacteria 1520
308 Ga0268264_10000313 3300028381 Bacteria 77820
309 Ga0268264_10046604 3300028381 Bacteria 3601
310 Ga0265319_1001893 3300028563 Bacteria 11884
311 Ga0265318_10000482 3300028577 Bacteria 29443
312 Ga0265323_10008541 3300028653 Bacteria 4219
313 Ga0265323_10015393 3300028653 Bacteria 3010
314 Ga0265336_10015875 3300028666 Bacteria 2469
315 Ga0265338_10006303 3300028800 Bacteria 15169
316 Ga0265338_10014520 3300028800 Bacteria 8754
317 Ga0265330_10079653 3300031235 Bacteria 1412
318 Ga0265332_10029308 3300031238 Bacteria 2406
319 Ga0265328_10076421 3300031239 Bacteria 1232
320 Ga0265320_10002844 3300031240 Bacteria 11872
321 Ga0265325_10000151 3300031241 Bacteria 49073
322 Ga0265325_10019595 3300031241 Bacteria 3737
323 Ga0265325_10027534 3300031241 Bacteria 3072
324 Ga0265325_10047893 3300031241 Bacteria 2211
325 Ga0265329_10000298 3300031242 Bacteria 26164
326 Ga0265329_10021114 3300031242 Bacteria 2190
327 Ga0265340_10000343 3300031247 Bacteria 24742
328 Ga0265340_10100617 3300031247 Bacteria 1343
329 Ga0265339_10000181 3300031249 Bacteria 53469
330 Ga0265339_10003110 3300031249 Bacteria 11682
331 Ga0265339_10004898 3300031249 Bacteria 9030
332 Ga0265331_10000166 3300031250 Bacteria 81796
333 Ga0265331_10000242 3300031250 Bacteria 65281
334 Ga0265331_10004533 3300031250 Bacteria 8664
335 Ga0265331_10069586 3300031250 Bacteria 1648
336 Ga0265327_10118379 3300031251 Bacteria 1258
337 Ga0265316_10000307 3300031344 Bacteria 54686
338 Ga0265316_10007106 3300031344 Bacteria 10589
339 Ga0265316_10019496 3300031344 Bacteria 5800
340 Ga0265316_10020960 3300031344 Bacteria 5549
341 Ga0265316_10076300 3300031344 Bacteria 2575
342 Ga0265316_10083639 3300031344 Archaea 2445
343 Ga0265316_10208632 3300031344 Bacteria 1446
344 Ga0307513_10067162 3300031456 Bacteria 3764
345 Ga0307408_100000053 3300031548 Bacteria 147370
346 Ga0307408_100017422 3300031548 Bacteria 4807
347 Ga0307408_100071812 3300031548 Bacteria 2561
348 Ga0307408_100073455 3300031548 Bacteria 2535
349 Ga0307408_100100811 3300031548 Bacteria 2200
350 Ga0265313_10000750 3300031595 Bacteria 33181
351 Ga0265313_10005800 3300031595 Bacteria 8973
352 Ga0265313_10015109 3300031595 Bacteria 4519
353 Ga0265314_10000290 3300031711 Bacteria 72189
354 Ga0265314_10007990 3300031711 Bacteria 9123
355 Ga0265314_10017022 3300031711 Bacteria 5717
356 Ga0265314_10038229 3300031711 Bacteria 3470
357 Ga0265342_10004248 3300031712 Bacteria 11352
358 Ga0265342_10046962 3300031712 Bacteria 2593
359 Ga0265342_10112734 3300031712 Bacteria 1538
360 Ga0316576_10000272 3300031727 Bacteria 22632
361 Ga0307405_10235415 3300031731 Bacteria 1353
362 Ga0307413_10003883 3300031824 Bacteria 6390
363 Ga0307413_10004983 3300031824 Bacteria 5858
364 Ga0307413_10022501 3300031824 Bacteria 3399
365 Ga0307413_10040716 3300031824 Bacteria 2714
366 Ga0307413_10160687 3300031824 Bacteria 1578
367 Ga0307413_10322065 3300031824 Bacteria 1181
368 Ga0307413_10331281 3300031824 Bacteria 1167
369 Ga0307410_10000005 3300031852 Bacteria 100475
370 Ga0307410_10006149 3300031852 Bacteria 6445
371 Ga0307410_10011028 3300031852 Bacteria 5151
372 Ga0307410_10030065 3300031852 Bacteria 3467
373 Ga0307410_10105290 3300031852 Bacteria 2030
374 Ga0307406_10038853 3300031901 Bacteria 2949
375 Ga0307406_10074016 3300031901 Bacteria 2241
376 Ga0307406_10100685 3300031901 Bacteria 1968
377 Ga0307406_10130384 3300031901 Bacteria 1764
378 Ga0307406_10253961 3300031901 Bacteria 1326
379 Ga0307407_10009431 3300031903 Bacteria 4548
380 Ga0307407_10096532 3300031903 Bacteria 1824
381 Ga0307407_10194853 3300031903 Bacteria 1353
382 Ga0307412_10080464 3300031911 Bacteria 2251
383 Ga0307412_10170706 3300031911 Bacteria 1626
384 Ga0307409_100006205 3300031995 Bacteria 6994
385 Ga0307409_100036371 3300031995 Bacteria 3618
386 Ga0307409_100066195 3300031995 Bacteria 2848
387 Ga0307409_100120729 3300031995 Bacteria 2219
388 Ga0307409_100135961 3300031995 Bacteria 2109
389 Ga0307409_100753931 3300031995 Bacteria 977
390 Ga0307416_100000056 3300032002 Bacteria 107434
391 Ga0307416_100001477 3300032002 Bacteria 12800
392 Ga0307416_100060509 3300032002 Bacteria 3085
393 Ga0307416_100063906 3300032002 Bacteria 3017
394 Ga0307416_100064448 3300032002 Bacteria 3006
395 Ga0307416_100139756 3300032002 Bacteria 2199
396 Ga0307416_100200817 3300032002 Bacteria 1891
397 Ga0307416_100314145 3300032002 Bacteria 1565
398 Ga0307416_100580491 3300032002 Bacteria 1198
399 Ga0307416_100657989 3300032002 Bacteria 1133
400 Ga0307414_10069695 3300032004 Bacteria 2529
401 Ga0307414_10096990 3300032004 Bacteria 2207
402 Ga0307414_10150634 3300032004 Bacteria 1835
403 Ga0307414_10206197 3300032004 Bacteria 1603
404 Ga0307414_10292698 3300032004 Bacteria 1373
405 Ga0307411_10009060 3300032005 Bacteria 5207
406 Ga0307411_10010998 3300032005 Bacteria 4857
407 Ga0307411_10012258 3300032005 Bacteria 4668
408 Ga0307411_10019008 3300032005 Bacteria 3958
409 Ga0307411_10020253 3300032005 Bacteria 3864
410 Ga0307411_10056162 3300032005 Bacteria 2594
411 Ga0307411_10068306 3300032005 Bacteria 2395
412 Ga0307415_100005743 3300032126 Bacteria 6617
413 Ga0307415_100036547 3300032126 Bacteria 3219
414 Ga0307415_100087404 3300032126 Bacteria 2246
415 Ga0307415_100219804 3300032126 Bacteria 1522
416 Ga0307415_100267532 3300032126 Bacteria 1398
417 Ga0307507_10000152 3300033179 Bacteria 122095
418 Ga0373950_0038798 3300034818 Bacteria 906
419 Ga0373923_0004390 3300035111 Bacteria 4675
420 Ga0373941_0061593 3300035115 Bacteria 1222
421 Ga0373954_0018521 3300035118 Bacteria 3136
422 Ga0373960_0053755 3300035121 Bacteria 1203
423 Ga0373960_0068976 3300035121 Bacteria 1090
424 Ga0373962_0051359 3300035242 Bacteria 1189
425 Ga0373935_0055113 3300035692 Bacteria 2533
426 Ga0373927_0032850 3300035695 Bacteria 3379
427 Ga0373933_0062826 3300035724 Bacteria 2244
428 Ga0373947_0050076 3300035725 Bacteria 2511
429 Ga0373937_0004947 3300036401 Bacteria 11329
430 Ga0373937_0349233 3300036401 Archaea 1401
431 Ga0373925_0094398 3300037068 Bacteria 2291
432 Ga0395899_0000009 3300037312 Bacteria 538632
433 Ga0395899_0000136 3300037312 Bacteria 112112
434 Ga0395900_0000285 3300037418 Bacteria 75772
435 Ga0395900_0143590 3300037418 Bacteria 2443
436 Ga0395898_0000050 3300037466 Bacteria 283059
437 Ga0395905_0205328 3300037471 Bacteria 1847
438 Ga0436364_0562702 3300037853 Bacteria 2505
439 Ga0436364_1300931 3300037853 Bacteria 9045
440 Ga0400483_199042 3300039062 Bacteria 39689
441 Ga0439439_0010185 3300041406 Bacteria 2245
442 Ga0451807_1902692 3300041486 Bacteria 1136
443 Ga0439431_0032748 3300041997 Bacteria 1297
444 Ga0450898_003226 3300042134 Bacteria 2333
445 Ga0439446_0043507 3300042156 Bacteria 1327
446 Ga0439434_0006714 3300042435 Bacteria 3363
447 Ga0451577_0011905 3300042876 Bacteria 8203
448 Ga0451577_0040874 3300042876 Bacteria 4163
449 Ga0451577_0123135 3300042876 Bacteria 2323
450 Ga0451577_0131635 3300042876 Bacteria 2244
451 Ga0451577_0172711 3300042876 Bacteria 1948
452 Ga0466969_0026488 3300044656 Bacteria 2973
453 Ga0453683_0018391 3300044673 Bacteria 4487
454 Ga0453683_0085792 3300044673 Bacteria 1973
455 Ga0453684_0000027 3300044712 Bacteria 778857
456 Ga0453684_0136526 3300044712 Bacteria 2936
457 Ga0453684_0306360 3300044712 Bacteria 1804
458 Ga0466957_0012298 3300044842 Bacteria 4955
459 Ga0451576_0515877 3300045051 Bacteria 1256
460 Ga0495592_0009875 3300046454 Bacteria 7187
461 Ga0495603_0327442 3300046455 Bacteria 879
462 Ga0495638_0216794 3300046460 Bacteria 1072
463 Ga0495651_0000035 3300046462 Bacteria 98834
464 Ga0495651_0005030 3300046462 Bacteria 10098
465 Ga0495580_0220186 3300046472 Bacteria 1304
466 Ga0495582_0041673 3300046473 Bacteria 2530
467 Ga0495582_0062064 3300046473 Bacteria 2064
468 Ga0495628_0109079 3300046516 Bacteria 2130
469 Ga0495628_0222191 3300046516 Bacteria 1418
470 Ga0495631_0085520 3300046518 Bacteria 1359
471 Ga0495666_0040071 3300046526 Bacteria 2272
472 Ga0495666_0050361 3300046526 Bacteria 2002
473 Ga0495652_0014398 3300046529 Bacteria 7101
474 Ga0495640_0101711 3300046533 Bacteria 1886
475 Ga0495586_0008960 3300046535 Bacteria 5326
476 Ga0495586_0011562 3300046535 Bacteria 4695
477 Ga0495621_0065902 3300046539 Bacteria 1324
478 Ga0495645_0099919 3300046543 Bacteria 2064
479 Ga0495634_0006537 3300046642 Bacteria 8847
480 Ga0495657_0054078 3300046675 Bacteria 2683
481 Ga0495623_0002018 3300046679 Bacteria 13626
482 Ga0495658_0007267 3300046683 Bacteria 5474
483 Ga0495613_0047305 3300046689 Bacteria 3178
484 Ga0495613_0288919 3300046689 Bacteria 1137
485 Ga0495636_0032129 3300047318 Bacteria 2153
486 Ga0495674_0023015 3300047319 Bacteria 5740
487 Ga0495672_0099112 3300047320 Bacteria 1584
488 Ga0495676_0092209 3300047321 Bacteria 2262
489 Ga0495680_0000889 3300047322 Bacteria 33209
490 Ga0495680_0072934 3300047322 Bacteria 2610
491 Ga0495680_0280185 3300047322 Bacteria 1175
492 Ga0495675_0265015 3300047444 Bacteria 1028
493 Ga0496101_0035655 3300048904 Bacteria 3520
494 Ga0496101_0294013 3300048904 Bacteria 1271
495 Ga0496101_0464427 3300048904 Bacteria 999
496 Ga0496102_0007614 3300048905 Bacteria 9252
497 Ga0496102_0248223 3300048905 Bacteria 1678
498 Ga0496102_0314416 3300048905 Bacteria 1476
499 Ga0496102_0411024 3300048905 Bacteria 1271
500 Ga0496103_0075322 3300048906 Bacteria 2116
501 Ga0496104_0007861 3300048907 Bacteria 9454
502 Ga0496104_0014407 3300048907 Bacteria 7145
503 Ga0496104_0080912 3300048907 Bacteria 3097
504 Ga0496104_0192359 3300048907 Bacteria 1952
505 Ga0496106_0027551 3300048909 Bacteria 4233
506 Ga0496106_0322550 3300048909 Bacteria 1240
507 Ga0496108_0000224 3300048911 Bacteria 50600
508 Ga0496108_0002300 3300048911 Bacteria 15305
509 Ga0496109_0002073 3300048912 Bacteria 16648
510 Ga0496109_0004053 3300048912 Bacteria 12242
511 Ga0496109_0057502 3300048912 Bacteria 3550
512 Ga0496109_0087162 3300048912 Bacteria 2883
513 Ga0496110_0122170 3300048913 Bacteria 2347
514 Ga0496110_0309247 3300048913 Bacteria 1439
515 Ga0496111_0038036 3300048914 Bacteria 3446
516 Ga0496111_0043607 3300048914 Bacteria 3224
517 Ga0496111_0073303 3300048914 Bacteria 2493
518 Ga0496111_0369758 3300048914 Bacteria 1061
519 Ga0496112_0000156 3300048915 Bacteria 42945
520 Ga0496112_0026550 3300048915 Bacteria 5574
521 Ga0496112_0163829 3300048915 Bacteria 2189
522 Ga0496112_0255096 3300048915 Bacteria 1704
523 Ga0496113_0000224 3300048916 Bacteria 26509
524 Ga0496113_0007998 3300048916 Bacteria 6854
525 Ga0496113_0008116 3300048916 Bacteria 6817
526 Ga0496113_0021934 3300048916 Bacteria 4510
527 Ga0496114_0205790 3300048917 Bacteria 1725
528 Ga0496126_0016788 3300048929 Bacteria 7308
529 Ga0501292_016632 3300049515 Bacteria 1158
530 Ga0501034_0001775 3300049571 Bacteria 27580
531 Ga0501034_0058886 3300049571 Bacteria 3859
532 Ga0501036_0237211 3300049572 Bacteria 1530
533 Ga0501040_0203242 3300049576 Bacteria 1407
534 Ga0501047_0076683 3300049581 Bacteria 3217
535 Ga0501048_0057854 3300049582 Bacteria 2749
536 Ga0501067_0000266 3300049583 Bacteria 28520
537 Ga0501067_0006188 3300049583 Bacteria 6636
538 Ga0501067_0045569 3300049583 Bacteria 2435
539 Ga0501067_0094932 3300049583 Bacteria 1656
540 Ga0501068_0000448 3300049584 Bacteria 20972
541 Ga0501068_0001329 3300049584 Bacteria 13102
542 Ga0501068_0101261 3300049584 Bacteria 1786
543 Ga0501069_0000254 3300049585 Bacteria 24126
544 Ga0501069_0006987 3300049585 Bacteria 5905
545 Ga0501069_0093653 3300049585 Bacteria 1700
546 Ga0501070_0000849 3300049586 Bacteria 27734
547 Ga0501070_0020097 3300049586 Bacteria 5600
548 Ga0501070_0026790 3300049586 Bacteria 4835
549 Ga0501070_0087909 3300049586 Bacteria 2572
550 Ga0501071_0021298 3300049587 Bacteria 4512
551 Ga0501072_0000338 3300049588 Bacteria 33400
552 Ga0501072_0006050 3300049588 Bacteria 9233
553 Ga0501072_0220539 3300049588 Bacteria 1511
554 Ga0501073_0025230 3300049589 Bacteria 4265
555 Ga0501073_0075109 3300049589 Bacteria 2352
556 Ga0501074_0000589 3300049590 Bacteria 22567
557 Ga0501074_0001294 3300049590 Bacteria 16594
558 Ga0501074_0148413 3300049590 Bacteria 1677
559 Ga0501075_0005544 3300049591 Bacteria 8637
560 Ga0501076_0011564 3300049592 Bacteria 6581
561 Ga0501076_0055266 3300049592 Bacteria 3149
562 Ga0501077_0002046 3300049593 Bacteria 12165
563 Ga0501077_0018620 3300049593 Bacteria 4391
564 Ga0501199_003270 3300049650 Bacteria 1547
565 Ga0501201_008705 3300049651 Bacteria 981
566 Ga0501208_008618 3300049655 Bacteria 1382
567 Ga0501209_001936 3300049656 Bacteria 3064
568 Ga0501216_005549 3300049660 Bacteria 1907
569 Ga0501216_011090 3300049660 Bacteria 1459
570 Ga0501233_006893 3300049668 Bacteria 2149
571 Ga0501239_010435 3300049672 Bacteria 1024
572 Ga0501249_026299 3300049679 Bacteria 1286
573 Ga0501249_031080 3300049679 Bacteria 1190
574 Ga0501225_0015941 3300049705 Bacteria 2089
575 Ga0501225_0020393 3300049705 Bacteria 1832
576 Ga0501229_003620 3300049706 Bacteria 1855
577 Ga0501234_004987 3300049707 Bacteria 2085
578 Ga0501234_013368 3300049707 Bacteria 1288
579 Ga0501245_005297 3300049708 Bacteria 1784
580 Ga0501079_0039768 3300049741 Bacteria 3628
581 Ga0501079_0051569 3300049741 Bacteria 3177
582 Ga0501079_0179144 3300049741 Bacteria 1654
583 Ga0501080_0001482 3300049742 Bacteria 19788
584 Ga0501080_0067088 3300049742 Bacteria 3337
585 Ga0501080_0068702 3300049742 Bacteria 3296
586 Ga0501080_0120587 3300049742 Bacteria 2430
587 Ga0501080_0318214 3300049742 Bacteria 1409
588 Ga0501081_0015656 3300049743 Bacteria 5005
589 Ga0501081_0016245 3300049743 Bacteria 4919
590 Ga0501081_0159499 3300049743 Bacteria 1625
591 Ga0501081_0337023 3300049743 Bacteria 1110
592 Ga0501083_0000370 3300049744 Bacteria 28443
593 Ga0501083_0000654 3300049744 Bacteria 22433
594 Ga0501083_0265812 3300049744 Bacteria 1116
595 Ga0501263_011756 3300049760 Bacteria 1090
596 Ga0501268_000526 3300049765 Bacteria 4211
597 Ga0501270_006166 3300049767 Bacteria 1427
598 Ga0501273_000813 3300049770 Bacteria 2717
599 Ga0501283_002694 3300049779 Bacteria 2317
600 Ga0501045_0128562 3300049824 Bacteria 1883
601 Ga0501045_0148882 3300049824 Bacteria 1741
602 Ga0501212_012411 3300049851 Bacteria 1239
603 nmdc:mga00v17_56834_c1 3300050491 Bacteria 2392
604 nmdc:mga07m45_15486_c1 3300050496 Bacteria 4072
605 nmdc:mga05p37_101647_c1 3300050507 Bacteria 3539
606 nmdc:mga05p37_10736_c1 3300050507 Bacteria 10872
607 nmdc:mga05p37_238652_c1 3300050507 Bacteria 2187
608 nmdc:mga05p37_312747_c1 3300050507 Bacteria 1861
609 nmdc:mga05p37_317600_c1 3300050507 Bacteria 1845
610 nmdc:mga05p37_7556_c1 3300050507 Bacteria 12818
611 nmdc:mga05p37_94120_c1 3300050507 Bacteria 3692
612 nmdc:mga09592_13286_c1 3300050508 Bacteria 6724
613 nmdc:mga0qj67_147845_c1 3300050509 Bacteria 1905
614 nmdc:mga0qj67_274559_c1 3300050509 Bacteria 1366
615 nmdc:mga0qj67_31390_c1 3300050509 Bacteria 4138
616 nmdc:mga06r32_112098_c1 3300050510 Bacteria 2684
617 nmdc:mga06r32_131982_c1 3300050510 Bacteria 2470
618 nmdc:mga06r32_218158_c1 3300050510 Bacteria 1895
619 nmdc:mga08y16_13403_c1 3300050511 Bacteria 8624
620 nmdc:mga08y16_190878_c1 3300050511 Unclassified 2125
621 nmdc:mga08y16_213254_c1 3300050511 Bacteria 1999
622 nmdc:mga08y16_484293_c1 3300050511 Bacteria 1258
623 nmdc:mga08y16_85639_c1 3300050511 Bacteria 3284
624 nmdc:mga0n895_106591_c1 3300050512 Bacteria 2815
625 nmdc:mga0n895_19669_c1 3300050512 Bacteria 6278
626 nmdc:mga0n895_2630_c1 3300050512 Bacteria 14145
627 nmdc:mga0n895_289453_c1 3300050512 Bacteria 1661
628 nmdc:mga0n895_290604_c1 3300050512 Bacteria 1657
629 nmdc:mga0n895_307485_c1 3300050512 Bacteria 1607
630 nmdc:mga0n895_312730_c1 3300050512 Bacteria 1592
631 nmdc:mga0n895_31439_c1 3300050512 Bacteria 5083
632 nmdc:mga0n895_337512_c1 3300050512 Unclassified 1527
633 nmdc:mga0rr50_136987_c1 3300050513 Bacteria 1966
634 nmdc:mga0rr50_18577_c1 3300050513 Bacteria 4673
635 nmdc:mga0rr50_186044_c1 3300050513 Bacteria 1700
636 nmdc:mga0rr50_334742_c1 3300050513 Bacteria 1271
637 nmdc:mga0rr50_36845_c1 3300050513 Bacteria 3525
638 nmdc:mga08x19_281376_c1 3300050514 Bacteria 1153
639 nmdc:mga0a205_150730_c1 3300050515 Bacteria 2225
640 nmdc:mga0a205_155141_c1 3300050515 Bacteria 2188
641 nmdc:mga0a205_351_c1 3300050515 Bacteria 34832
642 nmdc:mga0a205_75931_c1 3300050515 Bacteria 3247
643 nmdc:mga0a205_75960_c1 3300050515 Bacteria 3246
644 nmdc:mga0a205_8693_c1 3300050515 Bacteria 9246
645 Ga0495601_0250737 3300053077 Bacteria 1156
646 Ga0495612_0001806 3300053078 Bacteria 8763
647 Ga0495619_0037272 3300053085 Bacteria 3167
648 Ga0500583_0004418 3300053092 Bacteria 4580
649 Ga0500568_0036467 3300053139 Bacteria 2001
650 Ga0500616_0000226 3300053153 Bacteria 88101
651 Ga0500622_0023559 3300053156 Bacteria 3260
652 Ga0501084_0001921 3300054114 Bacteria 16601
653 Ga0501084_0023363 3300054114 Bacteria 5161
654 Ga0501084_0058663 3300054114 Bacteria 3220
655 Ga0590071_001110 3300059421 Bacteria 7286
656 Ga0590071_007573 3300059421 Bacteria 2570
657 Ga0590071_017193 3300059421 Bacteria 1698
658 Ga0590077_006863 3300059426 Bacteria 2333
659 Ga0501082_0000782 3300060353 Bacteria 27952
660 Ga0501082_0053584 3300060353 Bacteria 3476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100035944 Ga0070697_1000359442 262
2 3300005445 Ga0070708_100064266 Ga0070708_1000642663 266
3 3300005518 Ga0070699_100113368 Ga0070699_1001133682 266
4 3300050515 nmdc:mga0a205_75960_c1 nmdc:mga0a205_75960_c1_1546_2358 266
5 3300025938 Ga0207704_10552675 Ga0207704_105526751 267
6 3300048914 Ga0496111_0369758 Ga0496111_0369758_26_841 267
7 3300034818 Ga0373950_0038798 Ga0373950_0038798_39_869 272
8 3300005445 Ga0070708_100111663 Ga0070708_1001116632 273
9 3300005468 Ga0070707_100023166 Ga0070707_1000231665 273
10 3300005536 Ga0070697_100145624 Ga0070697_1001456242 273
11 3300006871 Ga0075434_100088339 Ga0075434_1000883392 273
12 3300025922 Ga0207646_10113995 Ga0207646_101139953 273
13 3300050512 nmdc:mga0n895_312730_c1 nmdc:mga0n895_312730_c1_443_1285 273
14 3300005563 Ga0068855_100259558 Ga0068855_1002595581 274
15 3300006844 Ga0075428_100060213 Ga0075428_1000602133 274
16 3300006852 Ga0075433_10020618 Ga0075433_100206184 274
17 3300006871 Ga0075434_100343304 Ga0075434_1003433041 274
18 3300009094 Ga0111539_10140445 Ga0111539_101404452 274
19 3300009147 Ga0114129_10013955 Ga0114129_100139558 274
20 3300027907 Ga0207428_10414976 Ga0207428_104149761 274
21 3300050511 nmdc:mga08y16_190878_c1 nmdc:mga08y16_190878_c1_1000_1845 274
22 3300050512 nmdc:mga0n895_337512_c1 nmdc:mga0n895_337512_c1_610_1455 274
23 3300050513 nmdc:mga0rr50_18577_c1 nmdc:mga0rr50_18577_c1_3463_4308 274
24 3300050515 nmdc:mga0a205_8693_c1 nmdc:mga0a205_8693_c1_7158_8003 274
25 3300005518 Ga0070699_100044011 Ga0070699_1000440114 276
26 3300005535 Ga0070684_100440174 Ga0070684_1004401742 276
27 3300005536 Ga0070697_100028520 Ga0070697_1000285203 276
28 3300005545 Ga0070695_100024430 Ga0070695_1000244304 276
29 3300005546 Ga0070696_100025301 Ga0070696_1000253014 276
30 3300006871 Ga0075434_100163467 Ga0075434_1001634673 276
31 3300031901 Ga0307406_10130384 Ga0307406_101303841 276
32 3300032126 Ga0307415_100087404 Ga0307415_1000874042 276
33 3300037418 Ga0395900_0143590 Ga0395900_0143590_1336_2178 276
34 3300049583 Ga0501067_0094932 Ga0501067_0094932_640_1482 276
35 3300049584 Ga0501068_0101261 Ga0501068_0101261_928_1770 276
36 3300049591 Ga0501075_0005544 Ga0501075_0005544_7778_8620 276
37 3300049651 Ga0501201_008705 Ga0501201_008705_92_934 276
38 3300049707 Ga0501234_013368 Ga0501234_013368_47_889 276
39 3300049742 Ga0501080_0068702 Ga0501080_0068702_458_1300 276
40 3300050515 nmdc:mga0a205_75931_c1 nmdc:mga0a205_75931_c1_197_1039 276
41 3300005441 Ga0070700_100322806 Ga0070700_1003228061 277
42 3300014326 Ga0157380_10440568 Ga0157380_104405681 277
43 3300046455 Ga0495603_0327442 Ga0495603_0327442_18_863 277
44 3300046472 Ga0495580_0220186 Ga0495580_0220186_34_879 277
45 3300046473 Ga0495582_0062064 Ga0495582_0062064_1172_2017 277
46 3300046526 Ga0495666_0040071 Ga0495666_0040071_1313_2158 277
47 3300046533 Ga0495640_0101711 Ga0495640_0101711_907_1752 277
48 3300046535 Ga0495586_0011562 Ga0495586_0011562_2814_3659 277
49 3300046642 Ga0495634_0006537 Ga0495634_0006537_611_1456 277
50 3300046689 Ga0495613_0288919 Ga0495613_0288919_248_1093 277
51 3300049571 Ga0501034_0058886 Ga0501034_0058886_129_977 277
52 3300049583 Ga0501067_0006188 Ga0501067_0006188_387_1235 277
53 3300049584 Ga0501068_0001329 Ga0501068_0001329_9090_9938 277
54 3300049585 Ga0501069_0006987 Ga0501069_0006987_2154_3002 277
55 3300049586 Ga0501070_0020097 Ga0501070_0020097_2450_3298 277
56 3300049587 Ga0501071_0021298 Ga0501071_0021298_1105_1953 277
57 3300049588 Ga0501072_0006050 Ga0501072_0006050_1122_1970 277
58 3300049589 Ga0501073_0025230 Ga0501073_0025230_978_1826 277
59 3300049590 Ga0501074_0001294 Ga0501074_0001294_9496_10344 277
60 3300049741 Ga0501079_0039768 Ga0501079_0039768_457_1305 277
61 3300049742 Ga0501080_0120587 Ga0501080_0120587_1535_2383 277
62 3300049744 Ga0501083_0000654 Ga0501083_0000654_12052_12900 277
63 3300050512 nmdc:mga0n895_307485_c1 nmdc:mga0n895_307485_c1_491_1336 277
64 3300050515 nmdc:mga0a205_351_c1 nmdc:mga0a205_351_c1_31996_32841 277
65 3300054114 Ga0501084_0001921 Ga0501084_0001921_6251_7099 277
66 3300060353 Ga0501082_0053584 Ga0501082_0053584_1544_2392 277
67 3300005353 Ga0070669_100384374 Ga0070669_1003843741 278
68 3300006844 Ga0075428_100075578 Ga0075428_1000755783 278
69 3300006844 Ga0075428_100300955 Ga0075428_1003009552 278
70 3300006846 Ga0075430_100159235 Ga0075430_1001592352 278
71 3300006846 Ga0075430_100188162 Ga0075430_1001881622 278
72 3300006852 Ga0075433_10042875 Ga0075433_100428752 278
73 3300006871 Ga0075434_100003487 Ga0075434_10000348710 278
74 3300006871 Ga0075434_100112272 Ga0075434_1001122722 278
75 3300006871 Ga0075434_100275978 Ga0075434_1002759782 278
76 3300007076 Ga0075435_100073387 Ga0075435_1000733873 278
77 3300009147 Ga0114129_10214100 Ga0114129_102141003 278
78 3300009147 Ga0114129_10423889 Ga0114129_104238892 278
79 3300025928 Ga0207700_10236148 Ga0207700_102361481 278
80 3300035121 Ga0373960_0053755 Ga0373960_0053755_71_928 278
81 3300035242 Ga0373962_0051359 Ga0373962_0051359_31_888 278
82 3300036401 Ga0373937_0349233 Ga0373937_0349233_353_1210 278
83 3300046683 Ga0495658_0007267 Ga0495658_0007267_3529_4386 278
84 3300050507 nmdc:mga05p37_317600_c1 nmdc:mga05p37_317600_c1_335_1192 278
85 3300050509 nmdc:mga0qj67_147845_c1 nmdc:mga0qj67_147845_c1_492_1349 278
86 3300050512 nmdc:mga0n895_2630_c1 nmdc:mga0n895_2630_c1_3708_4565 278
87 3300050512 nmdc:mga0n895_289453_c1 nmdc:mga0n895_289453_c1_288_1145 278
88 3300050512 nmdc:mga0n895_31439_c1 nmdc:mga0n895_31439_c1_2952_3809 278
89 3300050513 nmdc:mga0rr50_186044_c1 nmdc:mga0rr50_186044_c1_86_943 278
90 3300050515 nmdc:mga0a205_150730_c1 nmdc:mga0a205_150730_c1_757_1614 278
91 3300005335 Ga0070666_10068584 Ga0070666_100685842 279
92 3300005535 Ga0070684_100137639 Ga0070684_1001376392 279
93 3300005564 Ga0070664_100048786 Ga0070664_1000487861 279
94 3300005616 Ga0068852_100003713 Ga0068852_1000037135 279
95 3300005841 Ga0068863_100105987 Ga0068863_1001059873 279
96 3300025903 Ga0207680_10047463 Ga0207680_100474632 279
97 3300028381 Ga0268264_10000313 Ga0268264_1000031347 279
98 3300037068 Ga0373925_0094398 Ga0373925_0094398_69_953 279
99 3300046460 Ga0495638_0216794 Ga0495638_0216794_138_983 279
100 3300053092 Ga0500583_0004418 Ga0500583_0004418_3702_4547 279
101 3300053139 Ga0500568_0036467 Ga0500568_0036467_763_1608 279
102 3300005329 Ga0070683_100001813 Ga0070683_10000181313 280
103 3300005614 Ga0068856_100003024 Ga0068856_1000030242 280
104 3300006844 Ga0075428_100021270 Ga0075428_1000212704 280
105 3300009147 Ga0114129_10924821 Ga0114129_109248211 280
106 3300050511 nmdc:mga08y16_13403_c1 nmdc:mga08y16_13403_c1_3709_4563 280
107 3300009147 Ga0114129_10000471 Ga0114129_1000047131 281
108 3300050507 nmdc:mga05p37_7556_c1 nmdc:mga05p37_7556_c1_6641_7498 281
109 3300050510 nmdc:mga06r32_112098_c1 nmdc:mga06r32_112098_c1_1379_2236 281
110 3300050512 nmdc:mga0n895_19669_c1 nmdc:mga0n895_19669_c1_1826_2683 281
111 3300050513 nmdc:mga0rr50_136987_c1 nmdc:mga0rr50_136987_c1_268_1125 281
112 3300050515 nmdc:mga0a205_155141_c1 nmdc:mga0a205_155141_c1_990_1847 281
113 3300005444 Ga0070694_100360290 Ga0070694_1003602902 282
114 3300009147 Ga0114129_10012802 Ga0114129_100128023 282
115 3300048905 Ga0496102_0314416 Ga0496102_0314416_34_894 282
116 3300050512 nmdc:mga0n895_106591_c1 nmdc:mga0n895_106591_c1_217_1077 282
117 3300053156 Ga0500622_0023559 Ga0500622_0023559_1862_2716 282
118 3300005536 Ga0070697_100131419 Ga0070697_1001314192 283
119 3300031852 Ga0307410_10030065 Ga0307410_100300653 283
120 3300031901 Ga0307406_10074016 Ga0307406_100740162 283
121 3300031911 Ga0307412_10170706 Ga0307412_101707061 283
122 3300032004 Ga0307414_10206197 Ga0307414_102061972 283
123 3300044673 Ga0453683_0018391 Ga0453683_0018391_867_1751 283
124 3300046462 Ga0495651_0005030 Ga0495651_0005030_8979_9842 283
125 3300046526 Ga0495666_0050361 Ga0495666_0050361_1007_1870 283
126 iso_pu_bacteria 2599185184 2599479074 283
127 iso_pu_bacteria 2852623160 2852626785 283
128 iso_pu_bacteria 2884933994 2884938167 283
129 iso_pu_bacteria 2911138879 2911142417 283
130 iso_pu_bacteria 2919437846 2919442747 283
131 iso_pu_bacteria 2928078545 2928082612 283
132 iso_pu_bacteria 2928147474 2928148799 283
133 iso_pu_bacteria 2977232053 2977233910 283
134 3300042876 Ga0451577_0040874 Ga0451577_0040874_327_1199 284
135 3300044712 Ga0453684_0000027 Ga0453684_0000027_64376_65248 284
136 3300044712 Ga0453684_0136526 Ga0453684_0136526_1639_2499 284
137 3300025933 Ga0207706_10198997 Ga0207706_101989972 285
138 3300026067 Ga0207678_10021640 Ga0207678_100216404 285
139 3300031251 Ga0265327_10118379 Ga0265327_101183792 285
140 3300037312 Ga0395899_0000136 Ga0395899_0000136_105447_106310 285
141 3300037853 Ga0436364_0562702 Ga0436364_0562702_832_1704 285
142 3300044656 Ga0466969_0026488 Ga0466969_0026488_1235_2098 285
143 3300046516 Ga0495628_0222191 Ga0495628_0222191_114_989 285
144 3300053077 Ga0495601_0250737 Ga0495601_0250737_139_1014 285
145 3300053085 Ga0495619_0037272 Ga0495619_0037272_1891_2766 285
146 iso_pu_bacteria 2585427687 2586209844 285
147 iso_pu_bacteria 2585428095 2587865380 285
148 iso_pu_bacteria 2721755487 2722729439 285
149 iso_pu_bacteria 2738541283 2738755614 285
150 iso_pu_bacteria 2738541302 2738855436 285
151 iso_pu_bacteria 2739367651 2739588203 285
152 iso_pu_bacteria 2739367656 2739614014 285
153 iso_pu_bacteria 2739367663 2739648538 285
154 iso_pu_bacteria 2775506987 2776615202 285
155 iso_pu_bacteria 2818991437 2819546167 285
156 iso_pu_bacteria 2818991442 2819576280 285
157 iso_pu_bacteria 2818991444 2819586866 285
158 iso_pu_bacteria 2821136567 2821142508 285
159 iso_pu_bacteria 2842722452 2842723994 285
160 iso_pu_bacteria 2842909656 2842912274 285
161 iso_pu_bacteria 2849281842 2849282709 285
162 iso_pu_bacteria 2852627209 2852629191 285
163 iso_pu_bacteria 2896344016 2896346487 285
164 iso_pu_bacteria 2902048731 2902049466 285
165 iso_pu_bacteria 2904445276 2904446452 285
166 iso_pu_bacteria 2904467357 2904470324 285
167 iso_pu_bacteria 2904780799 2904781099 285
168 iso_pu_bacteria 2919177583 2919178701 285
169 iso_pu_bacteria 2929239360 2929243416 285
170 iso_pu_bacteria 2945997725 2945999256 285
171 iso_pu_bacteria 2954016120 2954021649 285
172 3300003323 rootH1_10020237 rootH1_1002023734 286
173 3300005614 Ga0068856_100000473 Ga0068856_10000047318 286
174 3300025903 Ga0207680_10192392 Ga0207680_101923921 286
175 3300025909 Ga0207705_10000043 Ga0207705_1000004372 286
176 3300025914 Ga0207671_10187354 Ga0207671_101873542 286
177 3300026041 Ga0207639_10041302 Ga0207639_100413025 286
178 3300026078 Ga0207702_10000240 Ga0207702_1000024050 286
179 3300028653 Ga0265323_10008541 Ga0265323_100085412 286
180 3300031344 Ga0265316_10000307 Ga0265316_100003077 286
181 3300031344 Ga0265316_10019496 Ga0265316_100194964 286
182 3300031456 Ga0307513_10067162 Ga0307513_100671623 286
183 3300031712 Ga0265342_10112734 Ga0265342_101127342 286
184 3300037312 Ga0395899_0000009 Ga0395899_0000009_70456_71331 286
185 3300037418 Ga0395900_0000285 Ga0395900_0000285_15744_16610 286
186 3300037466 Ga0395898_0000050 Ga0395898_0000050_228748_229623 286
187 3300044842 Ga0466957_0012298 Ga0466957_0012298_1301_2176 286
188 3300033179 Ga0307507_10000152 Ga0307507_1000015223 287
189 3300041997 Ga0439431_0032748 Ga0439431_0032748_259_1137 287
190 3300042876 Ga0451577_0123135 Ga0451577_0123135_898_1770 287
191 3300045051 Ga0451576_0515877 Ga0451576_0515877_341_1213 287
192 3300046518 Ga0495631_0085520 Ga0495631_0085520_338_1207 287
193 3300049586 Ga0501070_0026790 Ga0501070_0026790_3880_4758 287
194 3300049590 Ga0501074_0148413 Ga0501074_0148413_53_928 287
195 3300003911 JGI25405J52794_10001158 JGI25405J52794_100011581 288
196 3300005467 Ga0070706_100051539 Ga0070706_1000515392 288
197 3300005467 Ga0070706_100179575 Ga0070706_1001795753 288
198 3300005468 Ga0070707_100006816 Ga0070707_1000068169 288
199 3300005468 Ga0070707_100159444 Ga0070707_1001594441 288
200 3300005471 Ga0070698_100080457 Ga0070698_1000804573 288
201 3300005518 Ga0070699_100002982 Ga0070699_1000029826 288
202 3300005518 Ga0070699_100351971 Ga0070699_1003519711 288
203 3300005536 Ga0070697_100148064 Ga0070697_1001480642 288
204 3300005564 Ga0070664_100018737 Ga0070664_1000187376 288
205 3300005564 Ga0070664_100060725 Ga0070664_1000607252 288
206 3300005937 Ga0081455_10013960 Ga0081455_100139603 288
207 3300007265 Ga0099794_10054272 Ga0099794_100542721 288
208 3300007788 Ga0099795_10032439 Ga0099795_100324392 288
209 3300009093 Ga0105240_10041597 Ga0105240_100415976 288
210 3300009093 Ga0105240_10250305 Ga0105240_102503052 288
211 3300013104 Ga0157370_10184222 Ga0157370_101842222 288
212 3300025910 Ga0207684_10121265 Ga0207684_101212652 288
213 3300025913 Ga0207695_10102907 Ga0207695_101029072 288
214 3300025913 Ga0207695_10279927 Ga0207695_102799272 288
215 3300025922 Ga0207646_10000740 Ga0207646_1000074025 288
216 3300025922 Ga0207646_10050144 Ga0207646_100501442 288
217 3300025945 Ga0207679_10024234 Ga0207679_100242342 288
218 3300025945 Ga0207679_10025186 Ga0207679_100251862 288
219 3300028563 Ga0265319_1001893 Ga0265319_10018934 288
220 3300028577 Ga0265318_10000482 Ga0265318_1000048224 288
221 3300031235 Ga0265330_10079653 Ga0265330_100796532 288
222 3300031239 Ga0265328_10076421 Ga0265328_100764212 288
223 3300031240 Ga0265320_10002844 Ga0265320_100028448 288
224 3300031241 Ga0265325_10019595 Ga0265325_100195953 288
225 3300031241 Ga0265325_10047893 Ga0265325_100478932 288
226 3300031242 Ga0265329_10000298 Ga0265329_100002984 288
227 3300031247 Ga0265340_10100617 Ga0265340_101006171 288
228 3300031249 Ga0265339_10003110 Ga0265339_100031104 288
229 3300031249 Ga0265339_10004898 Ga0265339_100048985 288
230 3300031250 Ga0265331_10000242 Ga0265331_100002424 288
231 3300031250 Ga0265331_10004533 Ga0265331_100045334 288
232 3300031250 Ga0265331_10069586 Ga0265331_100695862 288
233 3300031344 Ga0265316_10007106 Ga0265316_100071063 288
234 3300031344 Ga0265316_10020960 Ga0265316_100209603 288
235 3300031344 Ga0265316_10208632 Ga0265316_102086322 288
236 3300031595 Ga0265313_10015109 Ga0265313_100151094 288
237 3300031711 Ga0265314_10007990 Ga0265314_100079904 288
238 3300031711 Ga0265314_10017022 Ga0265314_100170224 288
239 3300031711 Ga0265314_10038229 Ga0265314_100382293 288
240 3300031712 Ga0265342_10004248 Ga0265342_100042488 288
241 3300031712 Ga0265342_10046962 Ga0265342_100469622 288
242 3300031824 Ga0307413_10004983 Ga0307413_100049833 288
243 3300031903 Ga0307407_10194853 Ga0307407_101948531 288
244 3300032005 Ga0307411_10068306 Ga0307411_100683063 288
245 3300035118 Ga0373954_0018521 Ga0373954_0018521_51_929 288
246 3300035692 Ga0373935_0055113 Ga0373935_0055113_1522_2400 288
247 3300041406 Ga0439439_0010185 Ga0439439_0010185_744_1625 288
248 3300042156 Ga0439446_0043507 Ga0439446_0043507_251_1132 288
249 3300044712 Ga0453684_0306360 Ga0453684_0306360_330_1214 288
250 3300046462 Ga0495651_0000035 Ga0495651_0000035_9428_10306 288
251 3300046473 Ga0495582_0041673 Ga0495582_0041673_709_1587 288
252 3300046516 Ga0495628_0109079 Ga0495628_0109079_1095_1973 288
253 3300046529 Ga0495652_0014398 Ga0495652_0014398_2952_3830 288
254 3300046535 Ga0495586_0008960 Ga0495586_0008960_3054_3932 288
255 3300046543 Ga0495645_0099919 Ga0495645_0099919_1155_2033 288
256 3300046675 Ga0495657_0054078 Ga0495657_0054078_142_1020 288
257 3300046679 Ga0495623_0002018 Ga0495623_0002018_8914_9792 288
258 3300046689 Ga0495613_0047305 Ga0495613_0047305_1414_2292 288
259 3300047319 Ga0495674_0023015 Ga0495674_0023015_366_1244 288
260 3300047322 Ga0495680_0000889 Ga0495680_0000889_26974_27852 288
261 3300047444 Ga0495675_0265015 Ga0495675_0265015_104_982 288
262 3300049824 Ga0501045_0148882 Ga0501045_0148882_259_1143 288
263 3300050511 nmdc:mga08y16_213254_c1 nmdc:mga08y16_213254_c1_668_1534 288
264 3300053078 Ga0495612_0001806 Ga0495612_0001806_7574_8452 288
265 3300005336 Ga0070680_100309159 Ga0070680_1003091592 289
266 3300005340 Ga0070689_100146791 Ga0070689_1001467912 289
267 3300005354 Ga0070675_100090677 Ga0070675_1000906771 289
268 3300005445 Ga0070708_100349753 Ga0070708_1003497531 289
269 3300005458 Ga0070681_10037535 Ga0070681_100375352 289
270 3300005539 Ga0068853_100104395 Ga0068853_1001043952 289
271 3300005563 Ga0068855_100329260 Ga0068855_1003292602 289
272 3300006844 Ga0075428_100582826 Ga0075428_1005828262 289
273 3300009093 Ga0105240_10716734 Ga0105240_107167341 289
274 3300009174 Ga0105241_10109328 Ga0105241_101093282 289
275 3300009551 Ga0105238_10113345 Ga0105238_101133454 289
276 3300013104 Ga0157370_10260508 Ga0157370_102605082 289
277 3300013105 Ga0157369_10330011 Ga0157369_103300112 289
278 3300013307 Ga0157372_10145147 Ga0157372_101451473 289
279 3300025911 Ga0207654_10224827 Ga0207654_102248272 289
280 3300025912 Ga0207707_10051144 Ga0207707_100511442 289
281 3300025913 Ga0207695_10168951 Ga0207695_101689513 289
282 3300025921 Ga0207652_10031743 Ga0207652_100317434 289
283 3300025944 Ga0207661_10063581 Ga0207661_100635812 289
284 3300025949 Ga0207667_10002765 Ga0207667_1000276513 289
285 3300026041 Ga0207639_10254152 Ga0207639_102541522 289
286 3300031727 Ga0316576_10000272 Ga0316576_1000027214 289
287 3300031901 Ga0307406_10100685 Ga0307406_101006852 289
288 3300031903 Ga0307407_10096532 Ga0307407_100965322 289
289 3300032002 Ga0307416_100200817 Ga0307416_1002008171 289
290 3300032004 Ga0307414_10096990 Ga0307414_100969902 289
291 3300032005 Ga0307411_10010998 Ga0307411_100109982 289
292 3300032126 Ga0307415_100267532 Ga0307415_1002675322 289
293 3300044673 Ga0453683_0085792 Ga0453683_0085792_993_1889 289
294 3300049576 Ga0501040_0203242 Ga0501040_0203242_139_1020 289
295 3300049581 Ga0501047_0076683 Ga0501047_0076683_918_1814 289
296 3300049582 Ga0501048_0057854 Ga0501048_0057854_254_1135 289
297 3300049592 Ga0501076_0055266 Ga0501076_0055266_874_1755 289
298 3300049593 Ga0501077_0002046 Ga0501077_0002046_766_1701 289
299 3300049741 Ga0501079_0051569 Ga0501079_0051569_1147_2028 289
300 3300049743 Ga0501081_0016245 Ga0501081_0016245_256_1137 289
301 3300005293 Ga0065715_10006451 Ga0065715_100064514 290
302 3300005355 Ga0070671_100004792 Ga0070671_1000047927 290
303 3300005459 Ga0068867_100005794 Ga0068867_1000057946 290
304 3300005546 Ga0070696_100110518 Ga0070696_1001105182 290
305 3300005546 Ga0070696_100131459 Ga0070696_1001314592 290
306 3300005549 Ga0070704_100009376 Ga0070704_1000093761 290
307 3300005577 Ga0068857_100296379 Ga0068857_1002963792 290
308 3300005617 Ga0068859_100144853 Ga0068859_1001448532 290
309 3300005983 Ga0081540_1012288 Ga0081540_10122882 290
310 3300006237 Ga0097621_100001261 Ga0097621_1000012619 290
311 3300006358 Ga0068871_100000595 Ga0068871_1000005956 290
312 3300006844 Ga0075428_100223257 Ga0075428_1002232572 290
313 3300006847 Ga0075431_100119848 Ga0075431_1001198482 290
314 3300006871 Ga0075434_100001798 Ga0075434_10000179813 290
315 3300006881 Ga0068865_100011650 Ga0068865_1000116504 290
316 3300006931 Ga0097620_100144853 Ga0097620_1001448532 290
317 3300007076 Ga0075435_100125847 Ga0075435_1001258472 290
318 3300009147 Ga0114129_10060823 Ga0114129_100608235 290
319 3300009553 Ga0105249_10082000 Ga0105249_100820002 290
320 3300010375 Ga0105239_10045653 Ga0105239_100456532 290
321 3300011119 Ga0105246_10095480 Ga0105246_100954801 290
322 3300025931 Ga0207644_10126894 Ga0207644_101268942 290
323 3300025933 Ga0207706_10307931 Ga0207706_103079312 290
324 3300025937 Ga0207669_10376585 Ga0207669_103765851 290
325 3300025938 Ga0207704_10012729 Ga0207704_100127293 290
326 3300025942 Ga0207689_10000202 Ga0207689_100002027 290
327 3300025944 Ga0207661_10374121 Ga0207661_103741211 290
328 3300025972 Ga0207668_10230959 Ga0207668_102309592 290
329 3300026075 Ga0207708_10085564 Ga0207708_100855642 290
330 3300026075 Ga0207708_10343866 Ga0207708_103438661 290
331 3300026088 Ga0207641_10291233 Ga0207641_102912332 290
332 3300026089 Ga0207648_10010403 Ga0207648_100104036 290
333 3300026116 Ga0207674_10304519 Ga0207674_103045192 290
334 3300028666 Ga0265336_10015875 Ga0265336_100158752 290
335 3300028800 Ga0265338_10006303 Ga0265338_100063039 290
336 3300031242 Ga0265329_10021114 Ga0265329_100211142 290
337 3300031247 Ga0265340_10000343 Ga0265340_1000034316 290
338 3300031344 Ga0265316_10076300 Ga0265316_100763002 290
339 3300031344 Ga0265316_10083639 Ga0265316_100836393 290
340 3300031548 Ga0307408_100000053 Ga0307408_10000005383 290
341 3300031548 Ga0307408_100100811 Ga0307408_1001008112 290
342 3300031595 Ga0265313_10005800 Ga0265313_100058009 290
343 3300031731 Ga0307405_10235415 Ga0307405_102354151 290
344 3300031824 Ga0307413_10322065 Ga0307413_103220651 290
345 3300031852 Ga0307410_10000005 Ga0307410_1000000564 290
346 3300031901 Ga0307406_10038853 Ga0307406_100388532 290
347 3300031995 Ga0307409_100036371 Ga0307409_1000363711 290
348 3300031995 Ga0307409_100135961 Ga0307409_1001359612 290
349 3300031995 Ga0307409_100753931 Ga0307409_1007539311 290
350 3300032002 Ga0307416_100000056 Ga0307416_10000005635 290
351 3300032002 Ga0307416_100064448 Ga0307416_1000644483 290
352 3300032002 Ga0307416_100139756 Ga0307416_1001397561 290
353 3300042876 Ga0451577_0011905 Ga0451577_0011905_1766_2650 290
354 3300048904 Ga0496101_0294013 Ga0496101_0294013_312_1196 290
355 3300048905 Ga0496102_0007614 Ga0496102_0007614_3650_4534 290
356 3300048906 Ga0496103_0075322 Ga0496103_0075322_128_1012 290
357 3300048907 Ga0496104_0014407 Ga0496104_0014407_5049_5933 290
358 3300048907 Ga0496104_0080912 Ga0496104_0080912_1367_2251 290
359 3300048907 Ga0496104_0192359 Ga0496104_0192359_493_1377 290
360 3300048909 Ga0496106_0322550 Ga0496106_0322550_219_1103 290
361 3300048911 Ga0496108_0002300 Ga0496108_0002300_6880_7764 290
362 3300048912 Ga0496109_0002073 Ga0496109_0002073_3474_4358 290
363 3300048912 Ga0496109_0004053 Ga0496109_0004053_4156_5040 290
364 3300048912 Ga0496109_0087162 Ga0496109_0087162_1054_1938 290
365 3300048913 Ga0496110_0122170 Ga0496110_0122170_455_1339 290
366 3300048913 Ga0496110_0309247 Ga0496110_0309247_314_1198 290
367 3300048914 Ga0496111_0038036 Ga0496111_0038036_571_1455 290
368 3300048914 Ga0496111_0073303 Ga0496111_0073303_259_1143 290
369 3300048915 Ga0496112_0026550 Ga0496112_0026550_2348_3232 290
370 3300048915 Ga0496112_0163829 Ga0496112_0163829_474_1358 290
371 3300048915 Ga0496112_0255096 Ga0496112_0255096_744_1628 290
372 3300048916 Ga0496113_0007998 Ga0496113_0007998_60_944 290
373 3300048916 Ga0496113_0008116 Ga0496113_0008116_5312_6196 290
374 3300048916 Ga0496113_0021934 Ga0496113_0021934_1858_2742 290
375 3300049585 Ga0501069_0093653 Ga0501069_0093653_722_1654 290
376 3300049660 Ga0501216_005549 Ga0501216_005549_410_1294 290
377 3300049679 Ga0501249_031080 Ga0501249_031080_44_931 290
378 3300049705 Ga0501225_0015941 Ga0501225_0015941_496_1383 290
379 3300049707 Ga0501234_004987 Ga0501234_004987_811_1698 290
380 3300049742 Ga0501080_0067088 Ga0501080_0067088_2133_3020 290
381 3300049767 Ga0501270_006166 Ga0501270_006166_251_1138 290
382 3300050507 nmdc:mga05p37_10736_c1 nmdc:mga05p37_10736_c1_4947_5843 290
383 3300050511 nmdc:mga08y16_484293_c1 nmdc:mga08y16_484293_c1_35_919 290
384 3300050513 nmdc:mga0rr50_36845_c1 nmdc:mga0rr50_36845_c1_1428_2312 290
385 3300005336 Ga0070680_100004850 Ga0070680_1000048503 291
386 3300005347 Ga0070668_100001641 Ga0070668_1000016414 291
387 3300005354 Ga0070675_100019916 Ga0070675_1000199162 291
388 3300005356 Ga0070674_100397773 Ga0070674_1003977732 291
389 3300005440 Ga0070705_100088294 Ga0070705_1000882942 291
390 3300005445 Ga0070708_100002791 Ga0070708_1000027916 291
391 3300005458 Ga0070681_10010848 Ga0070681_100108485 291
392 3300005459 Ga0068867_100197967 Ga0068867_1001979672 291
393 3300005467 Ga0070706_100002873 Ga0070706_10000287313 291
394 3300005468 Ga0070707_100013735 Ga0070707_1000137353 291
395 3300005468 Ga0070707_100022535 Ga0070707_1000225354 291
396 3300005471 Ga0070698_100002158 Ga0070698_10000215811 291
397 3300005471 Ga0070698_100077257 Ga0070698_1000772572 291
398 3300005518 Ga0070699_100001557 Ga0070699_1000015576 291
399 3300005518 Ga0070699_100004839 Ga0070699_1000048396 291
400 3300005530 Ga0070679_100000835 Ga0070679_10000083516 291
401 3300005530 Ga0070679_100038328 Ga0070679_1000383282 291
402 3300005546 Ga0070696_100016442 Ga0070696_1000164423 291
403 3300005546 Ga0070696_100104612 Ga0070696_1001046122 291
404 3300005546 Ga0070696_100132797 Ga0070696_1001327972 291
405 3300005549 Ga0070704_100001281 Ga0070704_1000012814 291
406 3300005564 Ga0070664_100332565 Ga0070664_1003325651 291
407 3300005577 Ga0068857_100082844 Ga0068857_1000828442 291
408 3300005617 Ga0068859_100371247 Ga0068859_1003712472 291
409 3300005844 Ga0068862_100123682 Ga0068862_1001236822 291
410 3300005981 Ga0081538_10094815 Ga0081538_100948152 291
411 3300006844 Ga0075428_100396734 Ga0075428_1003967342 291
412 3300006846 Ga0075430_100272011 Ga0075430_1002720111 291
413 3300006852 Ga0075433_10017655 Ga0075433_100176554 291
414 3300006852 Ga0075433_10026609 Ga0075433_100266092 291
415 3300006871 Ga0075434_100001332 Ga0075434_10000133220 291
416 3300006880 Ga0075429_100002455 Ga0075429_1000024553 291
417 3300006880 Ga0075429_100031893 Ga0075429_1000318932 291
418 3300006914 Ga0075436_100120776 Ga0075436_1001207762 291
419 3300006931 Ga0097620_100371246 Ga0097620_1003712462 291
420 3300009147 Ga0114129_10011573 Ga0114129_100115734 291
421 3300009147 Ga0114129_10119826 Ga0114129_101198265 291
422 3300009147 Ga0114129_10199460 Ga0114129_101994603 291
423 3300009147 Ga0114129_10302777 Ga0114129_103027772 291
424 3300009147 Ga0114129_10633964 Ga0114129_106339641 291
425 3300009177 Ga0105248_10058087 Ga0105248_100580872 291
426 3300009177 Ga0105248_10115325 Ga0105248_101153252 291
427 3300009553 Ga0105249_10199025 Ga0105249_101990252 291
428 3300014325 Ga0163163_10045914 Ga0163163_100459142 291
429 3300014968 Ga0157379_10096565 Ga0157379_100965654 291
430 3300021388 Ga0213875_10005665 Ga0213875_100056655 291
431 3300025899 Ga0207642_10044462 Ga0207642_100444622 291
432 3300025910 Ga0207684_10009643 Ga0207684_100096433 291
433 3300025917 Ga0207660_10068472 Ga0207660_100684722 291
434 3300025921 Ga0207652_10144919 Ga0207652_101449192 291
435 3300025922 Ga0207646_10008320 Ga0207646_100083204 291
436 3300025922 Ga0207646_10026722 Ga0207646_100267225 291
437 3300025922 Ga0207646_10241582 Ga0207646_102415821 291
438 3300025936 Ga0207670_10405811 Ga0207670_104058111 291
439 3300025941 Ga0207711_10085795 Ga0207711_100857952 291
440 3300025941 Ga0207711_10114391 Ga0207711_101143912 291
441 3300025961 Ga0207712_10060720 Ga0207712_100607201 291
442 3300025972 Ga0207668_10082116 Ga0207668_100821162 291
443 3300026067 Ga0207678_10059162 Ga0207678_100591621 291
444 3300026095 Ga0207676_10151076 Ga0207676_101510762 291
445 3300028380 Ga0268265_10268609 Ga0268265_102686091 291
446 3300031241 Ga0265325_10027534 Ga0265325_100275344 291
447 3300031548 Ga0307408_100017422 Ga0307408_1000174222 291
448 3300031548 Ga0307408_100071812 Ga0307408_1000718122 291
449 3300031548 Ga0307408_100073455 Ga0307408_1000734552 291
450 3300031824 Ga0307413_10003883 Ga0307413_100038831 291
451 3300031824 Ga0307413_10022501 Ga0307413_100225012 291
452 3300031824 Ga0307413_10040716 Ga0307413_100407162 291
453 3300031824 Ga0307413_10160687 Ga0307413_101606872 291
454 3300031824 Ga0307413_10331281 Ga0307413_103312812 291
455 3300031852 Ga0307410_10006149 Ga0307410_100061495 291
456 3300031852 Ga0307410_10011028 Ga0307410_100110282 291
457 3300031852 Ga0307410_10105290 Ga0307410_101052902 291
458 3300031901 Ga0307406_10253961 Ga0307406_102539612 291
459 3300031903 Ga0307407_10009431 Ga0307407_100094312 291
460 3300031911 Ga0307412_10080464 Ga0307412_100804642 291
461 3300031995 Ga0307409_100006205 Ga0307409_1000062054 291
462 3300031995 Ga0307409_100066195 Ga0307409_1000661951 291
463 3300031995 Ga0307409_100120729 Ga0307409_1001207292 291
464 3300032002 Ga0307416_100001477 Ga0307416_1000014775 291
465 3300032002 Ga0307416_100060509 Ga0307416_1000605093 291
466 3300032002 Ga0307416_100063906 Ga0307416_1000639062 291
467 3300032002 Ga0307416_100314145 Ga0307416_1003141452 291
468 3300032002 Ga0307416_100580491 Ga0307416_1005804912 291
469 3300032002 Ga0307416_100657989 Ga0307416_1006579891 291
470 3300032004 Ga0307414_10069695 Ga0307414_100696952 291
471 3300032004 Ga0307414_10150634 Ga0307414_101506342 291
472 3300032004 Ga0307414_10292698 Ga0307414_102926981 291
473 3300032005 Ga0307411_10009060 Ga0307411_100090603 291
474 3300032005 Ga0307411_10019008 Ga0307411_100190084 291
475 3300032005 Ga0307411_10020253 Ga0307411_100202533 291
476 3300032005 Ga0307411_10056162 Ga0307411_100561622 291
477 3300032126 Ga0307415_100005743 Ga0307415_1000057435 291
478 3300032126 Ga0307415_100036547 Ga0307415_1000365473 291
479 3300032126 Ga0307415_100219804 Ga0307415_1002198042 291
480 3300035111 Ga0373923_0004390 Ga0373923_0004390_1077_1967 291
481 3300035115 Ga0373941_0061593 Ga0373941_0061593_281_1168 291
482 3300035121 Ga0373960_0068976 Ga0373960_0068976_184_1071 291
483 3300035695 Ga0373927_0032850 Ga0373927_0032850_45_935 291
484 3300035724 Ga0373933_0062826 Ga0373933_0062826_727_1617 291
485 3300035725 Ga0373947_0050076 Ga0373947_0050076_1413_2303 291
486 3300036401 Ga0373937_0004947 Ga0373937_0004947_1480_2370 291
487 3300037471 Ga0395905_0205328 Ga0395905_0205328_680_1567 291
488 3300039062 Ga0400483_199042 Ga0400483_199042_36359_37237 291
489 3300041486 Ga0451807_1902692 Ga0451807_1902692_76_963 291
490 3300042876 Ga0451577_0172711 Ga0451577_0172711_847_1734 291
491 3300047322 Ga0495680_0280185 Ga0495680_0280185_25_912 291
492 3300048904 Ga0496101_0035655 Ga0496101_0035655_622_1617 291
493 3300048904 Ga0496101_0464427 Ga0496101_0464427_80_967 291
494 3300048905 Ga0496102_0411024 Ga0496102_0411024_66_953 291
495 3300048907 Ga0496104_0007861 Ga0496104_0007861_3009_3896 291
496 3300048909 Ga0496106_0027551 Ga0496106_0027551_797_1684 291
497 3300048911 Ga0496108_0000224 Ga0496108_0000224_33126_34013 291
498 3300048912 Ga0496109_0057502 Ga0496109_0057502_1165_2052 291
499 3300048914 Ga0496111_0043607 Ga0496111_0043607_838_1725 291
500 3300048915 Ga0496112_0000156 Ga0496112_0000156_13034_13921 291
501 3300048916 Ga0496113_0000224 Ga0496113_0000224_12574_13461 291
502 3300048917 Ga0496114_0205790 Ga0496114_0205790_74_961 291
503 3300049515 Ga0501292_016632 Ga0501292_016632_251_1141 291
504 3300049572 Ga0501036_0237211 Ga0501036_0237211_77_964 291
505 3300049583 Ga0501067_0045569 Ga0501067_0045569_909_1808 291
506 3300049586 Ga0501070_0087909 Ga0501070_0087909_1273_2163 291
507 3300049588 Ga0501072_0220539 Ga0501072_0220539_570_1457 291
508 3300049592 Ga0501076_0011564 Ga0501076_0011564_502_1389 291
509 3300049593 Ga0501077_0018620 Ga0501077_0018620_1249_2136 291
510 3300049650 Ga0501199_003270 Ga0501199_003270_64_954 291
511 3300049655 Ga0501208_008618 Ga0501208_008618_354_1244 291
512 3300049656 Ga0501209_001936 Ga0501209_001936_209_1099 291
513 3300049660 Ga0501216_011090 Ga0501216_011090_260_1150 291
514 3300049668 Ga0501233_006893 Ga0501233_006893_252_1142 291
515 3300049672 Ga0501239_010435 Ga0501239_010435_39_929 291
516 3300049679 Ga0501249_026299 Ga0501249_026299_310_1200 291
517 3300049705 Ga0501225_0020393 Ga0501225_0020393_80_970 291
518 3300049706 Ga0501229_003620 Ga0501229_003620_740_1630 291
519 3300049708 Ga0501245_005297 Ga0501245_005297_659_1549 291
520 3300049742 Ga0501080_0318214 Ga0501080_0318214_218_1105 291
521 3300049743 Ga0501081_0015656 Ga0501081_0015656_243_1130 291
522 3300049743 Ga0501081_0159499 Ga0501081_0159499_312_1199 291
523 3300049743 Ga0501081_0337023 Ga0501081_0337023_14_901 291
524 3300049744 Ga0501083_0265812 Ga0501083_0265812_211_1098 291
525 3300049760 Ga0501263_011756 Ga0501263_011756_146_1036 291
526 3300049765 Ga0501268_000526 Ga0501268_000526_2841_3731 291
527 3300049770 Ga0501273_000813 Ga0501273_000813_1156_2046 291
528 3300049779 Ga0501283_002694 Ga0501283_002694_1143_2033 291
529 3300049824 Ga0501045_0128562 Ga0501045_0128562_310_1197 291
530 3300049851 Ga0501212_012411 Ga0501212_012411_314_1204 291
531 3300050507 nmdc:mga05p37_101647_c1 nmdc:mga05p37_101647_c1_385_1272 291
532 3300050507 nmdc:mga05p37_238652_c1 nmdc:mga05p37_238652_c1_1041_1928 291
533 3300050508 nmdc:mga09592_13286_c1 nmdc:mga09592_13286_c1_4580_5479 291
534 3300050509 nmdc:mga0qj67_274559_c1 nmdc:mga0qj67_274559_c1_244_1131 291
535 3300050510 nmdc:mga06r32_218158_c1 nmdc:mga06r32_218158_c1_486_1385 291
536 3300050512 nmdc:mga0n895_290604_c1 nmdc:mga0n895_290604_c1_148_1038 291
537 3300050514 nmdc:mga08x19_281376_c1 nmdc:mga08x19_281376_c1_89_979 291
538 3300054114 Ga0501084_0023363 Ga0501084_0023363_1792_2679 291
539 3300059421 Ga0590071_001110 Ga0590071_001110_233_1180 291
540 3300059421 Ga0590071_007573 Ga0590071_007573_1182_2069 291
541 3300059421 Ga0590071_017193 Ga0590071_017193_644_1597 291
542 3300059426 Ga0590077_006863 Ga0590077_006863_924_1871 291
543 3300005518 Ga0070699_100270689 Ga0070699_1002706891 292
544 3300005577 Ga0068857_100358341 Ga0068857_1003583412 292
545 3300006846 Ga0075430_100232029 Ga0075430_1002320291 292
546 3300006847 Ga0075431_100003197 Ga0075431_1000031975 292
547 3300025934 Ga0207686_10001945 Ga0207686_100019456 292
548 3300046454 Ga0495592_0009875 Ga0495592_0009875_5296_6231 292
549 3300047321 Ga0495676_0092209 Ga0495676_0092209_1333_2223 292
550 3300047322 Ga0495680_0072934 Ga0495680_0072934_1186_2076 292
551 3300048905 Ga0496102_0248223 Ga0496102_0248223_282_1172 292
552 3300049571 Ga0501034_0001775 Ga0501034_0001775_16104_16997 292
553 3300049583 Ga0501067_0000266 Ga0501067_0000266_11400_12293 292
554 3300049584 Ga0501068_0000448 Ga0501068_0000448_16067_16960 292
555 3300049585 Ga0501069_0000254 Ga0501069_0000254_14730_15623 292
556 3300049586 Ga0501070_0000849 Ga0501070_0000849_17130_18023 292
557 3300049588 Ga0501072_0000338 Ga0501072_0000338_17165_18058 292
558 3300049589 Ga0501073_0075109 Ga0501073_0075109_182_1075 292
559 3300049590 Ga0501074_0000589 Ga0501074_0000589_9714_10607 292
560 3300049742 Ga0501080_0001482 Ga0501080_0001482_13920_14813 292
561 3300049744 Ga0501083_0000370 Ga0501083_0000370_8530_9423 292
562 3300050509 nmdc:mga0qj67_31390_c1 nmdc:mga0qj67_31390_c1_3163_4053 292
563 3300054114 Ga0501084_0058663 Ga0501084_0058663_1561_2454 292
564 3300060353 Ga0501082_0000782 Ga0501082_0000782_9803_10696 292
565 3300005289 Ga0065704_10164034 Ga0065704_101640341 293
566 3300005293 Ga0065715_10089620 Ga0065715_1008962010 293
567 3300005295 Ga0065707_10093950 Ga0065707_100939503 293
568 3300005330 Ga0070690_100012968 Ga0070690_1000129682 293
569 3300005330 Ga0070690_100126325 Ga0070690_1001263252 293
570 3300005331 Ga0070670_100000627 Ga0070670_1000006279 293
571 3300005340 Ga0070689_100058933 Ga0070689_1000589332 293
572 3300005343 Ga0070687_100007543 Ga0070687_1000075432 293
573 3300005353 Ga0070669_100002872 Ga0070669_1000028725 293
574 3300005444 Ga0070694_100004077 Ga0070694_1000040773 293
575 3300005457 Ga0070662_100176828 Ga0070662_1001768283 293
576 3300005467 Ga0070706_100019100 Ga0070706_1000191007 293
577 3300005471 Ga0070698_100051081 Ga0070698_1000510815 293
578 3300005518 Ga0070699_100009207 Ga0070699_1000092072 293
579 3300005536 Ga0070697_100180457 Ga0070697_1001804573 293
580 3300005536 Ga0070697_100205289 Ga0070697_1002052892 293
581 3300005545 Ga0070695_100035005 Ga0070695_1000350053 293
582 3300005545 Ga0070695_100156100 Ga0070695_1001561002 293
583 3300005719 Ga0068861_100059682 Ga0068861_1000596823 293
584 3300005937 Ga0081455_10009457 Ga0081455_1000945713 293
585 3300006881 Ga0068865_100095624 Ga0068865_1000956241 293
586 3300009094 Ga0111539_10191418 Ga0111539_101914182 293
587 3300009098 Ga0105245_10199749 Ga0105245_101997493 293
588 3300009147 Ga0114129_10004244 Ga0114129_100042449 293
589 3300009147 Ga0114129_10298367 Ga0114129_102983673 293
590 3300009176 Ga0105242_10107827 Ga0105242_101078273 293
591 3300009177 Ga0105248_10940561 Ga0105248_109405611 293
592 3300009553 Ga0105249_10047816 Ga0105249_100478163 293
593 3300009553 Ga0105249_10259414 Ga0105249_102594142 293
594 3300013297 Ga0157378_10014580 Ga0157378_100145804 293
595 3300013306 Ga0163162_10018625 Ga0163162_100186253 293
596 3300013307 Ga0157372_10099038 Ga0157372_100990382 293
597 3300013308 Ga0157375_10033155 Ga0157375_100331554 293
598 3300014326 Ga0157380_10000393 Ga0157380_1000039311 293
599 3300014326 Ga0157380_10017721 Ga0157380_100177214 293
600 3300017792 Ga0163161_10130339 Ga0163161_101303392 293
601 3300021388 Ga0213875_10014305 Ga0213875_100143053 293
602 3300025910 Ga0207684_10239799 Ga0207684_102397991 293
603 3300025922 Ga0207646_10271632 Ga0207646_102716323 293
604 3300025923 Ga0207681_10000701 Ga0207681_100007016 293
605 3300025925 Ga0207650_10003875 Ga0207650_100038758 293
606 3300025927 Ga0207687_10127735 Ga0207687_101277352 293
607 3300025933 Ga0207706_10047479 Ga0207706_100474795 293
608 3300025936 Ga0207670_10128100 Ga0207670_101281002 293
609 3300025940 Ga0207691_10275914 Ga0207691_102759143 293
610 3300025961 Ga0207712_10218773 Ga0207712_102187732 293
611 3300026023 Ga0207677_10124398 Ga0207677_101243982 293
612 3300026035 Ga0207703_10417582 Ga0207703_104175822 293
613 3300026118 Ga0207675_100054009 Ga0207675_1000540093 293
614 3300026118 Ga0207675_100203857 Ga0207675_1002038573 293
615 3300028380 Ga0268265_10010200 Ga0268265_100102004 293
616 3300028381 Ga0268264_10046604 Ga0268264_100466042 293
617 3300028800 Ga0265338_10014520 Ga0265338_100145206 293
618 3300031238 Ga0265332_10029308 Ga0265332_100293082 293
619 3300031241 Ga0265325_10000151 Ga0265325_1000015131 293
620 3300031249 Ga0265339_10000181 Ga0265339_1000018121 293
621 3300031250 Ga0265331_10000166 Ga0265331_1000016628 293
622 3300031595 Ga0265313_10000750 Ga0265313_1000075026 293
623 3300031711 Ga0265314_10000290 Ga0265314_1000029028 293
624 3300037853 Ga0436364_1300931 Ga0436364_1300931_5331_6242 293
625 3300048929 Ga0496126_0016788 Ga0496126_0016788_2243_3163 293
626 3300050507 nmdc:mga05p37_312747_c1 nmdc:mga05p37_312747_c1_609_1490 293
627 3300050507 nmdc:mga05p37_94120_c1 nmdc:mga05p37_94120_c1_1686_2567 293
628 3300050513 nmdc:mga0rr50_334742_c1 nmdc:mga0rr50_334742_c1_360_1244 293
629 3300003761 Ga0055535_1002886 Ga0055535_10028864 294
630 3300005444 Ga0070694_100058148 Ga0070694_1000581482 294
631 3300005467 Ga0070706_100015182 Ga0070706_1000151823 294
632 3300005467 Ga0070706_100036187 Ga0070706_1000361874 294
633 3300005467 Ga0070706_100167031 Ga0070706_1001670312 294
634 3300005471 Ga0070698_100012022 Ga0070698_1000120222 294
635 3300005518 Ga0070699_100392168 Ga0070699_1003921681 294
636 3300005546 Ga0070696_100172075 Ga0070696_1001720752 294
637 3300009148 Ga0105243_10067097 Ga0105243_100670972 294
638 3300025910 Ga0207684_10015581 Ga0207684_100155813 294
639 3300025935 Ga0207709_10076521 Ga0207709_100765212 294
640 3300025945 Ga0207679_10322883 Ga0207679_103228832 294
641 3300032005 Ga0307411_10012258 Ga0307411_100122582 294
642 3300042876 Ga0451577_0131635 Ga0451577_0131635_136_1044 294
643 3300005293 Ga0065715_10117683 Ga0065715_101176832 295
644 3300005471 Ga0070698_100134799 Ga0070698_1001347993 295
645 3300005549 Ga0070704_100546313 Ga0070704_1005463131 295
646 3300005617 Ga0068859_100037658 Ga0068859_1000376584 295
647 3300005841 Ga0068863_100037968 Ga0068863_1000379683 295
648 3300005841 Ga0068863_100103833 Ga0068863_1001038331 295
649 3300006847 Ga0075431_100092611 Ga0075431_1000926112 295
650 3300006931 Ga0097620_100037660 Ga0097620_1000376604 295
651 3300009147 Ga0114129_10758921 Ga0114129_107589212 295
652 3300009176 Ga0105242_10321417 Ga0105242_103214172 295
653 3300025942 Ga0207689_10026688 Ga0207689_100266885 295
654 3300026088 Ga0207641_10023735 Ga0207641_100237353 295
655 3300026088 Ga0207641_10091721 Ga0207641_100917212 295
656 3300049741 Ga0501079_0179144 Ga0501079_0179144_602_1489 295
657 3300050510 nmdc:mga06r32_131982_c1 nmdc:mga06r32_131982_c1_1178_2095 295
658 3300005468 Ga0070707_100000045 Ga0070707_10000004579 296
659 3300005518 Ga0070699_100049357 Ga0070699_1000493573 296
660 3300025922 Ga0207646_10000097 Ga0207646_100000975 296
661 3300050511 nmdc:mga08y16_85639_c1 nmdc:mga08y16_85639_c1_1691_2596 296
662 3300003203 JGI25406J46586_10017553 JGI25406J46586_100175535 297
663 3300005330 Ga0070690_100386338 Ga0070690_1003863381 297
664 3300005334 Ga0068869_100061880 Ga0068869_1000618802 297
665 3300005344 Ga0070661_100092937 Ga0070661_1000929372 297
666 3300005355 Ga0070671_100031873 Ga0070671_1000318732 297
667 3300005438 Ga0070701_10036431 Ga0070701_100364312 297
668 3300005445 Ga0070708_100446023 Ga0070708_1004460231 297
669 3300005471 Ga0070698_100137108 Ga0070698_1001371082 297
670 3300005518 Ga0070699_100071779 Ga0070699_1000717792 297
671 3300005518 Ga0070699_100175259 Ga0070699_1001752592 297
672 3300005536 Ga0070697_100001314 Ga0070697_1000013145 297
673 3300005536 Ga0070697_100301228 Ga0070697_1003012283 297
674 3300005546 Ga0070696_100046391 Ga0070696_1000463912 297
675 3300005546 Ga0070696_100169631 Ga0070696_1001696312 297
676 3300005564 Ga0070664_100039669 Ga0070664_1000396692 297
677 3300005844 Ga0068862_100136793 Ga0068862_1001367933 297
678 3300005985 Ga0081539_10000165 Ga0081539_1000016571 297
679 3300006038 Ga0075365_10068373 Ga0075365_100683732 297
680 3300014325 Ga0163163_10240115 Ga0163163_102401151 297
681 3300014326 Ga0157380_10035130 Ga0157380_100351303 297
682 3300017792 Ga0163161_10134815 Ga0163161_101348152 297
683 3300025923 Ga0207681_10045260 Ga0207681_100452603 297
684 3300026089 Ga0207648_10200981 Ga0207648_102009812 297
685 3300026118 Ga0207675_100366535 Ga0207675_1003665352 297
686 3300028653 Ga0265323_10015393 Ga0265323_100153933 297
687 3300042134 Ga0450898_003226 Ga0450898_003226_390_1310 297
688 3300042435 Ga0439434_0006714 Ga0439434_0006714_2187_3083 297
689 3300046539 Ga0495621_0065902 Ga0495621_0065902_104_997 297
690 3300047318 Ga0495636_0032129 Ga0495636_0032129_462_1358 297
691 3300047320 Ga0495672_0099112 Ga0495672_0099112_92_988 297
692 3300050491 nmdc:mga00v17_56834_c1 nmdc:mga00v17_56834_c1_297_1217 297
693 3300050496 nmdc:mga07m45_15486_c1 nmdc:mga07m45_15486_c1_1396_2316 297
694 3300053153 Ga0500616_0000226 Ga0500616_0000226_55210_56115 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

68

328

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9572 7 295
6mg6-assembly2.cif.gz_C crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 0.9517 9 290
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9503 7 295
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9461 7 296
5h8k-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9458 7 296
ID Description Score Start End Superfamily
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9572 7 295 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9503 7 295 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9493 9 287 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9285 1 297 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9255 1 297 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A7V8SZN0-F1-model_v4 Carbon-nitrogen hydrolase 0.9922 12 255 GO:0033388
GO:0050126
AF-A0A7Y5FEC3-F1-model_v4 deleted 0.9921 12 139
AF-A0A535BF78-F1-model_v4 Acyltransferase 0.9885 10 152 GO:0016746
GO:0016811
AF-A0A7C6MMM4-F1-model_v4 deleted 0.988 12 239
AF-A0A7V2CZ42-F1-model_v4 Carbon-nitrogen hydrolase 0.9838 39 290 GO:0033388
GO:0050126

Feature Viewer

pLDDT pTM Quality
94.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map