F475705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 333 | 660 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100002872|Ga0070669_1000028725 |
| Length | 350 |
| Sequence | MSNVAKENRQVAKNAKNGSSSQFAWGAFVVLATLASWRLFLIDVGLWTLDFGRYTSRMPKKAKSSIVKVGLIQMSCDVKPESNLKKAIARIGAAAKDGAQIVCLQELFRSQYFCQTEDIELFKLAETIPGPTTEALSKVAKQKKVVVLASLFEKRAAGVYHNTTVVIDADGKIAGKYRKMHIPDDPLYYEKFYFTPGDLGFQTHDTRYGKVGALVCWDQWFPEAARLTALSGAEFIFYPTAIGWLPDEEEEMNQAQHSAWETIQRAHAIANGVYVVVVNRVGSEGKLNFWGQSFVADPFGRIIAKASADKEEVLVVDCDLSKIDETRQNWPFLRDRRIDAYDKLLFRYGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 2 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 5 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 8 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 9 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 13 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 14 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 15 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 16 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 17 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 18 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 19 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 20 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 21 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 22 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 23 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 24 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 25 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 26 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 27 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 28 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 29 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 30 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 31 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 32 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 33 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 34 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 35 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 204 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 222 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 226 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 292 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 293 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 294 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 299 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 306 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 309 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 327 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 332 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.1 |
| Metatranscriptomes | 0 |
| Isolates | 4.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 5.33 |
| Rhizosphere | 89.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10017553 | 3300003203 | Bacteria | 2957 |
| 2 | rootH1_10020237 | 3300003323 | Bacteria | 65963 |
| 3 | Ga0055535_1002886 | 3300003761 | Bacteria | 5371 |
| 4 | JGI25405J52794_10001158 | 3300003911 | Unclassified | 4248 |
| 5 | Ga0065704_10164034 | 3300005289 | Bacteria | 1335 |
| 6 | Ga0065715_10006451 | 3300005293 | Bacteria | 5913 |
| 7 | Ga0065715_10089620 | 3300005293 | Bacteria | 9209 |
| 8 | Ga0065715_10117683 | 3300005293 | Bacteria | 2339 |
| 9 | Ga0065707_10093950 | 3300005295 | Bacteria | 3545 |
| 10 | Ga0070683_100001813 | 3300005329 | Bacteria | 16645 |
| 11 | Ga0070690_100012968 | 3300005330 | Bacteria | 4914 |
| 12 | Ga0070690_100126325 | 3300005330 | Bacteria | 1722 |
| 13 | Ga0070690_100386338 | 3300005330 | Bacteria | 1024 |
| 14 | Ga0070670_100000627 | 3300005331 | Bacteria | 27660 |
| 15 | Ga0068869_100061880 | 3300005334 | Bacteria | 2746 |
| 16 | Ga0070666_10068584 | 3300005335 | Bacteria | 2410 |
| 17 | Ga0070680_100004850 | 3300005336 | Bacteria | 10127 |
| 18 | Ga0070680_100309159 | 3300005336 | Bacteria | 1341 |
| 19 | Ga0070689_100058933 | 3300005340 | Bacteria | 2983 |
| 20 | Ga0070689_100146791 | 3300005340 | Bacteria | 1900 |
| 21 | Ga0070687_100007543 | 3300005343 | Bacteria | 4543 |
| 22 | Ga0070661_100092937 | 3300005344 | Bacteria | 2235 |
| 23 | Ga0070668_100001641 | 3300005347 | Bacteria | 16221 |
| 24 | Ga0070669_100002872 | 3300005353 | Bacteria | 12434 |
| 25 | Ga0070669_100384374 | 3300005353 | Unclassified | 1145 |
| 26 | Ga0070675_100019916 | 3300005354 | Bacteria | 5353 |
| 27 | Ga0070675_100090677 | 3300005354 | Bacteria | 2560 |
| 28 | Ga0070671_100004792 | 3300005355 | Bacteria | 10756 |
| 29 | Ga0070671_100031873 | 3300005355 | Bacteria | 4357 |
| 30 | Ga0070674_100397773 | 3300005356 | Bacteria | 1125 |
| 31 | Ga0070701_10036431 | 3300005438 | Bacteria | 2479 |
| 32 | Ga0070705_100088294 | 3300005440 | Bacteria | 1924 |
| 33 | Ga0070700_100322806 | 3300005441 | Bacteria | 1135 |
| 34 | Ga0070694_100004077 | 3300005444 | Bacteria | 8761 |
| 35 | Ga0070694_100058148 | 3300005444 | Bacteria | 2630 |
| 36 | Ga0070694_100360290 | 3300005444 | Bacteria | 1129 |
| 37 | Ga0070708_100002791 | 3300005445 | Bacteria | 13573 |
| 38 | Ga0070708_100064266 | 3300005445 | Bacteria | 3287 |
| 39 | Ga0070708_100111663 | 3300005445 | Bacteria | 2513 |
| 40 | Ga0070708_100349753 | 3300005445 | Bacteria | 1393 |
| 41 | Ga0070708_100446023 | 3300005445 | Bacteria | 1221 |
| 42 | Ga0070662_100176828 | 3300005457 | Bacteria | 1680 |
| 43 | Ga0070681_10010848 | 3300005458 | Bacteria | 9006 |
| 44 | Ga0070681_10037535 | 3300005458 | Bacteria | 4861 |
| 45 | Ga0068867_100005794 | 3300005459 | Bacteria | 8767 |
| 46 | Ga0068867_100197967 | 3300005459 | Bacteria | 1607 |
| 47 | Ga0070706_100002873 | 3300005467 | Bacteria | 17160 |
| 48 | Ga0070706_100015182 | 3300005467 | Bacteria | 7112 |
| 49 | Ga0070706_100019100 | 3300005467 | Bacteria | 6323 |
| 50 | Ga0070706_100036187 | 3300005467 | Bacteria | 4559 |
| 51 | Ga0070706_100051539 | 3300005467 | Bacteria | 3798 |
| 52 | Ga0070706_100167031 | 3300005467 | Bacteria | 2055 |
| 53 | Ga0070706_100179575 | 3300005467 | Bacteria | 1976 |
| 54 | Ga0070707_100000045 | 3300005468 | Bacteria | 106487 |
| 55 | Ga0070707_100006816 | 3300005468 | Bacteria | 10579 |
| 56 | Ga0070707_100013735 | 3300005468 | Bacteria | 7583 |
| 57 | Ga0070707_100022535 | 3300005468 | Bacteria | 5954 |
| 58 | Ga0070707_100023166 | 3300005468 | Bacteria | 5874 |
| 59 | Ga0070707_100159444 | 3300005468 | Bacteria | 2198 |
| 60 | Ga0070698_100002158 | 3300005471 | Bacteria | 21843 |
| 61 | Ga0070698_100012022 | 3300005471 | Bacteria | 9177 |
| 62 | Ga0070698_100051081 | 3300005471 | Bacteria | 4212 |
| 63 | Ga0070698_100077257 | 3300005471 | Bacteria | 3329 |
| 64 | Ga0070698_100080457 | 3300005471 | Bacteria | 3253 |
| 65 | Ga0070698_100134799 | 3300005471 | Bacteria | 2424 |
| 66 | Ga0070698_100137108 | 3300005471 | Bacteria | 2400 |
| 67 | Ga0070699_100001557 | 3300005518 | Bacteria | 20982 |
| 68 | Ga0070699_100002982 | 3300005518 | Bacteria | 15032 |
| 69 | Ga0070699_100004839 | 3300005518 | Bacteria | 11879 |
| 70 | Ga0070699_100009207 | 3300005518 | Bacteria | 8562 |
| 71 | Ga0070699_100044011 | 3300005518 | Bacteria | 3864 |
| 72 | Ga0070699_100049357 | 3300005518 | Bacteria | 3642 |
| 73 | Ga0070699_100071779 | 3300005518 | Bacteria | 3012 |
| 74 | Ga0070699_100113368 | 3300005518 | Bacteria | 2382 |
| 75 | Ga0070699_100175259 | 3300005518 | Bacteria | 1901 |
| 76 | Ga0070699_100270689 | 3300005518 | Bacteria | 1520 |
| 77 | Ga0070699_100351971 | 3300005518 | Bacteria | 1327 |
| 78 | Ga0070699_100392168 | 3300005518 | Bacteria | 1255 |
| 79 | Ga0070679_100000835 | 3300005530 | Bacteria | 26788 |
| 80 | Ga0070679_100038328 | 3300005530 | Bacteria | 4764 |
| 81 | Ga0070684_100137639 | 3300005535 | Bacteria | 2207 |
| 82 | Ga0070684_100440174 | 3300005535 | Bacteria | 1204 |
| 83 | Ga0070697_100001314 | 3300005536 | Bacteria | 18777 |
| 84 | Ga0070697_100028520 | 3300005536 | Bacteria | 4470 |
| 85 | Ga0070697_100035944 | 3300005536 | Bacteria | 3999 |
| 86 | Ga0070697_100131419 | 3300005536 | Bacteria | 2100 |
| 87 | Ga0070697_100145624 | 3300005536 | Bacteria | 1994 |
| 88 | Ga0070697_100148064 | 3300005536 | Bacteria | 1977 |
| 89 | Ga0070697_100180457 | 3300005536 | Bacteria | 1789 |
| 90 | Ga0070697_100205289 | 3300005536 | Bacteria | 1676 |
| 91 | Ga0070697_100301228 | 3300005536 | Bacteria | 1378 |
| 92 | Ga0068853_100104395 | 3300005539 | Bacteria | 2509 |
| 93 | Ga0070695_100024430 | 3300005545 | Bacteria | 3723 |
| 94 | Ga0070695_100035005 | 3300005545 | Bacteria | 3153 |
| 95 | Ga0070695_100156100 | 3300005545 | Bacteria | 1597 |
| 96 | Ga0070696_100016442 | 3300005546 | Bacteria | 4982 |
| 97 | Ga0070696_100025301 | 3300005546 | Bacteria | 4034 |
| 98 | Ga0070696_100046391 | 3300005546 | Bacteria | 3013 |
| 99 | Ga0070696_100104612 | 3300005546 | Bacteria | 2033 |
| 100 | Ga0070696_100110518 | 3300005546 | Bacteria | 1979 |
| 101 | Ga0070696_100131459 | 3300005546 | Bacteria | 1821 |
| 102 | Ga0070696_100132797 | 3300005546 | Bacteria | 1813 |
| 103 | Ga0070696_100169631 | 3300005546 | Bacteria | 1612 |
| 104 | Ga0070696_100172075 | 3300005546 | Bacteria | 1601 |
| 105 | Ga0070704_100001281 | 3300005549 | Bacteria | 13282 |
| 106 | Ga0070704_100009376 | 3300005549 | Bacteria | 5911 |
| 107 | Ga0070704_100546313 | 3300005549 | Unclassified | 1012 |
| 108 | Ga0068855_100259558 | 3300005563 | Bacteria | 1936 |
| 109 | Ga0068855_100329260 | 3300005563 | Bacteria | 1686 |
| 110 | Ga0070664_100018737 | 3300005564 | Bacteria | 5693 |
| 111 | Ga0070664_100039669 | 3300005564 | Bacteria | 3968 |
| 112 | Ga0070664_100048786 | 3300005564 | Bacteria | 3579 |
| 113 | Ga0070664_100060725 | 3300005564 | Bacteria | 3220 |
| 114 | Ga0070664_100332565 | 3300005564 | Bacteria | 1378 |
| 115 | Ga0068857_100082844 | 3300005577 | Bacteria | 2866 |
| 116 | Ga0068857_100296379 | 3300005577 | Bacteria | 1490 |
| 117 | Ga0068857_100358341 | 3300005577 | Bacteria | 1352 |
| 118 | Ga0068856_100000473 | 3300005614 | Bacteria | 44407 |
| 119 | Ga0068856_100003024 | 3300005614 | Bacteria | 17232 |
| 120 | Ga0068852_100003713 | 3300005616 | Bacteria | 10697 |
| 121 | Ga0068859_100037658 | 3300005617 | Bacteria | 4854 |
| 122 | Ga0068859_100144853 | 3300005617 | Bacteria | 2450 |
| 123 | Ga0068859_100371247 | 3300005617 | Bacteria | 1526 |
| 124 | Ga0068861_100059682 | 3300005719 | Bacteria | 2921 |
| 125 | Ga0068863_100037968 | 3300005841 | Bacteria | 4584 |
| 126 | Ga0068863_100103833 | 3300005841 | Bacteria | 2703 |
| 127 | Ga0068863_100105987 | 3300005841 | Bacteria | 2674 |
| 128 | Ga0068862_100123682 | 3300005844 | Bacteria | 2282 |
| 129 | Ga0068862_100136793 | 3300005844 | Bacteria | 2172 |
| 130 | Ga0081455_10009457 | 3300005937 | Bacteria | 10026 |
| 131 | Ga0081455_10013960 | 3300005937 | Bacteria | 7896 |
| 132 | Ga0081538_10094815 | 3300005981 | Bacteria | 1527 |
| 133 | Ga0081540_1012288 | 3300005983 | Bacteria | 5652 |
| 134 | Ga0081539_10000165 | 3300005985 | Bacteria | 153824 |
| 135 | Ga0075365_10068373 | 3300006038 | Bacteria | 2387 |
| 136 | Ga0097621_100001261 | 3300006237 | Bacteria | 17505 |
| 137 | Ga0068871_100000595 | 3300006358 | Bacteria | 24865 |
| 138 | Ga0075428_100021270 | 3300006844 | Bacteria | 7184 |
| 139 | Ga0075428_100060213 | 3300006844 | Unclassified | 4158 |
| 140 | Ga0075428_100075578 | 3300006844 | Bacteria | 3678 |
| 141 | Ga0075428_100223257 | 3300006844 | Bacteria | 2034 |
| 142 | Ga0075428_100300955 | 3300006844 | Bacteria | 1724 |
| 143 | Ga0075428_100396734 | 3300006844 | Bacteria | 1479 |
| 144 | Ga0075428_100582826 | 3300006844 | Bacteria | 1195 |
| 145 | Ga0075430_100159235 | 3300006846 | Bacteria | 1879 |
| 146 | Ga0075430_100188162 | 3300006846 | Bacteria | 1716 |
| 147 | Ga0075430_100232029 | 3300006846 | Bacteria | 1530 |
| 148 | Ga0075430_100272011 | 3300006846 | Bacteria | 1402 |
| 149 | Ga0075431_100003197 | 3300006847 | Bacteria | 15840 |
| 150 | Ga0075431_100092611 | 3300006847 | Bacteria | 3120 |
| 151 | Ga0075431_100119848 | 3300006847 | Bacteria | 2715 |
| 152 | Ga0075433_10017655 | 3300006852 | Bacteria | 5918 |
| 153 | Ga0075433_10020618 | 3300006852 | Bacteria | 5516 |
| 154 | Ga0075433_10026609 | 3300006852 | Bacteria | 4900 |
| 155 | Ga0075433_10042875 | 3300006852 | Bacteria | 3927 |
| 156 | Ga0075434_100001332 | 3300006871 | Bacteria | 20677 |
| 157 | Ga0075434_100001798 | 3300006871 | Bacteria | 18527 |
| 158 | Ga0075434_100003487 | 3300006871 | Bacteria | 14068 |
| 159 | Ga0075434_100088339 | 3300006871 | Bacteria | 3101 |
| 160 | Ga0075434_100112272 | 3300006871 | Bacteria | 2737 |
| 161 | Ga0075434_100163467 | 3300006871 | Bacteria | 2246 |
| 162 | Ga0075434_100275978 | 3300006871 | Bacteria | 1700 |
| 163 | Ga0075434_100343304 | 3300006871 | Unclassified | 1514 |
| 164 | Ga0075429_100002455 | 3300006880 | Bacteria | 15595 |
| 165 | Ga0075429_100031893 | 3300006880 | Bacteria | 4581 |
| 166 | Ga0068865_100011650 | 3300006881 | Bacteria | 5510 |
| 167 | Ga0068865_100095624 | 3300006881 | Bacteria | 2165 |
| 168 | Ga0075436_100120776 | 3300006914 | Bacteria | 1833 |
| 169 | Ga0097620_100037660 | 3300006931 | Bacteria | 4854 |
| 170 | Ga0097620_100144853 | 3300006931 | Bacteria | 2450 |
| 171 | Ga0097620_100371246 | 3300006931 | Bacteria | 1526 |
| 172 | Ga0075435_100073387 | 3300007076 | Bacteria | 2797 |
| 173 | Ga0075435_100125847 | 3300007076 | Bacteria | 2142 |
| 174 | Ga0099794_10054272 | 3300007265 | Bacteria | 1934 |
| 175 | Ga0099795_10032439 | 3300007788 | Bacteria | 1806 |
| 176 | Ga0105240_10041597 | 3300009093 | Bacteria | 5864 |
| 177 | Ga0105240_10250305 | 3300009093 | Bacteria | 2050 |
| 178 | Ga0105240_10716734 | 3300009093 | Bacteria | 1090 |
| 179 | Ga0111539_10140445 | 3300009094 | Bacteria | 2828 |
| 180 | Ga0111539_10191418 | 3300009094 | Bacteria | 2387 |
| 181 | Ga0105245_10199749 | 3300009098 | Bacteria | 1920 |
| 182 | Ga0114129_10000471 | 3300009147 | Bacteria | 48410 |
| 183 | Ga0114129_10004244 | 3300009147 | Bacteria | 20246 |
| 184 | Ga0114129_10011573 | 3300009147 | Bacteria | 12561 |
| 185 | Ga0114129_10012802 | 3300009147 | Bacteria | 11939 |
| 186 | Ga0114129_10013955 | 3300009147 | Bacteria | 11446 |
| 187 | Ga0114129_10060823 | 3300009147 | Bacteria | 5280 |
| 188 | Ga0114129_10119826 | 3300009147 | Bacteria | 3624 |
| 189 | Ga0114129_10199460 | 3300009147 | Bacteria | 2711 |
| 190 | Ga0114129_10214100 | 3300009147 | Unclassified | 2603 |
| 191 | Ga0114129_10298367 | 3300009147 | Bacteria | 2149 |
| 192 | Ga0114129_10302777 | 3300009147 | Bacteria | 2130 |
| 193 | Ga0114129_10423889 | 3300009147 | Bacteria | 1750 |
| 194 | Ga0114129_10633964 | 3300009147 | Bacteria | 1381 |
| 195 | Ga0114129_10758921 | 3300009147 | Bacteria | 1241 |
| 196 | Ga0114129_10924821 | 3300009147 | Bacteria | 1103 |
| 197 | Ga0105243_10067097 | 3300009148 | Bacteria | 2887 |
| 198 | Ga0105241_10109328 | 3300009174 | Bacteria | 2211 |
| 199 | Ga0105242_10107827 | 3300009176 | Bacteria | 2370 |
| 200 | Ga0105242_10321417 | 3300009176 | Bacteria | 1419 |
| 201 | Ga0105248_10058087 | 3300009177 | Bacteria | 4344 |
| 202 | Ga0105248_10115325 | 3300009177 | Bacteria | 3030 |
| 203 | Ga0105248_10940561 | 3300009177 | Bacteria | 976 |
| 204 | Ga0105238_10113345 | 3300009551 | Bacteria | 2691 |
| 205 | Ga0105249_10047816 | 3300009553 | Bacteria | 3899 |
| 206 | Ga0105249_10082000 | 3300009553 | Bacteria | 3000 |
| 207 | Ga0105249_10199025 | 3300009553 | Bacteria | 1960 |
| 208 | Ga0105249_10259414 | 3300009553 | Bacteria | 1726 |
| 209 | Ga0105239_10045653 | 3300010375 | Bacteria | 4802 |
| 210 | Ga0105246_10095480 | 3300011119 | Bacteria | 2153 |
| 211 | Ga0157370_10184222 | 3300013104 | Bacteria | 1939 |
| 212 | Ga0157370_10260508 | 3300013104 | Bacteria | 1603 |
| 213 | Ga0157369_10330011 | 3300013105 | Bacteria | 1585 |
| 214 | Ga0157378_10014580 | 3300013297 | Bacteria | 6882 |
| 215 | Ga0163162_10018625 | 3300013306 | Bacteria | 6803 |
| 216 | Ga0157372_10099038 | 3300013307 | Bacteria | 3325 |
| 217 | Ga0157372_10145147 | 3300013307 | Bacteria | 2737 |
| 218 | Ga0157375_10033155 | 3300013308 | Bacteria | 4904 |
| 219 | Ga0163163_10045914 | 3300014325 | Bacteria | 4289 |
| 220 | Ga0163163_10240115 | 3300014325 | Bacteria | 1861 |
| 221 | Ga0157380_10000393 | 3300014326 | Bacteria | 26369 |
| 222 | Ga0157380_10017721 | 3300014326 | Bacteria | 5275 |
| 223 | Ga0157380_10035130 | 3300014326 | Bacteria | 3871 |
| 224 | Ga0157380_10440568 | 3300014326 | Bacteria | 1248 |
| 225 | Ga0157379_10096565 | 3300014968 | Bacteria | 2652 |
| 226 | Ga0163161_10130339 | 3300017792 | Bacteria | 1896 |
| 227 | Ga0163161_10134815 | 3300017792 | Bacteria | 1866 |
| 228 | Ga0213875_10005665 | 3300021388 | Bacteria | 6668 |
| 229 | Ga0213875_10014305 | 3300021388 | Bacteria | 3873 |
| 230 | Ga0207642_10044462 | 3300025899 | Bacteria | 1966 |
| 231 | Ga0207680_10047463 | 3300025903 | Bacteria | 2545 |
| 232 | Ga0207680_10192392 | 3300025903 | Bacteria | 1386 |
| 233 | Ga0207705_10000043 | 3300025909 | Bacteria | 181491 |
| 234 | Ga0207684_10009643 | 3300025910 | Bacteria | 8515 |
| 235 | Ga0207684_10015581 | 3300025910 | Bacteria | 6542 |
| 236 | Ga0207684_10121265 | 3300025910 | Bacteria | 2242 |
| 237 | Ga0207684_10239799 | 3300025910 | Bacteria | 1564 |
| 238 | Ga0207654_10224827 | 3300025911 | Bacteria | 1247 |
| 239 | Ga0207707_10051144 | 3300025912 | Bacteria | 3598 |
| 240 | Ga0207695_10102907 | 3300025913 | Bacteria | 2848 |
| 241 | Ga0207695_10168951 | 3300025913 | Bacteria | 2114 |
| 242 | Ga0207695_10279927 | 3300025913 | Bacteria | 1562 |
| 243 | Ga0207671_10187354 | 3300025914 | Bacteria | 1612 |
| 244 | Ga0207660_10068472 | 3300025917 | Bacteria | 2574 |
| 245 | Ga0207652_10031743 | 3300025921 | Bacteria | 4436 |
| 246 | Ga0207652_10144919 | 3300025921 | Bacteria | 2125 |
| 247 | Ga0207646_10000097 | 3300025922 | Bacteria | 117004 |
| 248 | Ga0207646_10000740 | 3300025922 | Bacteria | 42433 |
| 249 | Ga0207646_10008320 | 3300025922 | Bacteria | 10409 |
| 250 | Ga0207646_10026722 | 3300025922 | Bacteria | 5265 |
| 251 | Ga0207646_10050144 | 3300025922 | Bacteria | 3736 |
| 252 | Ga0207646_10113995 | 3300025922 | Bacteria | 2427 |
| 253 | Ga0207646_10241582 | 3300025922 | Bacteria | 1631 |
| 254 | Ga0207646_10271632 | 3300025922 | Bacteria | 1532 |
| 255 | Ga0207681_10000701 | 3300025923 | Bacteria | 21997 |
| 256 | Ga0207681_10045260 | 3300025923 | Bacteria | 2954 |
| 257 | Ga0207650_10003875 | 3300025925 | Bacteria | 10222 |
| 258 | Ga0207687_10127735 | 3300025927 | Bacteria | 1911 |
| 259 | Ga0207700_10236148 | 3300025928 | Bacteria | 1557 |
| 260 | Ga0207644_10126894 | 3300025931 | Bacteria | 1948 |
| 261 | Ga0207706_10047479 | 3300025933 | Bacteria | 3798 |
| 262 | Ga0207706_10198997 | 3300025933 | Bacteria | 1757 |
| 263 | Ga0207706_10307931 | 3300025933 | Bacteria | 1379 |
| 264 | Ga0207686_10001945 | 3300025934 | Bacteria | 11406 |
| 265 | Ga0207709_10076521 | 3300025935 | Bacteria | 2142 |
| 266 | Ga0207670_10128100 | 3300025936 | Bacteria | 1855 |
| 267 | Ga0207670_10405811 | 3300025936 | Bacteria | 1090 |
| 268 | Ga0207669_10376585 | 3300025937 | Bacteria | 1105 |
| 269 | Ga0207704_10012729 | 3300025938 | Bacteria | 4182 |
| 270 | Ga0207704_10552675 | 3300025938 | Bacteria | 936 |
| 271 | Ga0207691_10275914 | 3300025940 | Bacteria | 1447 |
| 272 | Ga0207711_10085795 | 3300025941 | Bacteria | 2759 |
| 273 | Ga0207711_10114391 | 3300025941 | Bacteria | 2403 |
| 274 | Ga0207689_10000202 | 3300025942 | Bacteria | 52492 |
| 275 | Ga0207689_10026688 | 3300025942 | Bacteria | 4838 |
| 276 | Ga0207661_10063581 | 3300025944 | Bacteria | 2989 |
| 277 | Ga0207661_10374121 | 3300025944 | Bacteria | 1289 |
| 278 | Ga0207679_10024234 | 3300025945 | Bacteria | 4160 |
| 279 | Ga0207679_10025186 | 3300025945 | Bacteria | 4089 |
| 280 | Ga0207679_10322883 | 3300025945 | Bacteria | 1337 |
| 281 | Ga0207667_10002765 | 3300025949 | Bacteria | 21699 |
| 282 | Ga0207712_10060720 | 3300025961 | Bacteria | 2681 |
| 283 | Ga0207712_10218773 | 3300025961 | Bacteria | 1521 |
| 284 | Ga0207668_10082116 | 3300025972 | Bacteria | 2340 |
| 285 | Ga0207668_10230959 | 3300025972 | Bacteria | 1492 |
| 286 | Ga0207677_10124398 | 3300026023 | Bacteria | 1946 |
| 287 | Ga0207703_10417582 | 3300026035 | Bacteria | 1248 |
| 288 | Ga0207639_10041302 | 3300026041 | Bacteria | 3449 |
| 289 | Ga0207639_10254152 | 3300026041 | Bacteria | 1534 |
| 290 | Ga0207678_10021640 | 3300026067 | Bacteria | 5639 |
| 291 | Ga0207678_10059162 | 3300026067 | Bacteria | 3297 |
| 292 | Ga0207708_10085564 | 3300026075 | Bacteria | 2425 |
| 293 | Ga0207708_10343866 | 3300026075 | Bacteria | 1222 |
| 294 | Ga0207702_10000240 | 3300026078 | Bacteria | 63855 |
| 295 | Ga0207641_10023735 | 3300026088 | Bacteria | 5054 |
| 296 | Ga0207641_10091721 | 3300026088 | Bacteria | 2659 |
| 297 | Ga0207641_10291233 | 3300026088 | Bacteria | 1539 |
| 298 | Ga0207648_10010403 | 3300026089 | Bacteria | 8820 |
| 299 | Ga0207648_10200981 | 3300026089 | Bacteria | 1767 |
| 300 | Ga0207676_10151076 | 3300026095 | Bacteria | 2000 |
| 301 | Ga0207674_10304519 | 3300026116 | Bacteria | 1543 |
| 302 | Ga0207675_100054009 | 3300026118 | Bacteria | 3748 |
| 303 | Ga0207675_100203857 | 3300026118 | Bacteria | 1900 |
| 304 | Ga0207675_100366535 | 3300026118 | Bacteria | 1414 |
| 305 | Ga0207428_10414976 | 3300027907 | Bacteria | 984 |
| 306 | Ga0268265_10010200 | 3300028380 | Bacteria | 6342 |
| 307 | Ga0268265_10268609 | 3300028380 | Bacteria | 1520 |
| 308 | Ga0268264_10000313 | 3300028381 | Bacteria | 77820 |
| 309 | Ga0268264_10046604 | 3300028381 | Bacteria | 3601 |
| 310 | Ga0265319_1001893 | 3300028563 | Bacteria | 11884 |
| 311 | Ga0265318_10000482 | 3300028577 | Bacteria | 29443 |
| 312 | Ga0265323_10008541 | 3300028653 | Bacteria | 4219 |
| 313 | Ga0265323_10015393 | 3300028653 | Bacteria | 3010 |
| 314 | Ga0265336_10015875 | 3300028666 | Bacteria | 2469 |
| 315 | Ga0265338_10006303 | 3300028800 | Bacteria | 15169 |
| 316 | Ga0265338_10014520 | 3300028800 | Bacteria | 8754 |
| 317 | Ga0265330_10079653 | 3300031235 | Bacteria | 1412 |
| 318 | Ga0265332_10029308 | 3300031238 | Bacteria | 2406 |
| 319 | Ga0265328_10076421 | 3300031239 | Bacteria | 1232 |
| 320 | Ga0265320_10002844 | 3300031240 | Bacteria | 11872 |
| 321 | Ga0265325_10000151 | 3300031241 | Bacteria | 49073 |
| 322 | Ga0265325_10019595 | 3300031241 | Bacteria | 3737 |
| 323 | Ga0265325_10027534 | 3300031241 | Bacteria | 3072 |
| 324 | Ga0265325_10047893 | 3300031241 | Bacteria | 2211 |
| 325 | Ga0265329_10000298 | 3300031242 | Bacteria | 26164 |
| 326 | Ga0265329_10021114 | 3300031242 | Bacteria | 2190 |
| 327 | Ga0265340_10000343 | 3300031247 | Bacteria | 24742 |
| 328 | Ga0265340_10100617 | 3300031247 | Bacteria | 1343 |
| 329 | Ga0265339_10000181 | 3300031249 | Bacteria | 53469 |
| 330 | Ga0265339_10003110 | 3300031249 | Bacteria | 11682 |
| 331 | Ga0265339_10004898 | 3300031249 | Bacteria | 9030 |
| 332 | Ga0265331_10000166 | 3300031250 | Bacteria | 81796 |
| 333 | Ga0265331_10000242 | 3300031250 | Bacteria | 65281 |
| 334 | Ga0265331_10004533 | 3300031250 | Bacteria | 8664 |
| 335 | Ga0265331_10069586 | 3300031250 | Bacteria | 1648 |
| 336 | Ga0265327_10118379 | 3300031251 | Bacteria | 1258 |
| 337 | Ga0265316_10000307 | 3300031344 | Bacteria | 54686 |
| 338 | Ga0265316_10007106 | 3300031344 | Bacteria | 10589 |
| 339 | Ga0265316_10019496 | 3300031344 | Bacteria | 5800 |
| 340 | Ga0265316_10020960 | 3300031344 | Bacteria | 5549 |
| 341 | Ga0265316_10076300 | 3300031344 | Bacteria | 2575 |
| 342 | Ga0265316_10083639 | 3300031344 | Archaea | 2445 |
| 343 | Ga0265316_10208632 | 3300031344 | Bacteria | 1446 |
| 344 | Ga0307513_10067162 | 3300031456 | Bacteria | 3764 |
| 345 | Ga0307408_100000053 | 3300031548 | Bacteria | 147370 |
| 346 | Ga0307408_100017422 | 3300031548 | Bacteria | 4807 |
| 347 | Ga0307408_100071812 | 3300031548 | Bacteria | 2561 |
| 348 | Ga0307408_100073455 | 3300031548 | Bacteria | 2535 |
| 349 | Ga0307408_100100811 | 3300031548 | Bacteria | 2200 |
| 350 | Ga0265313_10000750 | 3300031595 | Bacteria | 33181 |
| 351 | Ga0265313_10005800 | 3300031595 | Bacteria | 8973 |
| 352 | Ga0265313_10015109 | 3300031595 | Bacteria | 4519 |
| 353 | Ga0265314_10000290 | 3300031711 | Bacteria | 72189 |
| 354 | Ga0265314_10007990 | 3300031711 | Bacteria | 9123 |
| 355 | Ga0265314_10017022 | 3300031711 | Bacteria | 5717 |
| 356 | Ga0265314_10038229 | 3300031711 | Bacteria | 3470 |
| 357 | Ga0265342_10004248 | 3300031712 | Bacteria | 11352 |
| 358 | Ga0265342_10046962 | 3300031712 | Bacteria | 2593 |
| 359 | Ga0265342_10112734 | 3300031712 | Bacteria | 1538 |
| 360 | Ga0316576_10000272 | 3300031727 | Bacteria | 22632 |
| 361 | Ga0307405_10235415 | 3300031731 | Bacteria | 1353 |
| 362 | Ga0307413_10003883 | 3300031824 | Bacteria | 6390 |
| 363 | Ga0307413_10004983 | 3300031824 | Bacteria | 5858 |
| 364 | Ga0307413_10022501 | 3300031824 | Bacteria | 3399 |
| 365 | Ga0307413_10040716 | 3300031824 | Bacteria | 2714 |
| 366 | Ga0307413_10160687 | 3300031824 | Bacteria | 1578 |
| 367 | Ga0307413_10322065 | 3300031824 | Bacteria | 1181 |
| 368 | Ga0307413_10331281 | 3300031824 | Bacteria | 1167 |
| 369 | Ga0307410_10000005 | 3300031852 | Bacteria | 100475 |
| 370 | Ga0307410_10006149 | 3300031852 | Bacteria | 6445 |
| 371 | Ga0307410_10011028 | 3300031852 | Bacteria | 5151 |
| 372 | Ga0307410_10030065 | 3300031852 | Bacteria | 3467 |
| 373 | Ga0307410_10105290 | 3300031852 | Bacteria | 2030 |
| 374 | Ga0307406_10038853 | 3300031901 | Bacteria | 2949 |
| 375 | Ga0307406_10074016 | 3300031901 | Bacteria | 2241 |
| 376 | Ga0307406_10100685 | 3300031901 | Bacteria | 1968 |
| 377 | Ga0307406_10130384 | 3300031901 | Bacteria | 1764 |
| 378 | Ga0307406_10253961 | 3300031901 | Bacteria | 1326 |
| 379 | Ga0307407_10009431 | 3300031903 | Bacteria | 4548 |
| 380 | Ga0307407_10096532 | 3300031903 | Bacteria | 1824 |
| 381 | Ga0307407_10194853 | 3300031903 | Bacteria | 1353 |
| 382 | Ga0307412_10080464 | 3300031911 | Bacteria | 2251 |
| 383 | Ga0307412_10170706 | 3300031911 | Bacteria | 1626 |
| 384 | Ga0307409_100006205 | 3300031995 | Bacteria | 6994 |
| 385 | Ga0307409_100036371 | 3300031995 | Bacteria | 3618 |
| 386 | Ga0307409_100066195 | 3300031995 | Bacteria | 2848 |
| 387 | Ga0307409_100120729 | 3300031995 | Bacteria | 2219 |
| 388 | Ga0307409_100135961 | 3300031995 | Bacteria | 2109 |
| 389 | Ga0307409_100753931 | 3300031995 | Bacteria | 977 |
| 390 | Ga0307416_100000056 | 3300032002 | Bacteria | 107434 |
| 391 | Ga0307416_100001477 | 3300032002 | Bacteria | 12800 |
| 392 | Ga0307416_100060509 | 3300032002 | Bacteria | 3085 |
| 393 | Ga0307416_100063906 | 3300032002 | Bacteria | 3017 |
| 394 | Ga0307416_100064448 | 3300032002 | Bacteria | 3006 |
| 395 | Ga0307416_100139756 | 3300032002 | Bacteria | 2199 |
| 396 | Ga0307416_100200817 | 3300032002 | Bacteria | 1891 |
| 397 | Ga0307416_100314145 | 3300032002 | Bacteria | 1565 |
| 398 | Ga0307416_100580491 | 3300032002 | Bacteria | 1198 |
| 399 | Ga0307416_100657989 | 3300032002 | Bacteria | 1133 |
| 400 | Ga0307414_10069695 | 3300032004 | Bacteria | 2529 |
| 401 | Ga0307414_10096990 | 3300032004 | Bacteria | 2207 |
| 402 | Ga0307414_10150634 | 3300032004 | Bacteria | 1835 |
| 403 | Ga0307414_10206197 | 3300032004 | Bacteria | 1603 |
| 404 | Ga0307414_10292698 | 3300032004 | Bacteria | 1373 |
| 405 | Ga0307411_10009060 | 3300032005 | Bacteria | 5207 |
| 406 | Ga0307411_10010998 | 3300032005 | Bacteria | 4857 |
| 407 | Ga0307411_10012258 | 3300032005 | Bacteria | 4668 |
| 408 | Ga0307411_10019008 | 3300032005 | Bacteria | 3958 |
| 409 | Ga0307411_10020253 | 3300032005 | Bacteria | 3864 |
| 410 | Ga0307411_10056162 | 3300032005 | Bacteria | 2594 |
| 411 | Ga0307411_10068306 | 3300032005 | Bacteria | 2395 |
| 412 | Ga0307415_100005743 | 3300032126 | Bacteria | 6617 |
| 413 | Ga0307415_100036547 | 3300032126 | Bacteria | 3219 |
| 414 | Ga0307415_100087404 | 3300032126 | Bacteria | 2246 |
| 415 | Ga0307415_100219804 | 3300032126 | Bacteria | 1522 |
| 416 | Ga0307415_100267532 | 3300032126 | Bacteria | 1398 |
| 417 | Ga0307507_10000152 | 3300033179 | Bacteria | 122095 |
| 418 | Ga0373950_0038798 | 3300034818 | Bacteria | 906 |
| 419 | Ga0373923_0004390 | 3300035111 | Bacteria | 4675 |
| 420 | Ga0373941_0061593 | 3300035115 | Bacteria | 1222 |
| 421 | Ga0373954_0018521 | 3300035118 | Bacteria | 3136 |
| 422 | Ga0373960_0053755 | 3300035121 | Bacteria | 1203 |
| 423 | Ga0373960_0068976 | 3300035121 | Bacteria | 1090 |
| 424 | Ga0373962_0051359 | 3300035242 | Bacteria | 1189 |
| 425 | Ga0373935_0055113 | 3300035692 | Bacteria | 2533 |
| 426 | Ga0373927_0032850 | 3300035695 | Bacteria | 3379 |
| 427 | Ga0373933_0062826 | 3300035724 | Bacteria | 2244 |
| 428 | Ga0373947_0050076 | 3300035725 | Bacteria | 2511 |
| 429 | Ga0373937_0004947 | 3300036401 | Bacteria | 11329 |
| 430 | Ga0373937_0349233 | 3300036401 | Archaea | 1401 |
| 431 | Ga0373925_0094398 | 3300037068 | Bacteria | 2291 |
| 432 | Ga0395899_0000009 | 3300037312 | Bacteria | 538632 |
| 433 | Ga0395899_0000136 | 3300037312 | Bacteria | 112112 |
| 434 | Ga0395900_0000285 | 3300037418 | Bacteria | 75772 |
| 435 | Ga0395900_0143590 | 3300037418 | Bacteria | 2443 |
| 436 | Ga0395898_0000050 | 3300037466 | Bacteria | 283059 |
| 437 | Ga0395905_0205328 | 3300037471 | Bacteria | 1847 |
| 438 | Ga0436364_0562702 | 3300037853 | Bacteria | 2505 |
| 439 | Ga0436364_1300931 | 3300037853 | Bacteria | 9045 |
| 440 | Ga0400483_199042 | 3300039062 | Bacteria | 39689 |
| 441 | Ga0439439_0010185 | 3300041406 | Bacteria | 2245 |
| 442 | Ga0451807_1902692 | 3300041486 | Bacteria | 1136 |
| 443 | Ga0439431_0032748 | 3300041997 | Bacteria | 1297 |
| 444 | Ga0450898_003226 | 3300042134 | Bacteria | 2333 |
| 445 | Ga0439446_0043507 | 3300042156 | Bacteria | 1327 |
| 446 | Ga0439434_0006714 | 3300042435 | Bacteria | 3363 |
| 447 | Ga0451577_0011905 | 3300042876 | Bacteria | 8203 |
| 448 | Ga0451577_0040874 | 3300042876 | Bacteria | 4163 |
| 449 | Ga0451577_0123135 | 3300042876 | Bacteria | 2323 |
| 450 | Ga0451577_0131635 | 3300042876 | Bacteria | 2244 |
| 451 | Ga0451577_0172711 | 3300042876 | Bacteria | 1948 |
| 452 | Ga0466969_0026488 | 3300044656 | Bacteria | 2973 |
| 453 | Ga0453683_0018391 | 3300044673 | Bacteria | 4487 |
| 454 | Ga0453683_0085792 | 3300044673 | Bacteria | 1973 |
| 455 | Ga0453684_0000027 | 3300044712 | Bacteria | 778857 |
| 456 | Ga0453684_0136526 | 3300044712 | Bacteria | 2936 |
| 457 | Ga0453684_0306360 | 3300044712 | Bacteria | 1804 |
| 458 | Ga0466957_0012298 | 3300044842 | Bacteria | 4955 |
| 459 | Ga0451576_0515877 | 3300045051 | Bacteria | 1256 |
| 460 | Ga0495592_0009875 | 3300046454 | Bacteria | 7187 |
| 461 | Ga0495603_0327442 | 3300046455 | Bacteria | 879 |
| 462 | Ga0495638_0216794 | 3300046460 | Bacteria | 1072 |
| 463 | Ga0495651_0000035 | 3300046462 | Bacteria | 98834 |
| 464 | Ga0495651_0005030 | 3300046462 | Bacteria | 10098 |
| 465 | Ga0495580_0220186 | 3300046472 | Bacteria | 1304 |
| 466 | Ga0495582_0041673 | 3300046473 | Bacteria | 2530 |
| 467 | Ga0495582_0062064 | 3300046473 | Bacteria | 2064 |
| 468 | Ga0495628_0109079 | 3300046516 | Bacteria | 2130 |
| 469 | Ga0495628_0222191 | 3300046516 | Bacteria | 1418 |
| 470 | Ga0495631_0085520 | 3300046518 | Bacteria | 1359 |
| 471 | Ga0495666_0040071 | 3300046526 | Bacteria | 2272 |
| 472 | Ga0495666_0050361 | 3300046526 | Bacteria | 2002 |
| 473 | Ga0495652_0014398 | 3300046529 | Bacteria | 7101 |
| 474 | Ga0495640_0101711 | 3300046533 | Bacteria | 1886 |
| 475 | Ga0495586_0008960 | 3300046535 | Bacteria | 5326 |
| 476 | Ga0495586_0011562 | 3300046535 | Bacteria | 4695 |
| 477 | Ga0495621_0065902 | 3300046539 | Bacteria | 1324 |
| 478 | Ga0495645_0099919 | 3300046543 | Bacteria | 2064 |
| 479 | Ga0495634_0006537 | 3300046642 | Bacteria | 8847 |
| 480 | Ga0495657_0054078 | 3300046675 | Bacteria | 2683 |
| 481 | Ga0495623_0002018 | 3300046679 | Bacteria | 13626 |
| 482 | Ga0495658_0007267 | 3300046683 | Bacteria | 5474 |
| 483 | Ga0495613_0047305 | 3300046689 | Bacteria | 3178 |
| 484 | Ga0495613_0288919 | 3300046689 | Bacteria | 1137 |
| 485 | Ga0495636_0032129 | 3300047318 | Bacteria | 2153 |
| 486 | Ga0495674_0023015 | 3300047319 | Bacteria | 5740 |
| 487 | Ga0495672_0099112 | 3300047320 | Bacteria | 1584 |
| 488 | Ga0495676_0092209 | 3300047321 | Bacteria | 2262 |
| 489 | Ga0495680_0000889 | 3300047322 | Bacteria | 33209 |
| 490 | Ga0495680_0072934 | 3300047322 | Bacteria | 2610 |
| 491 | Ga0495680_0280185 | 3300047322 | Bacteria | 1175 |
| 492 | Ga0495675_0265015 | 3300047444 | Bacteria | 1028 |
| 493 | Ga0496101_0035655 | 3300048904 | Bacteria | 3520 |
| 494 | Ga0496101_0294013 | 3300048904 | Bacteria | 1271 |
| 495 | Ga0496101_0464427 | 3300048904 | Bacteria | 999 |
| 496 | Ga0496102_0007614 | 3300048905 | Bacteria | 9252 |
| 497 | Ga0496102_0248223 | 3300048905 | Bacteria | 1678 |
| 498 | Ga0496102_0314416 | 3300048905 | Bacteria | 1476 |
| 499 | Ga0496102_0411024 | 3300048905 | Bacteria | 1271 |
| 500 | Ga0496103_0075322 | 3300048906 | Bacteria | 2116 |
| 501 | Ga0496104_0007861 | 3300048907 | Bacteria | 9454 |
| 502 | Ga0496104_0014407 | 3300048907 | Bacteria | 7145 |
| 503 | Ga0496104_0080912 | 3300048907 | Bacteria | 3097 |
| 504 | Ga0496104_0192359 | 3300048907 | Bacteria | 1952 |
| 505 | Ga0496106_0027551 | 3300048909 | Bacteria | 4233 |
| 506 | Ga0496106_0322550 | 3300048909 | Bacteria | 1240 |
| 507 | Ga0496108_0000224 | 3300048911 | Bacteria | 50600 |
| 508 | Ga0496108_0002300 | 3300048911 | Bacteria | 15305 |
| 509 | Ga0496109_0002073 | 3300048912 | Bacteria | 16648 |
| 510 | Ga0496109_0004053 | 3300048912 | Bacteria | 12242 |
| 511 | Ga0496109_0057502 | 3300048912 | Bacteria | 3550 |
| 512 | Ga0496109_0087162 | 3300048912 | Bacteria | 2883 |
| 513 | Ga0496110_0122170 | 3300048913 | Bacteria | 2347 |
| 514 | Ga0496110_0309247 | 3300048913 | Bacteria | 1439 |
| 515 | Ga0496111_0038036 | 3300048914 | Bacteria | 3446 |
| 516 | Ga0496111_0043607 | 3300048914 | Bacteria | 3224 |
| 517 | Ga0496111_0073303 | 3300048914 | Bacteria | 2493 |
| 518 | Ga0496111_0369758 | 3300048914 | Bacteria | 1061 |
| 519 | Ga0496112_0000156 | 3300048915 | Bacteria | 42945 |
| 520 | Ga0496112_0026550 | 3300048915 | Bacteria | 5574 |
| 521 | Ga0496112_0163829 | 3300048915 | Bacteria | 2189 |
| 522 | Ga0496112_0255096 | 3300048915 | Bacteria | 1704 |
| 523 | Ga0496113_0000224 | 3300048916 | Bacteria | 26509 |
| 524 | Ga0496113_0007998 | 3300048916 | Bacteria | 6854 |
| 525 | Ga0496113_0008116 | 3300048916 | Bacteria | 6817 |
| 526 | Ga0496113_0021934 | 3300048916 | Bacteria | 4510 |
| 527 | Ga0496114_0205790 | 3300048917 | Bacteria | 1725 |
| 528 | Ga0496126_0016788 | 3300048929 | Bacteria | 7308 |
| 529 | Ga0501292_016632 | 3300049515 | Bacteria | 1158 |
| 530 | Ga0501034_0001775 | 3300049571 | Bacteria | 27580 |
| 531 | Ga0501034_0058886 | 3300049571 | Bacteria | 3859 |
| 532 | Ga0501036_0237211 | 3300049572 | Bacteria | 1530 |
| 533 | Ga0501040_0203242 | 3300049576 | Bacteria | 1407 |
| 534 | Ga0501047_0076683 | 3300049581 | Bacteria | 3217 |
| 535 | Ga0501048_0057854 | 3300049582 | Bacteria | 2749 |
| 536 | Ga0501067_0000266 | 3300049583 | Bacteria | 28520 |
| 537 | Ga0501067_0006188 | 3300049583 | Bacteria | 6636 |
| 538 | Ga0501067_0045569 | 3300049583 | Bacteria | 2435 |
| 539 | Ga0501067_0094932 | 3300049583 | Bacteria | 1656 |
| 540 | Ga0501068_0000448 | 3300049584 | Bacteria | 20972 |
| 541 | Ga0501068_0001329 | 3300049584 | Bacteria | 13102 |
| 542 | Ga0501068_0101261 | 3300049584 | Bacteria | 1786 |
| 543 | Ga0501069_0000254 | 3300049585 | Bacteria | 24126 |
| 544 | Ga0501069_0006987 | 3300049585 | Bacteria | 5905 |
| 545 | Ga0501069_0093653 | 3300049585 | Bacteria | 1700 |
| 546 | Ga0501070_0000849 | 3300049586 | Bacteria | 27734 |
| 547 | Ga0501070_0020097 | 3300049586 | Bacteria | 5600 |
| 548 | Ga0501070_0026790 | 3300049586 | Bacteria | 4835 |
| 549 | Ga0501070_0087909 | 3300049586 | Bacteria | 2572 |
| 550 | Ga0501071_0021298 | 3300049587 | Bacteria | 4512 |
| 551 | Ga0501072_0000338 | 3300049588 | Bacteria | 33400 |
| 552 | Ga0501072_0006050 | 3300049588 | Bacteria | 9233 |
| 553 | Ga0501072_0220539 | 3300049588 | Bacteria | 1511 |
| 554 | Ga0501073_0025230 | 3300049589 | Bacteria | 4265 |
| 555 | Ga0501073_0075109 | 3300049589 | Bacteria | 2352 |
| 556 | Ga0501074_0000589 | 3300049590 | Bacteria | 22567 |
| 557 | Ga0501074_0001294 | 3300049590 | Bacteria | 16594 |
| 558 | Ga0501074_0148413 | 3300049590 | Bacteria | 1677 |
| 559 | Ga0501075_0005544 | 3300049591 | Bacteria | 8637 |
| 560 | Ga0501076_0011564 | 3300049592 | Bacteria | 6581 |
| 561 | Ga0501076_0055266 | 3300049592 | Bacteria | 3149 |
| 562 | Ga0501077_0002046 | 3300049593 | Bacteria | 12165 |
| 563 | Ga0501077_0018620 | 3300049593 | Bacteria | 4391 |
| 564 | Ga0501199_003270 | 3300049650 | Bacteria | 1547 |
| 565 | Ga0501201_008705 | 3300049651 | Bacteria | 981 |
| 566 | Ga0501208_008618 | 3300049655 | Bacteria | 1382 |
| 567 | Ga0501209_001936 | 3300049656 | Bacteria | 3064 |
| 568 | Ga0501216_005549 | 3300049660 | Bacteria | 1907 |
| 569 | Ga0501216_011090 | 3300049660 | Bacteria | 1459 |
| 570 | Ga0501233_006893 | 3300049668 | Bacteria | 2149 |
| 571 | Ga0501239_010435 | 3300049672 | Bacteria | 1024 |
| 572 | Ga0501249_026299 | 3300049679 | Bacteria | 1286 |
| 573 | Ga0501249_031080 | 3300049679 | Bacteria | 1190 |
| 574 | Ga0501225_0015941 | 3300049705 | Bacteria | 2089 |
| 575 | Ga0501225_0020393 | 3300049705 | Bacteria | 1832 |
| 576 | Ga0501229_003620 | 3300049706 | Bacteria | 1855 |
| 577 | Ga0501234_004987 | 3300049707 | Bacteria | 2085 |
| 578 | Ga0501234_013368 | 3300049707 | Bacteria | 1288 |
| 579 | Ga0501245_005297 | 3300049708 | Bacteria | 1784 |
| 580 | Ga0501079_0039768 | 3300049741 | Bacteria | 3628 |
| 581 | Ga0501079_0051569 | 3300049741 | Bacteria | 3177 |
| 582 | Ga0501079_0179144 | 3300049741 | Bacteria | 1654 |
| 583 | Ga0501080_0001482 | 3300049742 | Bacteria | 19788 |
| 584 | Ga0501080_0067088 | 3300049742 | Bacteria | 3337 |
| 585 | Ga0501080_0068702 | 3300049742 | Bacteria | 3296 |
| 586 | Ga0501080_0120587 | 3300049742 | Bacteria | 2430 |
| 587 | Ga0501080_0318214 | 3300049742 | Bacteria | 1409 |
| 588 | Ga0501081_0015656 | 3300049743 | Bacteria | 5005 |
| 589 | Ga0501081_0016245 | 3300049743 | Bacteria | 4919 |
| 590 | Ga0501081_0159499 | 3300049743 | Bacteria | 1625 |
| 591 | Ga0501081_0337023 | 3300049743 | Bacteria | 1110 |
| 592 | Ga0501083_0000370 | 3300049744 | Bacteria | 28443 |
| 593 | Ga0501083_0000654 | 3300049744 | Bacteria | 22433 |
| 594 | Ga0501083_0265812 | 3300049744 | Bacteria | 1116 |
| 595 | Ga0501263_011756 | 3300049760 | Bacteria | 1090 |
| 596 | Ga0501268_000526 | 3300049765 | Bacteria | 4211 |
| 597 | Ga0501270_006166 | 3300049767 | Bacteria | 1427 |
| 598 | Ga0501273_000813 | 3300049770 | Bacteria | 2717 |
| 599 | Ga0501283_002694 | 3300049779 | Bacteria | 2317 |
| 600 | Ga0501045_0128562 | 3300049824 | Bacteria | 1883 |
| 601 | Ga0501045_0148882 | 3300049824 | Bacteria | 1741 |
| 602 | Ga0501212_012411 | 3300049851 | Bacteria | 1239 |
| 603 | nmdc:mga00v17_56834_c1 | 3300050491 | Bacteria | 2392 |
| 604 | nmdc:mga07m45_15486_c1 | 3300050496 | Bacteria | 4072 |
| 605 | nmdc:mga05p37_101647_c1 | 3300050507 | Bacteria | 3539 |
| 606 | nmdc:mga05p37_10736_c1 | 3300050507 | Bacteria | 10872 |
| 607 | nmdc:mga05p37_238652_c1 | 3300050507 | Bacteria | 2187 |
| 608 | nmdc:mga05p37_312747_c1 | 3300050507 | Bacteria | 1861 |
| 609 | nmdc:mga05p37_317600_c1 | 3300050507 | Bacteria | 1845 |
| 610 | nmdc:mga05p37_7556_c1 | 3300050507 | Bacteria | 12818 |
| 611 | nmdc:mga05p37_94120_c1 | 3300050507 | Bacteria | 3692 |
| 612 | nmdc:mga09592_13286_c1 | 3300050508 | Bacteria | 6724 |
| 613 | nmdc:mga0qj67_147845_c1 | 3300050509 | Bacteria | 1905 |
| 614 | nmdc:mga0qj67_274559_c1 | 3300050509 | Bacteria | 1366 |
| 615 | nmdc:mga0qj67_31390_c1 | 3300050509 | Bacteria | 4138 |
| 616 | nmdc:mga06r32_112098_c1 | 3300050510 | Bacteria | 2684 |
| 617 | nmdc:mga06r32_131982_c1 | 3300050510 | Bacteria | 2470 |
| 618 | nmdc:mga06r32_218158_c1 | 3300050510 | Bacteria | 1895 |
| 619 | nmdc:mga08y16_13403_c1 | 3300050511 | Bacteria | 8624 |
| 620 | nmdc:mga08y16_190878_c1 | 3300050511 | Unclassified | 2125 |
| 621 | nmdc:mga08y16_213254_c1 | 3300050511 | Bacteria | 1999 |
| 622 | nmdc:mga08y16_484293_c1 | 3300050511 | Bacteria | 1258 |
| 623 | nmdc:mga08y16_85639_c1 | 3300050511 | Bacteria | 3284 |
| 624 | nmdc:mga0n895_106591_c1 | 3300050512 | Bacteria | 2815 |
| 625 | nmdc:mga0n895_19669_c1 | 3300050512 | Bacteria | 6278 |
| 626 | nmdc:mga0n895_2630_c1 | 3300050512 | Bacteria | 14145 |
| 627 | nmdc:mga0n895_289453_c1 | 3300050512 | Bacteria | 1661 |
| 628 | nmdc:mga0n895_290604_c1 | 3300050512 | Bacteria | 1657 |
| 629 | nmdc:mga0n895_307485_c1 | 3300050512 | Bacteria | 1607 |
| 630 | nmdc:mga0n895_312730_c1 | 3300050512 | Bacteria | 1592 |
| 631 | nmdc:mga0n895_31439_c1 | 3300050512 | Bacteria | 5083 |
| 632 | nmdc:mga0n895_337512_c1 | 3300050512 | Unclassified | 1527 |
| 633 | nmdc:mga0rr50_136987_c1 | 3300050513 | Bacteria | 1966 |
| 634 | nmdc:mga0rr50_18577_c1 | 3300050513 | Bacteria | 4673 |
| 635 | nmdc:mga0rr50_186044_c1 | 3300050513 | Bacteria | 1700 |
| 636 | nmdc:mga0rr50_334742_c1 | 3300050513 | Bacteria | 1271 |
| 637 | nmdc:mga0rr50_36845_c1 | 3300050513 | Bacteria | 3525 |
| 638 | nmdc:mga08x19_281376_c1 | 3300050514 | Bacteria | 1153 |
| 639 | nmdc:mga0a205_150730_c1 | 3300050515 | Bacteria | 2225 |
| 640 | nmdc:mga0a205_155141_c1 | 3300050515 | Bacteria | 2188 |
| 641 | nmdc:mga0a205_351_c1 | 3300050515 | Bacteria | 34832 |
| 642 | nmdc:mga0a205_75931_c1 | 3300050515 | Bacteria | 3247 |
| 643 | nmdc:mga0a205_75960_c1 | 3300050515 | Bacteria | 3246 |
| 644 | nmdc:mga0a205_8693_c1 | 3300050515 | Bacteria | 9246 |
| 645 | Ga0495601_0250737 | 3300053077 | Bacteria | 1156 |
| 646 | Ga0495612_0001806 | 3300053078 | Bacteria | 8763 |
| 647 | Ga0495619_0037272 | 3300053085 | Bacteria | 3167 |
| 648 | Ga0500583_0004418 | 3300053092 | Bacteria | 4580 |
| 649 | Ga0500568_0036467 | 3300053139 | Bacteria | 2001 |
| 650 | Ga0500616_0000226 | 3300053153 | Bacteria | 88101 |
| 651 | Ga0500622_0023559 | 3300053156 | Bacteria | 3260 |
| 652 | Ga0501084_0001921 | 3300054114 | Bacteria | 16601 |
| 653 | Ga0501084_0023363 | 3300054114 | Bacteria | 5161 |
| 654 | Ga0501084_0058663 | 3300054114 | Bacteria | 3220 |
| 655 | Ga0590071_001110 | 3300059421 | Bacteria | 7286 |
| 656 | Ga0590071_007573 | 3300059421 | Bacteria | 2570 |
| 657 | Ga0590071_017193 | 3300059421 | Bacteria | 1698 |
| 658 | Ga0590077_006863 | 3300059426 | Bacteria | 2333 |
| 659 | Ga0501082_0000782 | 3300060353 | Bacteria | 27952 |
| 660 | Ga0501082_0053584 | 3300060353 | Bacteria | 3476 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100035944 | Ga0070697_1000359442 | 262 |
| 2 | 3300005445 | Ga0070708_100064266 | Ga0070708_1000642663 | 266 |
| 3 | 3300005518 | Ga0070699_100113368 | Ga0070699_1001133682 | 266 |
| 4 | 3300050515 | nmdc:mga0a205_75960_c1 | nmdc:mga0a205_75960_c1_1546_2358 | 266 |
| 5 | 3300025938 | Ga0207704_10552675 | Ga0207704_105526751 | 267 |
| 6 | 3300048914 | Ga0496111_0369758 | Ga0496111_0369758_26_841 | 267 |
| 7 | 3300034818 | Ga0373950_0038798 | Ga0373950_0038798_39_869 | 272 |
| 8 | 3300005445 | Ga0070708_100111663 | Ga0070708_1001116632 | 273 |
| 9 | 3300005468 | Ga0070707_100023166 | Ga0070707_1000231665 | 273 |
| 10 | 3300005536 | Ga0070697_100145624 | Ga0070697_1001456242 | 273 |
| 11 | 3300006871 | Ga0075434_100088339 | Ga0075434_1000883392 | 273 |
| 12 | 3300025922 | Ga0207646_10113995 | Ga0207646_101139953 | 273 |
| 13 | 3300050512 | nmdc:mga0n895_312730_c1 | nmdc:mga0n895_312730_c1_443_1285 | 273 |
| 14 | 3300005563 | Ga0068855_100259558 | Ga0068855_1002595581 | 274 |
| 15 | 3300006844 | Ga0075428_100060213 | Ga0075428_1000602133 | 274 |
| 16 | 3300006852 | Ga0075433_10020618 | Ga0075433_100206184 | 274 |
| 17 | 3300006871 | Ga0075434_100343304 | Ga0075434_1003433041 | 274 |
| 18 | 3300009094 | Ga0111539_10140445 | Ga0111539_101404452 | 274 |
| 19 | 3300009147 | Ga0114129_10013955 | Ga0114129_100139558 | 274 |
| 20 | 3300027907 | Ga0207428_10414976 | Ga0207428_104149761 | 274 |
| 21 | 3300050511 | nmdc:mga08y16_190878_c1 | nmdc:mga08y16_190878_c1_1000_1845 | 274 |
| 22 | 3300050512 | nmdc:mga0n895_337512_c1 | nmdc:mga0n895_337512_c1_610_1455 | 274 |
| 23 | 3300050513 | nmdc:mga0rr50_18577_c1 | nmdc:mga0rr50_18577_c1_3463_4308 | 274 |
| 24 | 3300050515 | nmdc:mga0a205_8693_c1 | nmdc:mga0a205_8693_c1_7158_8003 | 274 |
| 25 | 3300005518 | Ga0070699_100044011 | Ga0070699_1000440114 | 276 |
| 26 | 3300005535 | Ga0070684_100440174 | Ga0070684_1004401742 | 276 |
| 27 | 3300005536 | Ga0070697_100028520 | Ga0070697_1000285203 | 276 |
| 28 | 3300005545 | Ga0070695_100024430 | Ga0070695_1000244304 | 276 |
| 29 | 3300005546 | Ga0070696_100025301 | Ga0070696_1000253014 | 276 |
| 30 | 3300006871 | Ga0075434_100163467 | Ga0075434_1001634673 | 276 |
| 31 | 3300031901 | Ga0307406_10130384 | Ga0307406_101303841 | 276 |
| 32 | 3300032126 | Ga0307415_100087404 | Ga0307415_1000874042 | 276 |
| 33 | 3300037418 | Ga0395900_0143590 | Ga0395900_0143590_1336_2178 | 276 |
| 34 | 3300049583 | Ga0501067_0094932 | Ga0501067_0094932_640_1482 | 276 |
| 35 | 3300049584 | Ga0501068_0101261 | Ga0501068_0101261_928_1770 | 276 |
| 36 | 3300049591 | Ga0501075_0005544 | Ga0501075_0005544_7778_8620 | 276 |
| 37 | 3300049651 | Ga0501201_008705 | Ga0501201_008705_92_934 | 276 |
| 38 | 3300049707 | Ga0501234_013368 | Ga0501234_013368_47_889 | 276 |
| 39 | 3300049742 | Ga0501080_0068702 | Ga0501080_0068702_458_1300 | 276 |
| 40 | 3300050515 | nmdc:mga0a205_75931_c1 | nmdc:mga0a205_75931_c1_197_1039 | 276 |
| 41 | 3300005441 | Ga0070700_100322806 | Ga0070700_1003228061 | 277 |
| 42 | 3300014326 | Ga0157380_10440568 | Ga0157380_104405681 | 277 |
| 43 | 3300046455 | Ga0495603_0327442 | Ga0495603_0327442_18_863 | 277 |
| 44 | 3300046472 | Ga0495580_0220186 | Ga0495580_0220186_34_879 | 277 |
| 45 | 3300046473 | Ga0495582_0062064 | Ga0495582_0062064_1172_2017 | 277 |
| 46 | 3300046526 | Ga0495666_0040071 | Ga0495666_0040071_1313_2158 | 277 |
| 47 | 3300046533 | Ga0495640_0101711 | Ga0495640_0101711_907_1752 | 277 |
| 48 | 3300046535 | Ga0495586_0011562 | Ga0495586_0011562_2814_3659 | 277 |
| 49 | 3300046642 | Ga0495634_0006537 | Ga0495634_0006537_611_1456 | 277 |
| 50 | 3300046689 | Ga0495613_0288919 | Ga0495613_0288919_248_1093 | 277 |
| 51 | 3300049571 | Ga0501034_0058886 | Ga0501034_0058886_129_977 | 277 |
| 52 | 3300049583 | Ga0501067_0006188 | Ga0501067_0006188_387_1235 | 277 |
| 53 | 3300049584 | Ga0501068_0001329 | Ga0501068_0001329_9090_9938 | 277 |
| 54 | 3300049585 | Ga0501069_0006987 | Ga0501069_0006987_2154_3002 | 277 |
| 55 | 3300049586 | Ga0501070_0020097 | Ga0501070_0020097_2450_3298 | 277 |
| 56 | 3300049587 | Ga0501071_0021298 | Ga0501071_0021298_1105_1953 | 277 |
| 57 | 3300049588 | Ga0501072_0006050 | Ga0501072_0006050_1122_1970 | 277 |
| 58 | 3300049589 | Ga0501073_0025230 | Ga0501073_0025230_978_1826 | 277 |
| 59 | 3300049590 | Ga0501074_0001294 | Ga0501074_0001294_9496_10344 | 277 |
| 60 | 3300049741 | Ga0501079_0039768 | Ga0501079_0039768_457_1305 | 277 |
| 61 | 3300049742 | Ga0501080_0120587 | Ga0501080_0120587_1535_2383 | 277 |
| 62 | 3300049744 | Ga0501083_0000654 | Ga0501083_0000654_12052_12900 | 277 |
| 63 | 3300050512 | nmdc:mga0n895_307485_c1 | nmdc:mga0n895_307485_c1_491_1336 | 277 |
| 64 | 3300050515 | nmdc:mga0a205_351_c1 | nmdc:mga0a205_351_c1_31996_32841 | 277 |
| 65 | 3300054114 | Ga0501084_0001921 | Ga0501084_0001921_6251_7099 | 277 |
| 66 | 3300060353 | Ga0501082_0053584 | Ga0501082_0053584_1544_2392 | 277 |
| 67 | 3300005353 | Ga0070669_100384374 | Ga0070669_1003843741 | 278 |
| 68 | 3300006844 | Ga0075428_100075578 | Ga0075428_1000755783 | 278 |
| 69 | 3300006844 | Ga0075428_100300955 | Ga0075428_1003009552 | 278 |
| 70 | 3300006846 | Ga0075430_100159235 | Ga0075430_1001592352 | 278 |
| 71 | 3300006846 | Ga0075430_100188162 | Ga0075430_1001881622 | 278 |
| 72 | 3300006852 | Ga0075433_10042875 | Ga0075433_100428752 | 278 |
| 73 | 3300006871 | Ga0075434_100003487 | Ga0075434_10000348710 | 278 |
| 74 | 3300006871 | Ga0075434_100112272 | Ga0075434_1001122722 | 278 |
| 75 | 3300006871 | Ga0075434_100275978 | Ga0075434_1002759782 | 278 |
| 76 | 3300007076 | Ga0075435_100073387 | Ga0075435_1000733873 | 278 |
| 77 | 3300009147 | Ga0114129_10214100 | Ga0114129_102141003 | 278 |
| 78 | 3300009147 | Ga0114129_10423889 | Ga0114129_104238892 | 278 |
| 79 | 3300025928 | Ga0207700_10236148 | Ga0207700_102361481 | 278 |
| 80 | 3300035121 | Ga0373960_0053755 | Ga0373960_0053755_71_928 | 278 |
| 81 | 3300035242 | Ga0373962_0051359 | Ga0373962_0051359_31_888 | 278 |
| 82 | 3300036401 | Ga0373937_0349233 | Ga0373937_0349233_353_1210 | 278 |
| 83 | 3300046683 | Ga0495658_0007267 | Ga0495658_0007267_3529_4386 | 278 |
| 84 | 3300050507 | nmdc:mga05p37_317600_c1 | nmdc:mga05p37_317600_c1_335_1192 | 278 |
| 85 | 3300050509 | nmdc:mga0qj67_147845_c1 | nmdc:mga0qj67_147845_c1_492_1349 | 278 |
| 86 | 3300050512 | nmdc:mga0n895_2630_c1 | nmdc:mga0n895_2630_c1_3708_4565 | 278 |
| 87 | 3300050512 | nmdc:mga0n895_289453_c1 | nmdc:mga0n895_289453_c1_288_1145 | 278 |
| 88 | 3300050512 | nmdc:mga0n895_31439_c1 | nmdc:mga0n895_31439_c1_2952_3809 | 278 |
| 89 | 3300050513 | nmdc:mga0rr50_186044_c1 | nmdc:mga0rr50_186044_c1_86_943 | 278 |
| 90 | 3300050515 | nmdc:mga0a205_150730_c1 | nmdc:mga0a205_150730_c1_757_1614 | 278 |
| 91 | 3300005335 | Ga0070666_10068584 | Ga0070666_100685842 | 279 |
| 92 | 3300005535 | Ga0070684_100137639 | Ga0070684_1001376392 | 279 |
| 93 | 3300005564 | Ga0070664_100048786 | Ga0070664_1000487861 | 279 |
| 94 | 3300005616 | Ga0068852_100003713 | Ga0068852_1000037135 | 279 |
| 95 | 3300005841 | Ga0068863_100105987 | Ga0068863_1001059873 | 279 |
| 96 | 3300025903 | Ga0207680_10047463 | Ga0207680_100474632 | 279 |
| 97 | 3300028381 | Ga0268264_10000313 | Ga0268264_1000031347 | 279 |
| 98 | 3300037068 | Ga0373925_0094398 | Ga0373925_0094398_69_953 | 279 |
| 99 | 3300046460 | Ga0495638_0216794 | Ga0495638_0216794_138_983 | 279 |
| 100 | 3300053092 | Ga0500583_0004418 | Ga0500583_0004418_3702_4547 | 279 |
| 101 | 3300053139 | Ga0500568_0036467 | Ga0500568_0036467_763_1608 | 279 |
| 102 | 3300005329 | Ga0070683_100001813 | Ga0070683_10000181313 | 280 |
| 103 | 3300005614 | Ga0068856_100003024 | Ga0068856_1000030242 | 280 |
| 104 | 3300006844 | Ga0075428_100021270 | Ga0075428_1000212704 | 280 |
| 105 | 3300009147 | Ga0114129_10924821 | Ga0114129_109248211 | 280 |
| 106 | 3300050511 | nmdc:mga08y16_13403_c1 | nmdc:mga08y16_13403_c1_3709_4563 | 280 |
| 107 | 3300009147 | Ga0114129_10000471 | Ga0114129_1000047131 | 281 |
| 108 | 3300050507 | nmdc:mga05p37_7556_c1 | nmdc:mga05p37_7556_c1_6641_7498 | 281 |
| 109 | 3300050510 | nmdc:mga06r32_112098_c1 | nmdc:mga06r32_112098_c1_1379_2236 | 281 |
| 110 | 3300050512 | nmdc:mga0n895_19669_c1 | nmdc:mga0n895_19669_c1_1826_2683 | 281 |
| 111 | 3300050513 | nmdc:mga0rr50_136987_c1 | nmdc:mga0rr50_136987_c1_268_1125 | 281 |
| 112 | 3300050515 | nmdc:mga0a205_155141_c1 | nmdc:mga0a205_155141_c1_990_1847 | 281 |
| 113 | 3300005444 | Ga0070694_100360290 | Ga0070694_1003602902 | 282 |
| 114 | 3300009147 | Ga0114129_10012802 | Ga0114129_100128023 | 282 |
| 115 | 3300048905 | Ga0496102_0314416 | Ga0496102_0314416_34_894 | 282 |
| 116 | 3300050512 | nmdc:mga0n895_106591_c1 | nmdc:mga0n895_106591_c1_217_1077 | 282 |
| 117 | 3300053156 | Ga0500622_0023559 | Ga0500622_0023559_1862_2716 | 282 |
| 118 | 3300005536 | Ga0070697_100131419 | Ga0070697_1001314192 | 283 |
| 119 | 3300031852 | Ga0307410_10030065 | Ga0307410_100300653 | 283 |
| 120 | 3300031901 | Ga0307406_10074016 | Ga0307406_100740162 | 283 |
| 121 | 3300031911 | Ga0307412_10170706 | Ga0307412_101707061 | 283 |
| 122 | 3300032004 | Ga0307414_10206197 | Ga0307414_102061972 | 283 |
| 123 | 3300044673 | Ga0453683_0018391 | Ga0453683_0018391_867_1751 | 283 |
| 124 | 3300046462 | Ga0495651_0005030 | Ga0495651_0005030_8979_9842 | 283 |
| 125 | 3300046526 | Ga0495666_0050361 | Ga0495666_0050361_1007_1870 | 283 |
| 126 | iso_pu_bacteria | 2599185184 | 2599479074 | 283 |
| 127 | iso_pu_bacteria | 2852623160 | 2852626785 | 283 |
| 128 | iso_pu_bacteria | 2884933994 | 2884938167 | 283 |
| 129 | iso_pu_bacteria | 2911138879 | 2911142417 | 283 |
| 130 | iso_pu_bacteria | 2919437846 | 2919442747 | 283 |
| 131 | iso_pu_bacteria | 2928078545 | 2928082612 | 283 |
| 132 | iso_pu_bacteria | 2928147474 | 2928148799 | 283 |
| 133 | iso_pu_bacteria | 2977232053 | 2977233910 | 283 |
| 134 | 3300042876 | Ga0451577_0040874 | Ga0451577_0040874_327_1199 | 284 |
| 135 | 3300044712 | Ga0453684_0000027 | Ga0453684_0000027_64376_65248 | 284 |
| 136 | 3300044712 | Ga0453684_0136526 | Ga0453684_0136526_1639_2499 | 284 |
| 137 | 3300025933 | Ga0207706_10198997 | Ga0207706_101989972 | 285 |
| 138 | 3300026067 | Ga0207678_10021640 | Ga0207678_100216404 | 285 |
| 139 | 3300031251 | Ga0265327_10118379 | Ga0265327_101183792 | 285 |
| 140 | 3300037312 | Ga0395899_0000136 | Ga0395899_0000136_105447_106310 | 285 |
| 141 | 3300037853 | Ga0436364_0562702 | Ga0436364_0562702_832_1704 | 285 |
| 142 | 3300044656 | Ga0466969_0026488 | Ga0466969_0026488_1235_2098 | 285 |
| 143 | 3300046516 | Ga0495628_0222191 | Ga0495628_0222191_114_989 | 285 |
| 144 | 3300053077 | Ga0495601_0250737 | Ga0495601_0250737_139_1014 | 285 |
| 145 | 3300053085 | Ga0495619_0037272 | Ga0495619_0037272_1891_2766 | 285 |
| 146 | iso_pu_bacteria | 2585427687 | 2586209844 | 285 |
| 147 | iso_pu_bacteria | 2585428095 | 2587865380 | 285 |
| 148 | iso_pu_bacteria | 2721755487 | 2722729439 | 285 |
| 149 | iso_pu_bacteria | 2738541283 | 2738755614 | 285 |
| 150 | iso_pu_bacteria | 2738541302 | 2738855436 | 285 |
| 151 | iso_pu_bacteria | 2739367651 | 2739588203 | 285 |
| 152 | iso_pu_bacteria | 2739367656 | 2739614014 | 285 |
| 153 | iso_pu_bacteria | 2739367663 | 2739648538 | 285 |
| 154 | iso_pu_bacteria | 2775506987 | 2776615202 | 285 |
| 155 | iso_pu_bacteria | 2818991437 | 2819546167 | 285 |
| 156 | iso_pu_bacteria | 2818991442 | 2819576280 | 285 |
| 157 | iso_pu_bacteria | 2818991444 | 2819586866 | 285 |
| 158 | iso_pu_bacteria | 2821136567 | 2821142508 | 285 |
| 159 | iso_pu_bacteria | 2842722452 | 2842723994 | 285 |
| 160 | iso_pu_bacteria | 2842909656 | 2842912274 | 285 |
| 161 | iso_pu_bacteria | 2849281842 | 2849282709 | 285 |
| 162 | iso_pu_bacteria | 2852627209 | 2852629191 | 285 |
| 163 | iso_pu_bacteria | 2896344016 | 2896346487 | 285 |
| 164 | iso_pu_bacteria | 2902048731 | 2902049466 | 285 |
| 165 | iso_pu_bacteria | 2904445276 | 2904446452 | 285 |
| 166 | iso_pu_bacteria | 2904467357 | 2904470324 | 285 |
| 167 | iso_pu_bacteria | 2904780799 | 2904781099 | 285 |
| 168 | iso_pu_bacteria | 2919177583 | 2919178701 | 285 |
| 169 | iso_pu_bacteria | 2929239360 | 2929243416 | 285 |
| 170 | iso_pu_bacteria | 2945997725 | 2945999256 | 285 |
| 171 | iso_pu_bacteria | 2954016120 | 2954021649 | 285 |
| 172 | 3300003323 | rootH1_10020237 | rootH1_1002023734 | 286 |
| 173 | 3300005614 | Ga0068856_100000473 | Ga0068856_10000047318 | 286 |
| 174 | 3300025903 | Ga0207680_10192392 | Ga0207680_101923921 | 286 |
| 175 | 3300025909 | Ga0207705_10000043 | Ga0207705_1000004372 | 286 |
| 176 | 3300025914 | Ga0207671_10187354 | Ga0207671_101873542 | 286 |
| 177 | 3300026041 | Ga0207639_10041302 | Ga0207639_100413025 | 286 |
| 178 | 3300026078 | Ga0207702_10000240 | Ga0207702_1000024050 | 286 |
| 179 | 3300028653 | Ga0265323_10008541 | Ga0265323_100085412 | 286 |
| 180 | 3300031344 | Ga0265316_10000307 | Ga0265316_100003077 | 286 |
| 181 | 3300031344 | Ga0265316_10019496 | Ga0265316_100194964 | 286 |
| 182 | 3300031456 | Ga0307513_10067162 | Ga0307513_100671623 | 286 |
| 183 | 3300031712 | Ga0265342_10112734 | Ga0265342_101127342 | 286 |
| 184 | 3300037312 | Ga0395899_0000009 | Ga0395899_0000009_70456_71331 | 286 |
| 185 | 3300037418 | Ga0395900_0000285 | Ga0395900_0000285_15744_16610 | 286 |
| 186 | 3300037466 | Ga0395898_0000050 | Ga0395898_0000050_228748_229623 | 286 |
| 187 | 3300044842 | Ga0466957_0012298 | Ga0466957_0012298_1301_2176 | 286 |
| 188 | 3300033179 | Ga0307507_10000152 | Ga0307507_1000015223 | 287 |
| 189 | 3300041997 | Ga0439431_0032748 | Ga0439431_0032748_259_1137 | 287 |
| 190 | 3300042876 | Ga0451577_0123135 | Ga0451577_0123135_898_1770 | 287 |
| 191 | 3300045051 | Ga0451576_0515877 | Ga0451576_0515877_341_1213 | 287 |
| 192 | 3300046518 | Ga0495631_0085520 | Ga0495631_0085520_338_1207 | 287 |
| 193 | 3300049586 | Ga0501070_0026790 | Ga0501070_0026790_3880_4758 | 287 |
| 194 | 3300049590 | Ga0501074_0148413 | Ga0501074_0148413_53_928 | 287 |
| 195 | 3300003911 | JGI25405J52794_10001158 | JGI25405J52794_100011581 | 288 |
| 196 | 3300005467 | Ga0070706_100051539 | Ga0070706_1000515392 | 288 |
| 197 | 3300005467 | Ga0070706_100179575 | Ga0070706_1001795753 | 288 |
| 198 | 3300005468 | Ga0070707_100006816 | Ga0070707_1000068169 | 288 |
| 199 | 3300005468 | Ga0070707_100159444 | Ga0070707_1001594441 | 288 |
| 200 | 3300005471 | Ga0070698_100080457 | Ga0070698_1000804573 | 288 |
| 201 | 3300005518 | Ga0070699_100002982 | Ga0070699_1000029826 | 288 |
| 202 | 3300005518 | Ga0070699_100351971 | Ga0070699_1003519711 | 288 |
| 203 | 3300005536 | Ga0070697_100148064 | Ga0070697_1001480642 | 288 |
| 204 | 3300005564 | Ga0070664_100018737 | Ga0070664_1000187376 | 288 |
| 205 | 3300005564 | Ga0070664_100060725 | Ga0070664_1000607252 | 288 |
| 206 | 3300005937 | Ga0081455_10013960 | Ga0081455_100139603 | 288 |
| 207 | 3300007265 | Ga0099794_10054272 | Ga0099794_100542721 | 288 |
| 208 | 3300007788 | Ga0099795_10032439 | Ga0099795_100324392 | 288 |
| 209 | 3300009093 | Ga0105240_10041597 | Ga0105240_100415976 | 288 |
| 210 | 3300009093 | Ga0105240_10250305 | Ga0105240_102503052 | 288 |
| 211 | 3300013104 | Ga0157370_10184222 | Ga0157370_101842222 | 288 |
| 212 | 3300025910 | Ga0207684_10121265 | Ga0207684_101212652 | 288 |
| 213 | 3300025913 | Ga0207695_10102907 | Ga0207695_101029072 | 288 |
| 214 | 3300025913 | Ga0207695_10279927 | Ga0207695_102799272 | 288 |
| 215 | 3300025922 | Ga0207646_10000740 | Ga0207646_1000074025 | 288 |
| 216 | 3300025922 | Ga0207646_10050144 | Ga0207646_100501442 | 288 |
| 217 | 3300025945 | Ga0207679_10024234 | Ga0207679_100242342 | 288 |
| 218 | 3300025945 | Ga0207679_10025186 | Ga0207679_100251862 | 288 |
| 219 | 3300028563 | Ga0265319_1001893 | Ga0265319_10018934 | 288 |
| 220 | 3300028577 | Ga0265318_10000482 | Ga0265318_1000048224 | 288 |
| 221 | 3300031235 | Ga0265330_10079653 | Ga0265330_100796532 | 288 |
| 222 | 3300031239 | Ga0265328_10076421 | Ga0265328_100764212 | 288 |
| 223 | 3300031240 | Ga0265320_10002844 | Ga0265320_100028448 | 288 |
| 224 | 3300031241 | Ga0265325_10019595 | Ga0265325_100195953 | 288 |
| 225 | 3300031241 | Ga0265325_10047893 | Ga0265325_100478932 | 288 |
| 226 | 3300031242 | Ga0265329_10000298 | Ga0265329_100002984 | 288 |
| 227 | 3300031247 | Ga0265340_10100617 | Ga0265340_101006171 | 288 |
| 228 | 3300031249 | Ga0265339_10003110 | Ga0265339_100031104 | 288 |
| 229 | 3300031249 | Ga0265339_10004898 | Ga0265339_100048985 | 288 |
| 230 | 3300031250 | Ga0265331_10000242 | Ga0265331_100002424 | 288 |
| 231 | 3300031250 | Ga0265331_10004533 | Ga0265331_100045334 | 288 |
| 232 | 3300031250 | Ga0265331_10069586 | Ga0265331_100695862 | 288 |
| 233 | 3300031344 | Ga0265316_10007106 | Ga0265316_100071063 | 288 |
| 234 | 3300031344 | Ga0265316_10020960 | Ga0265316_100209603 | 288 |
| 235 | 3300031344 | Ga0265316_10208632 | Ga0265316_102086322 | 288 |
| 236 | 3300031595 | Ga0265313_10015109 | Ga0265313_100151094 | 288 |
| 237 | 3300031711 | Ga0265314_10007990 | Ga0265314_100079904 | 288 |
| 238 | 3300031711 | Ga0265314_10017022 | Ga0265314_100170224 | 288 |
| 239 | 3300031711 | Ga0265314_10038229 | Ga0265314_100382293 | 288 |
| 240 | 3300031712 | Ga0265342_10004248 | Ga0265342_100042488 | 288 |
| 241 | 3300031712 | Ga0265342_10046962 | Ga0265342_100469622 | 288 |
| 242 | 3300031824 | Ga0307413_10004983 | Ga0307413_100049833 | 288 |
| 243 | 3300031903 | Ga0307407_10194853 | Ga0307407_101948531 | 288 |
| 244 | 3300032005 | Ga0307411_10068306 | Ga0307411_100683063 | 288 |
| 245 | 3300035118 | Ga0373954_0018521 | Ga0373954_0018521_51_929 | 288 |
| 246 | 3300035692 | Ga0373935_0055113 | Ga0373935_0055113_1522_2400 | 288 |
| 247 | 3300041406 | Ga0439439_0010185 | Ga0439439_0010185_744_1625 | 288 |
| 248 | 3300042156 | Ga0439446_0043507 | Ga0439446_0043507_251_1132 | 288 |
| 249 | 3300044712 | Ga0453684_0306360 | Ga0453684_0306360_330_1214 | 288 |
| 250 | 3300046462 | Ga0495651_0000035 | Ga0495651_0000035_9428_10306 | 288 |
| 251 | 3300046473 | Ga0495582_0041673 | Ga0495582_0041673_709_1587 | 288 |
| 252 | 3300046516 | Ga0495628_0109079 | Ga0495628_0109079_1095_1973 | 288 |
| 253 | 3300046529 | Ga0495652_0014398 | Ga0495652_0014398_2952_3830 | 288 |
| 254 | 3300046535 | Ga0495586_0008960 | Ga0495586_0008960_3054_3932 | 288 |
| 255 | 3300046543 | Ga0495645_0099919 | Ga0495645_0099919_1155_2033 | 288 |
| 256 | 3300046675 | Ga0495657_0054078 | Ga0495657_0054078_142_1020 | 288 |
| 257 | 3300046679 | Ga0495623_0002018 | Ga0495623_0002018_8914_9792 | 288 |
| 258 | 3300046689 | Ga0495613_0047305 | Ga0495613_0047305_1414_2292 | 288 |
| 259 | 3300047319 | Ga0495674_0023015 | Ga0495674_0023015_366_1244 | 288 |
| 260 | 3300047322 | Ga0495680_0000889 | Ga0495680_0000889_26974_27852 | 288 |
| 261 | 3300047444 | Ga0495675_0265015 | Ga0495675_0265015_104_982 | 288 |
| 262 | 3300049824 | Ga0501045_0148882 | Ga0501045_0148882_259_1143 | 288 |
| 263 | 3300050511 | nmdc:mga08y16_213254_c1 | nmdc:mga08y16_213254_c1_668_1534 | 288 |
| 264 | 3300053078 | Ga0495612_0001806 | Ga0495612_0001806_7574_8452 | 288 |
| 265 | 3300005336 | Ga0070680_100309159 | Ga0070680_1003091592 | 289 |
| 266 | 3300005340 | Ga0070689_100146791 | Ga0070689_1001467912 | 289 |
| 267 | 3300005354 | Ga0070675_100090677 | Ga0070675_1000906771 | 289 |
| 268 | 3300005445 | Ga0070708_100349753 | Ga0070708_1003497531 | 289 |
| 269 | 3300005458 | Ga0070681_10037535 | Ga0070681_100375352 | 289 |
| 270 | 3300005539 | Ga0068853_100104395 | Ga0068853_1001043952 | 289 |
| 271 | 3300005563 | Ga0068855_100329260 | Ga0068855_1003292602 | 289 |
| 272 | 3300006844 | Ga0075428_100582826 | Ga0075428_1005828262 | 289 |
| 273 | 3300009093 | Ga0105240_10716734 | Ga0105240_107167341 | 289 |
| 274 | 3300009174 | Ga0105241_10109328 | Ga0105241_101093282 | 289 |
| 275 | 3300009551 | Ga0105238_10113345 | Ga0105238_101133454 | 289 |
| 276 | 3300013104 | Ga0157370_10260508 | Ga0157370_102605082 | 289 |
| 277 | 3300013105 | Ga0157369_10330011 | Ga0157369_103300112 | 289 |
| 278 | 3300013307 | Ga0157372_10145147 | Ga0157372_101451473 | 289 |
| 279 | 3300025911 | Ga0207654_10224827 | Ga0207654_102248272 | 289 |
| 280 | 3300025912 | Ga0207707_10051144 | Ga0207707_100511442 | 289 |
| 281 | 3300025913 | Ga0207695_10168951 | Ga0207695_101689513 | 289 |
| 282 | 3300025921 | Ga0207652_10031743 | Ga0207652_100317434 | 289 |
| 283 | 3300025944 | Ga0207661_10063581 | Ga0207661_100635812 | 289 |
| 284 | 3300025949 | Ga0207667_10002765 | Ga0207667_1000276513 | 289 |
| 285 | 3300026041 | Ga0207639_10254152 | Ga0207639_102541522 | 289 |
| 286 | 3300031727 | Ga0316576_10000272 | Ga0316576_1000027214 | 289 |
| 287 | 3300031901 | Ga0307406_10100685 | Ga0307406_101006852 | 289 |
| 288 | 3300031903 | Ga0307407_10096532 | Ga0307407_100965322 | 289 |
| 289 | 3300032002 | Ga0307416_100200817 | Ga0307416_1002008171 | 289 |
| 290 | 3300032004 | Ga0307414_10096990 | Ga0307414_100969902 | 289 |
| 291 | 3300032005 | Ga0307411_10010998 | Ga0307411_100109982 | 289 |
| 292 | 3300032126 | Ga0307415_100267532 | Ga0307415_1002675322 | 289 |
| 293 | 3300044673 | Ga0453683_0085792 | Ga0453683_0085792_993_1889 | 289 |
| 294 | 3300049576 | Ga0501040_0203242 | Ga0501040_0203242_139_1020 | 289 |
| 295 | 3300049581 | Ga0501047_0076683 | Ga0501047_0076683_918_1814 | 289 |
| 296 | 3300049582 | Ga0501048_0057854 | Ga0501048_0057854_254_1135 | 289 |
| 297 | 3300049592 | Ga0501076_0055266 | Ga0501076_0055266_874_1755 | 289 |
| 298 | 3300049593 | Ga0501077_0002046 | Ga0501077_0002046_766_1701 | 289 |
| 299 | 3300049741 | Ga0501079_0051569 | Ga0501079_0051569_1147_2028 | 289 |
| 300 | 3300049743 | Ga0501081_0016245 | Ga0501081_0016245_256_1137 | 289 |
| 301 | 3300005293 | Ga0065715_10006451 | Ga0065715_100064514 | 290 |
| 302 | 3300005355 | Ga0070671_100004792 | Ga0070671_1000047927 | 290 |
| 303 | 3300005459 | Ga0068867_100005794 | Ga0068867_1000057946 | 290 |
| 304 | 3300005546 | Ga0070696_100110518 | Ga0070696_1001105182 | 290 |
| 305 | 3300005546 | Ga0070696_100131459 | Ga0070696_1001314592 | 290 |
| 306 | 3300005549 | Ga0070704_100009376 | Ga0070704_1000093761 | 290 |
| 307 | 3300005577 | Ga0068857_100296379 | Ga0068857_1002963792 | 290 |
| 308 | 3300005617 | Ga0068859_100144853 | Ga0068859_1001448532 | 290 |
| 309 | 3300005983 | Ga0081540_1012288 | Ga0081540_10122882 | 290 |
| 310 | 3300006237 | Ga0097621_100001261 | Ga0097621_1000012619 | 290 |
| 311 | 3300006358 | Ga0068871_100000595 | Ga0068871_1000005956 | 290 |
| 312 | 3300006844 | Ga0075428_100223257 | Ga0075428_1002232572 | 290 |
| 313 | 3300006847 | Ga0075431_100119848 | Ga0075431_1001198482 | 290 |
| 314 | 3300006871 | Ga0075434_100001798 | Ga0075434_10000179813 | 290 |
| 315 | 3300006881 | Ga0068865_100011650 | Ga0068865_1000116504 | 290 |
| 316 | 3300006931 | Ga0097620_100144853 | Ga0097620_1001448532 | 290 |
| 317 | 3300007076 | Ga0075435_100125847 | Ga0075435_1001258472 | 290 |
| 318 | 3300009147 | Ga0114129_10060823 | Ga0114129_100608235 | 290 |
| 319 | 3300009553 | Ga0105249_10082000 | Ga0105249_100820002 | 290 |
| 320 | 3300010375 | Ga0105239_10045653 | Ga0105239_100456532 | 290 |
| 321 | 3300011119 | Ga0105246_10095480 | Ga0105246_100954801 | 290 |
| 322 | 3300025931 | Ga0207644_10126894 | Ga0207644_101268942 | 290 |
| 323 | 3300025933 | Ga0207706_10307931 | Ga0207706_103079312 | 290 |
| 324 | 3300025937 | Ga0207669_10376585 | Ga0207669_103765851 | 290 |
| 325 | 3300025938 | Ga0207704_10012729 | Ga0207704_100127293 | 290 |
| 326 | 3300025942 | Ga0207689_10000202 | Ga0207689_100002027 | 290 |
| 327 | 3300025944 | Ga0207661_10374121 | Ga0207661_103741211 | 290 |
| 328 | 3300025972 | Ga0207668_10230959 | Ga0207668_102309592 | 290 |
| 329 | 3300026075 | Ga0207708_10085564 | Ga0207708_100855642 | 290 |
| 330 | 3300026075 | Ga0207708_10343866 | Ga0207708_103438661 | 290 |
| 331 | 3300026088 | Ga0207641_10291233 | Ga0207641_102912332 | 290 |
| 332 | 3300026089 | Ga0207648_10010403 | Ga0207648_100104036 | 290 |
| 333 | 3300026116 | Ga0207674_10304519 | Ga0207674_103045192 | 290 |
| 334 | 3300028666 | Ga0265336_10015875 | Ga0265336_100158752 | 290 |
| 335 | 3300028800 | Ga0265338_10006303 | Ga0265338_100063039 | 290 |
| 336 | 3300031242 | Ga0265329_10021114 | Ga0265329_100211142 | 290 |
| 337 | 3300031247 | Ga0265340_10000343 | Ga0265340_1000034316 | 290 |
| 338 | 3300031344 | Ga0265316_10076300 | Ga0265316_100763002 | 290 |
| 339 | 3300031344 | Ga0265316_10083639 | Ga0265316_100836393 | 290 |
| 340 | 3300031548 | Ga0307408_100000053 | Ga0307408_10000005383 | 290 |
| 341 | 3300031548 | Ga0307408_100100811 | Ga0307408_1001008112 | 290 |
| 342 | 3300031595 | Ga0265313_10005800 | Ga0265313_100058009 | 290 |
| 343 | 3300031731 | Ga0307405_10235415 | Ga0307405_102354151 | 290 |
| 344 | 3300031824 | Ga0307413_10322065 | Ga0307413_103220651 | 290 |
| 345 | 3300031852 | Ga0307410_10000005 | Ga0307410_1000000564 | 290 |
| 346 | 3300031901 | Ga0307406_10038853 | Ga0307406_100388532 | 290 |
| 347 | 3300031995 | Ga0307409_100036371 | Ga0307409_1000363711 | 290 |
| 348 | 3300031995 | Ga0307409_100135961 | Ga0307409_1001359612 | 290 |
| 349 | 3300031995 | Ga0307409_100753931 | Ga0307409_1007539311 | 290 |
| 350 | 3300032002 | Ga0307416_100000056 | Ga0307416_10000005635 | 290 |
| 351 | 3300032002 | Ga0307416_100064448 | Ga0307416_1000644483 | 290 |
| 352 | 3300032002 | Ga0307416_100139756 | Ga0307416_1001397561 | 290 |
| 353 | 3300042876 | Ga0451577_0011905 | Ga0451577_0011905_1766_2650 | 290 |
| 354 | 3300048904 | Ga0496101_0294013 | Ga0496101_0294013_312_1196 | 290 |
| 355 | 3300048905 | Ga0496102_0007614 | Ga0496102_0007614_3650_4534 | 290 |
| 356 | 3300048906 | Ga0496103_0075322 | Ga0496103_0075322_128_1012 | 290 |
| 357 | 3300048907 | Ga0496104_0014407 | Ga0496104_0014407_5049_5933 | 290 |
| 358 | 3300048907 | Ga0496104_0080912 | Ga0496104_0080912_1367_2251 | 290 |
| 359 | 3300048907 | Ga0496104_0192359 | Ga0496104_0192359_493_1377 | 290 |
| 360 | 3300048909 | Ga0496106_0322550 | Ga0496106_0322550_219_1103 | 290 |
| 361 | 3300048911 | Ga0496108_0002300 | Ga0496108_0002300_6880_7764 | 290 |
| 362 | 3300048912 | Ga0496109_0002073 | Ga0496109_0002073_3474_4358 | 290 |
| 363 | 3300048912 | Ga0496109_0004053 | Ga0496109_0004053_4156_5040 | 290 |
| 364 | 3300048912 | Ga0496109_0087162 | Ga0496109_0087162_1054_1938 | 290 |
| 365 | 3300048913 | Ga0496110_0122170 | Ga0496110_0122170_455_1339 | 290 |
| 366 | 3300048913 | Ga0496110_0309247 | Ga0496110_0309247_314_1198 | 290 |
| 367 | 3300048914 | Ga0496111_0038036 | Ga0496111_0038036_571_1455 | 290 |
| 368 | 3300048914 | Ga0496111_0073303 | Ga0496111_0073303_259_1143 | 290 |
| 369 | 3300048915 | Ga0496112_0026550 | Ga0496112_0026550_2348_3232 | 290 |
| 370 | 3300048915 | Ga0496112_0163829 | Ga0496112_0163829_474_1358 | 290 |
| 371 | 3300048915 | Ga0496112_0255096 | Ga0496112_0255096_744_1628 | 290 |
| 372 | 3300048916 | Ga0496113_0007998 | Ga0496113_0007998_60_944 | 290 |
| 373 | 3300048916 | Ga0496113_0008116 | Ga0496113_0008116_5312_6196 | 290 |
| 374 | 3300048916 | Ga0496113_0021934 | Ga0496113_0021934_1858_2742 | 290 |
| 375 | 3300049585 | Ga0501069_0093653 | Ga0501069_0093653_722_1654 | 290 |
| 376 | 3300049660 | Ga0501216_005549 | Ga0501216_005549_410_1294 | 290 |
| 377 | 3300049679 | Ga0501249_031080 | Ga0501249_031080_44_931 | 290 |
| 378 | 3300049705 | Ga0501225_0015941 | Ga0501225_0015941_496_1383 | 290 |
| 379 | 3300049707 | Ga0501234_004987 | Ga0501234_004987_811_1698 | 290 |
| 380 | 3300049742 | Ga0501080_0067088 | Ga0501080_0067088_2133_3020 | 290 |
| 381 | 3300049767 | Ga0501270_006166 | Ga0501270_006166_251_1138 | 290 |
| 382 | 3300050507 | nmdc:mga05p37_10736_c1 | nmdc:mga05p37_10736_c1_4947_5843 | 290 |
| 383 | 3300050511 | nmdc:mga08y16_484293_c1 | nmdc:mga08y16_484293_c1_35_919 | 290 |
| 384 | 3300050513 | nmdc:mga0rr50_36845_c1 | nmdc:mga0rr50_36845_c1_1428_2312 | 290 |
| 385 | 3300005336 | Ga0070680_100004850 | Ga0070680_1000048503 | 291 |
| 386 | 3300005347 | Ga0070668_100001641 | Ga0070668_1000016414 | 291 |
| 387 | 3300005354 | Ga0070675_100019916 | Ga0070675_1000199162 | 291 |
| 388 | 3300005356 | Ga0070674_100397773 | Ga0070674_1003977732 | 291 |
| 389 | 3300005440 | Ga0070705_100088294 | Ga0070705_1000882942 | 291 |
| 390 | 3300005445 | Ga0070708_100002791 | Ga0070708_1000027916 | 291 |
| 391 | 3300005458 | Ga0070681_10010848 | Ga0070681_100108485 | 291 |
| 392 | 3300005459 | Ga0068867_100197967 | Ga0068867_1001979672 | 291 |
| 393 | 3300005467 | Ga0070706_100002873 | Ga0070706_10000287313 | 291 |
| 394 | 3300005468 | Ga0070707_100013735 | Ga0070707_1000137353 | 291 |
| 395 | 3300005468 | Ga0070707_100022535 | Ga0070707_1000225354 | 291 |
| 396 | 3300005471 | Ga0070698_100002158 | Ga0070698_10000215811 | 291 |
| 397 | 3300005471 | Ga0070698_100077257 | Ga0070698_1000772572 | 291 |
| 398 | 3300005518 | Ga0070699_100001557 | Ga0070699_1000015576 | 291 |
| 399 | 3300005518 | Ga0070699_100004839 | Ga0070699_1000048396 | 291 |
| 400 | 3300005530 | Ga0070679_100000835 | Ga0070679_10000083516 | 291 |
| 401 | 3300005530 | Ga0070679_100038328 | Ga0070679_1000383282 | 291 |
| 402 | 3300005546 | Ga0070696_100016442 | Ga0070696_1000164423 | 291 |
| 403 | 3300005546 | Ga0070696_100104612 | Ga0070696_1001046122 | 291 |
| 404 | 3300005546 | Ga0070696_100132797 | Ga0070696_1001327972 | 291 |
| 405 | 3300005549 | Ga0070704_100001281 | Ga0070704_1000012814 | 291 |
| 406 | 3300005564 | Ga0070664_100332565 | Ga0070664_1003325651 | 291 |
| 407 | 3300005577 | Ga0068857_100082844 | Ga0068857_1000828442 | 291 |
| 408 | 3300005617 | Ga0068859_100371247 | Ga0068859_1003712472 | 291 |
| 409 | 3300005844 | Ga0068862_100123682 | Ga0068862_1001236822 | 291 |
| 410 | 3300005981 | Ga0081538_10094815 | Ga0081538_100948152 | 291 |
| 411 | 3300006844 | Ga0075428_100396734 | Ga0075428_1003967342 | 291 |
| 412 | 3300006846 | Ga0075430_100272011 | Ga0075430_1002720111 | 291 |
| 413 | 3300006852 | Ga0075433_10017655 | Ga0075433_100176554 | 291 |
| 414 | 3300006852 | Ga0075433_10026609 | Ga0075433_100266092 | 291 |
| 415 | 3300006871 | Ga0075434_100001332 | Ga0075434_10000133220 | 291 |
| 416 | 3300006880 | Ga0075429_100002455 | Ga0075429_1000024553 | 291 |
| 417 | 3300006880 | Ga0075429_100031893 | Ga0075429_1000318932 | 291 |
| 418 | 3300006914 | Ga0075436_100120776 | Ga0075436_1001207762 | 291 |
| 419 | 3300006931 | Ga0097620_100371246 | Ga0097620_1003712462 | 291 |
| 420 | 3300009147 | Ga0114129_10011573 | Ga0114129_100115734 | 291 |
| 421 | 3300009147 | Ga0114129_10119826 | Ga0114129_101198265 | 291 |
| 422 | 3300009147 | Ga0114129_10199460 | Ga0114129_101994603 | 291 |
| 423 | 3300009147 | Ga0114129_10302777 | Ga0114129_103027772 | 291 |
| 424 | 3300009147 | Ga0114129_10633964 | Ga0114129_106339641 | 291 |
| 425 | 3300009177 | Ga0105248_10058087 | Ga0105248_100580872 | 291 |
| 426 | 3300009177 | Ga0105248_10115325 | Ga0105248_101153252 | 291 |
| 427 | 3300009553 | Ga0105249_10199025 | Ga0105249_101990252 | 291 |
| 428 | 3300014325 | Ga0163163_10045914 | Ga0163163_100459142 | 291 |
| 429 | 3300014968 | Ga0157379_10096565 | Ga0157379_100965654 | 291 |
| 430 | 3300021388 | Ga0213875_10005665 | Ga0213875_100056655 | 291 |
| 431 | 3300025899 | Ga0207642_10044462 | Ga0207642_100444622 | 291 |
| 432 | 3300025910 | Ga0207684_10009643 | Ga0207684_100096433 | 291 |
| 433 | 3300025917 | Ga0207660_10068472 | Ga0207660_100684722 | 291 |
| 434 | 3300025921 | Ga0207652_10144919 | Ga0207652_101449192 | 291 |
| 435 | 3300025922 | Ga0207646_10008320 | Ga0207646_100083204 | 291 |
| 436 | 3300025922 | Ga0207646_10026722 | Ga0207646_100267225 | 291 |
| 437 | 3300025922 | Ga0207646_10241582 | Ga0207646_102415821 | 291 |
| 438 | 3300025936 | Ga0207670_10405811 | Ga0207670_104058111 | 291 |
| 439 | 3300025941 | Ga0207711_10085795 | Ga0207711_100857952 | 291 |
| 440 | 3300025941 | Ga0207711_10114391 | Ga0207711_101143912 | 291 |
| 441 | 3300025961 | Ga0207712_10060720 | Ga0207712_100607201 | 291 |
| 442 | 3300025972 | Ga0207668_10082116 | Ga0207668_100821162 | 291 |
| 443 | 3300026067 | Ga0207678_10059162 | Ga0207678_100591621 | 291 |
| 444 | 3300026095 | Ga0207676_10151076 | Ga0207676_101510762 | 291 |
| 445 | 3300028380 | Ga0268265_10268609 | Ga0268265_102686091 | 291 |
| 446 | 3300031241 | Ga0265325_10027534 | Ga0265325_100275344 | 291 |
| 447 | 3300031548 | Ga0307408_100017422 | Ga0307408_1000174222 | 291 |
| 448 | 3300031548 | Ga0307408_100071812 | Ga0307408_1000718122 | 291 |
| 449 | 3300031548 | Ga0307408_100073455 | Ga0307408_1000734552 | 291 |
| 450 | 3300031824 | Ga0307413_10003883 | Ga0307413_100038831 | 291 |
| 451 | 3300031824 | Ga0307413_10022501 | Ga0307413_100225012 | 291 |
| 452 | 3300031824 | Ga0307413_10040716 | Ga0307413_100407162 | 291 |
| 453 | 3300031824 | Ga0307413_10160687 | Ga0307413_101606872 | 291 |
| 454 | 3300031824 | Ga0307413_10331281 | Ga0307413_103312812 | 291 |
| 455 | 3300031852 | Ga0307410_10006149 | Ga0307410_100061495 | 291 |
| 456 | 3300031852 | Ga0307410_10011028 | Ga0307410_100110282 | 291 |
| 457 | 3300031852 | Ga0307410_10105290 | Ga0307410_101052902 | 291 |
| 458 | 3300031901 | Ga0307406_10253961 | Ga0307406_102539612 | 291 |
| 459 | 3300031903 | Ga0307407_10009431 | Ga0307407_100094312 | 291 |
| 460 | 3300031911 | Ga0307412_10080464 | Ga0307412_100804642 | 291 |
| 461 | 3300031995 | Ga0307409_100006205 | Ga0307409_1000062054 | 291 |
| 462 | 3300031995 | Ga0307409_100066195 | Ga0307409_1000661951 | 291 |
| 463 | 3300031995 | Ga0307409_100120729 | Ga0307409_1001207292 | 291 |
| 464 | 3300032002 | Ga0307416_100001477 | Ga0307416_1000014775 | 291 |
| 465 | 3300032002 | Ga0307416_100060509 | Ga0307416_1000605093 | 291 |
| 466 | 3300032002 | Ga0307416_100063906 | Ga0307416_1000639062 | 291 |
| 467 | 3300032002 | Ga0307416_100314145 | Ga0307416_1003141452 | 291 |
| 468 | 3300032002 | Ga0307416_100580491 | Ga0307416_1005804912 | 291 |
| 469 | 3300032002 | Ga0307416_100657989 | Ga0307416_1006579891 | 291 |
| 470 | 3300032004 | Ga0307414_10069695 | Ga0307414_100696952 | 291 |
| 471 | 3300032004 | Ga0307414_10150634 | Ga0307414_101506342 | 291 |
| 472 | 3300032004 | Ga0307414_10292698 | Ga0307414_102926981 | 291 |
| 473 | 3300032005 | Ga0307411_10009060 | Ga0307411_100090603 | 291 |
| 474 | 3300032005 | Ga0307411_10019008 | Ga0307411_100190084 | 291 |
| 475 | 3300032005 | Ga0307411_10020253 | Ga0307411_100202533 | 291 |
| 476 | 3300032005 | Ga0307411_10056162 | Ga0307411_100561622 | 291 |
| 477 | 3300032126 | Ga0307415_100005743 | Ga0307415_1000057435 | 291 |
| 478 | 3300032126 | Ga0307415_100036547 | Ga0307415_1000365473 | 291 |
| 479 | 3300032126 | Ga0307415_100219804 | Ga0307415_1002198042 | 291 |
| 480 | 3300035111 | Ga0373923_0004390 | Ga0373923_0004390_1077_1967 | 291 |
| 481 | 3300035115 | Ga0373941_0061593 | Ga0373941_0061593_281_1168 | 291 |
| 482 | 3300035121 | Ga0373960_0068976 | Ga0373960_0068976_184_1071 | 291 |
| 483 | 3300035695 | Ga0373927_0032850 | Ga0373927_0032850_45_935 | 291 |
| 484 | 3300035724 | Ga0373933_0062826 | Ga0373933_0062826_727_1617 | 291 |
| 485 | 3300035725 | Ga0373947_0050076 | Ga0373947_0050076_1413_2303 | 291 |
| 486 | 3300036401 | Ga0373937_0004947 | Ga0373937_0004947_1480_2370 | 291 |
| 487 | 3300037471 | Ga0395905_0205328 | Ga0395905_0205328_680_1567 | 291 |
| 488 | 3300039062 | Ga0400483_199042 | Ga0400483_199042_36359_37237 | 291 |
| 489 | 3300041486 | Ga0451807_1902692 | Ga0451807_1902692_76_963 | 291 |
| 490 | 3300042876 | Ga0451577_0172711 | Ga0451577_0172711_847_1734 | 291 |
| 491 | 3300047322 | Ga0495680_0280185 | Ga0495680_0280185_25_912 | 291 |
| 492 | 3300048904 | Ga0496101_0035655 | Ga0496101_0035655_622_1617 | 291 |
| 493 | 3300048904 | Ga0496101_0464427 | Ga0496101_0464427_80_967 | 291 |
| 494 | 3300048905 | Ga0496102_0411024 | Ga0496102_0411024_66_953 | 291 |
| 495 | 3300048907 | Ga0496104_0007861 | Ga0496104_0007861_3009_3896 | 291 |
| 496 | 3300048909 | Ga0496106_0027551 | Ga0496106_0027551_797_1684 | 291 |
| 497 | 3300048911 | Ga0496108_0000224 | Ga0496108_0000224_33126_34013 | 291 |
| 498 | 3300048912 | Ga0496109_0057502 | Ga0496109_0057502_1165_2052 | 291 |
| 499 | 3300048914 | Ga0496111_0043607 | Ga0496111_0043607_838_1725 | 291 |
| 500 | 3300048915 | Ga0496112_0000156 | Ga0496112_0000156_13034_13921 | 291 |
| 501 | 3300048916 | Ga0496113_0000224 | Ga0496113_0000224_12574_13461 | 291 |
| 502 | 3300048917 | Ga0496114_0205790 | Ga0496114_0205790_74_961 | 291 |
| 503 | 3300049515 | Ga0501292_016632 | Ga0501292_016632_251_1141 | 291 |
| 504 | 3300049572 | Ga0501036_0237211 | Ga0501036_0237211_77_964 | 291 |
| 505 | 3300049583 | Ga0501067_0045569 | Ga0501067_0045569_909_1808 | 291 |
| 506 | 3300049586 | Ga0501070_0087909 | Ga0501070_0087909_1273_2163 | 291 |
| 507 | 3300049588 | Ga0501072_0220539 | Ga0501072_0220539_570_1457 | 291 |
| 508 | 3300049592 | Ga0501076_0011564 | Ga0501076_0011564_502_1389 | 291 |
| 509 | 3300049593 | Ga0501077_0018620 | Ga0501077_0018620_1249_2136 | 291 |
| 510 | 3300049650 | Ga0501199_003270 | Ga0501199_003270_64_954 | 291 |
| 511 | 3300049655 | Ga0501208_008618 | Ga0501208_008618_354_1244 | 291 |
| 512 | 3300049656 | Ga0501209_001936 | Ga0501209_001936_209_1099 | 291 |
| 513 | 3300049660 | Ga0501216_011090 | Ga0501216_011090_260_1150 | 291 |
| 514 | 3300049668 | Ga0501233_006893 | Ga0501233_006893_252_1142 | 291 |
| 515 | 3300049672 | Ga0501239_010435 | Ga0501239_010435_39_929 | 291 |
| 516 | 3300049679 | Ga0501249_026299 | Ga0501249_026299_310_1200 | 291 |
| 517 | 3300049705 | Ga0501225_0020393 | Ga0501225_0020393_80_970 | 291 |
| 518 | 3300049706 | Ga0501229_003620 | Ga0501229_003620_740_1630 | 291 |
| 519 | 3300049708 | Ga0501245_005297 | Ga0501245_005297_659_1549 | 291 |
| 520 | 3300049742 | Ga0501080_0318214 | Ga0501080_0318214_218_1105 | 291 |
| 521 | 3300049743 | Ga0501081_0015656 | Ga0501081_0015656_243_1130 | 291 |
| 522 | 3300049743 | Ga0501081_0159499 | Ga0501081_0159499_312_1199 | 291 |
| 523 | 3300049743 | Ga0501081_0337023 | Ga0501081_0337023_14_901 | 291 |
| 524 | 3300049744 | Ga0501083_0265812 | Ga0501083_0265812_211_1098 | 291 |
| 525 | 3300049760 | Ga0501263_011756 | Ga0501263_011756_146_1036 | 291 |
| 526 | 3300049765 | Ga0501268_000526 | Ga0501268_000526_2841_3731 | 291 |
| 527 | 3300049770 | Ga0501273_000813 | Ga0501273_000813_1156_2046 | 291 |
| 528 | 3300049779 | Ga0501283_002694 | Ga0501283_002694_1143_2033 | 291 |
| 529 | 3300049824 | Ga0501045_0128562 | Ga0501045_0128562_310_1197 | 291 |
| 530 | 3300049851 | Ga0501212_012411 | Ga0501212_012411_314_1204 | 291 |
| 531 | 3300050507 | nmdc:mga05p37_101647_c1 | nmdc:mga05p37_101647_c1_385_1272 | 291 |
| 532 | 3300050507 | nmdc:mga05p37_238652_c1 | nmdc:mga05p37_238652_c1_1041_1928 | 291 |
| 533 | 3300050508 | nmdc:mga09592_13286_c1 | nmdc:mga09592_13286_c1_4580_5479 | 291 |
| 534 | 3300050509 | nmdc:mga0qj67_274559_c1 | nmdc:mga0qj67_274559_c1_244_1131 | 291 |
| 535 | 3300050510 | nmdc:mga06r32_218158_c1 | nmdc:mga06r32_218158_c1_486_1385 | 291 |
| 536 | 3300050512 | nmdc:mga0n895_290604_c1 | nmdc:mga0n895_290604_c1_148_1038 | 291 |
| 537 | 3300050514 | nmdc:mga08x19_281376_c1 | nmdc:mga08x19_281376_c1_89_979 | 291 |
| 538 | 3300054114 | Ga0501084_0023363 | Ga0501084_0023363_1792_2679 | 291 |
| 539 | 3300059421 | Ga0590071_001110 | Ga0590071_001110_233_1180 | 291 |
| 540 | 3300059421 | Ga0590071_007573 | Ga0590071_007573_1182_2069 | 291 |
| 541 | 3300059421 | Ga0590071_017193 | Ga0590071_017193_644_1597 | 291 |
| 542 | 3300059426 | Ga0590077_006863 | Ga0590077_006863_924_1871 | 291 |
| 543 | 3300005518 | Ga0070699_100270689 | Ga0070699_1002706891 | 292 |
| 544 | 3300005577 | Ga0068857_100358341 | Ga0068857_1003583412 | 292 |
| 545 | 3300006846 | Ga0075430_100232029 | Ga0075430_1002320291 | 292 |
| 546 | 3300006847 | Ga0075431_100003197 | Ga0075431_1000031975 | 292 |
| 547 | 3300025934 | Ga0207686_10001945 | Ga0207686_100019456 | 292 |
| 548 | 3300046454 | Ga0495592_0009875 | Ga0495592_0009875_5296_6231 | 292 |
| 549 | 3300047321 | Ga0495676_0092209 | Ga0495676_0092209_1333_2223 | 292 |
| 550 | 3300047322 | Ga0495680_0072934 | Ga0495680_0072934_1186_2076 | 292 |
| 551 | 3300048905 | Ga0496102_0248223 | Ga0496102_0248223_282_1172 | 292 |
| 552 | 3300049571 | Ga0501034_0001775 | Ga0501034_0001775_16104_16997 | 292 |
| 553 | 3300049583 | Ga0501067_0000266 | Ga0501067_0000266_11400_12293 | 292 |
| 554 | 3300049584 | Ga0501068_0000448 | Ga0501068_0000448_16067_16960 | 292 |
| 555 | 3300049585 | Ga0501069_0000254 | Ga0501069_0000254_14730_15623 | 292 |
| 556 | 3300049586 | Ga0501070_0000849 | Ga0501070_0000849_17130_18023 | 292 |
| 557 | 3300049588 | Ga0501072_0000338 | Ga0501072_0000338_17165_18058 | 292 |
| 558 | 3300049589 | Ga0501073_0075109 | Ga0501073_0075109_182_1075 | 292 |
| 559 | 3300049590 | Ga0501074_0000589 | Ga0501074_0000589_9714_10607 | 292 |
| 560 | 3300049742 | Ga0501080_0001482 | Ga0501080_0001482_13920_14813 | 292 |
| 561 | 3300049744 | Ga0501083_0000370 | Ga0501083_0000370_8530_9423 | 292 |
| 562 | 3300050509 | nmdc:mga0qj67_31390_c1 | nmdc:mga0qj67_31390_c1_3163_4053 | 292 |
| 563 | 3300054114 | Ga0501084_0058663 | Ga0501084_0058663_1561_2454 | 292 |
| 564 | 3300060353 | Ga0501082_0000782 | Ga0501082_0000782_9803_10696 | 292 |
| 565 | 3300005289 | Ga0065704_10164034 | Ga0065704_101640341 | 293 |
| 566 | 3300005293 | Ga0065715_10089620 | Ga0065715_1008962010 | 293 |
| 567 | 3300005295 | Ga0065707_10093950 | Ga0065707_100939503 | 293 |
| 568 | 3300005330 | Ga0070690_100012968 | Ga0070690_1000129682 | 293 |
| 569 | 3300005330 | Ga0070690_100126325 | Ga0070690_1001263252 | 293 |
| 570 | 3300005331 | Ga0070670_100000627 | Ga0070670_1000006279 | 293 |
| 571 | 3300005340 | Ga0070689_100058933 | Ga0070689_1000589332 | 293 |
| 572 | 3300005343 | Ga0070687_100007543 | Ga0070687_1000075432 | 293 |
| 573 | 3300005353 | Ga0070669_100002872 | Ga0070669_1000028725 | 293 |
| 574 | 3300005444 | Ga0070694_100004077 | Ga0070694_1000040773 | 293 |
| 575 | 3300005457 | Ga0070662_100176828 | Ga0070662_1001768283 | 293 |
| 576 | 3300005467 | Ga0070706_100019100 | Ga0070706_1000191007 | 293 |
| 577 | 3300005471 | Ga0070698_100051081 | Ga0070698_1000510815 | 293 |
| 578 | 3300005518 | Ga0070699_100009207 | Ga0070699_1000092072 | 293 |
| 579 | 3300005536 | Ga0070697_100180457 | Ga0070697_1001804573 | 293 |
| 580 | 3300005536 | Ga0070697_100205289 | Ga0070697_1002052892 | 293 |
| 581 | 3300005545 | Ga0070695_100035005 | Ga0070695_1000350053 | 293 |
| 582 | 3300005545 | Ga0070695_100156100 | Ga0070695_1001561002 | 293 |
| 583 | 3300005719 | Ga0068861_100059682 | Ga0068861_1000596823 | 293 |
| 584 | 3300005937 | Ga0081455_10009457 | Ga0081455_1000945713 | 293 |
| 585 | 3300006881 | Ga0068865_100095624 | Ga0068865_1000956241 | 293 |
| 586 | 3300009094 | Ga0111539_10191418 | Ga0111539_101914182 | 293 |
| 587 | 3300009098 | Ga0105245_10199749 | Ga0105245_101997493 | 293 |
| 588 | 3300009147 | Ga0114129_10004244 | Ga0114129_100042449 | 293 |
| 589 | 3300009147 | Ga0114129_10298367 | Ga0114129_102983673 | 293 |
| 590 | 3300009176 | Ga0105242_10107827 | Ga0105242_101078273 | 293 |
| 591 | 3300009177 | Ga0105248_10940561 | Ga0105248_109405611 | 293 |
| 592 | 3300009553 | Ga0105249_10047816 | Ga0105249_100478163 | 293 |
| 593 | 3300009553 | Ga0105249_10259414 | Ga0105249_102594142 | 293 |
| 594 | 3300013297 | Ga0157378_10014580 | Ga0157378_100145804 | 293 |
| 595 | 3300013306 | Ga0163162_10018625 | Ga0163162_100186253 | 293 |
| 596 | 3300013307 | Ga0157372_10099038 | Ga0157372_100990382 | 293 |
| 597 | 3300013308 | Ga0157375_10033155 | Ga0157375_100331554 | 293 |
| 598 | 3300014326 | Ga0157380_10000393 | Ga0157380_1000039311 | 293 |
| 599 | 3300014326 | Ga0157380_10017721 | Ga0157380_100177214 | 293 |
| 600 | 3300017792 | Ga0163161_10130339 | Ga0163161_101303392 | 293 |
| 601 | 3300021388 | Ga0213875_10014305 | Ga0213875_100143053 | 293 |
| 602 | 3300025910 | Ga0207684_10239799 | Ga0207684_102397991 | 293 |
| 603 | 3300025922 | Ga0207646_10271632 | Ga0207646_102716323 | 293 |
| 604 | 3300025923 | Ga0207681_10000701 | Ga0207681_100007016 | 293 |
| 605 | 3300025925 | Ga0207650_10003875 | Ga0207650_100038758 | 293 |
| 606 | 3300025927 | Ga0207687_10127735 | Ga0207687_101277352 | 293 |
| 607 | 3300025933 | Ga0207706_10047479 | Ga0207706_100474795 | 293 |
| 608 | 3300025936 | Ga0207670_10128100 | Ga0207670_101281002 | 293 |
| 609 | 3300025940 | Ga0207691_10275914 | Ga0207691_102759143 | 293 |
| 610 | 3300025961 | Ga0207712_10218773 | Ga0207712_102187732 | 293 |
| 611 | 3300026023 | Ga0207677_10124398 | Ga0207677_101243982 | 293 |
| 612 | 3300026035 | Ga0207703_10417582 | Ga0207703_104175822 | 293 |
| 613 | 3300026118 | Ga0207675_100054009 | Ga0207675_1000540093 | 293 |
| 614 | 3300026118 | Ga0207675_100203857 | Ga0207675_1002038573 | 293 |
| 615 | 3300028380 | Ga0268265_10010200 | Ga0268265_100102004 | 293 |
| 616 | 3300028381 | Ga0268264_10046604 | Ga0268264_100466042 | 293 |
| 617 | 3300028800 | Ga0265338_10014520 | Ga0265338_100145206 | 293 |
| 618 | 3300031238 | Ga0265332_10029308 | Ga0265332_100293082 | 293 |
| 619 | 3300031241 | Ga0265325_10000151 | Ga0265325_1000015131 | 293 |
| 620 | 3300031249 | Ga0265339_10000181 | Ga0265339_1000018121 | 293 |
| 621 | 3300031250 | Ga0265331_10000166 | Ga0265331_1000016628 | 293 |
| 622 | 3300031595 | Ga0265313_10000750 | Ga0265313_1000075026 | 293 |
| 623 | 3300031711 | Ga0265314_10000290 | Ga0265314_1000029028 | 293 |
| 624 | 3300037853 | Ga0436364_1300931 | Ga0436364_1300931_5331_6242 | 293 |
| 625 | 3300048929 | Ga0496126_0016788 | Ga0496126_0016788_2243_3163 | 293 |
| 626 | 3300050507 | nmdc:mga05p37_312747_c1 | nmdc:mga05p37_312747_c1_609_1490 | 293 |
| 627 | 3300050507 | nmdc:mga05p37_94120_c1 | nmdc:mga05p37_94120_c1_1686_2567 | 293 |
| 628 | 3300050513 | nmdc:mga0rr50_334742_c1 | nmdc:mga0rr50_334742_c1_360_1244 | 293 |
| 629 | 3300003761 | Ga0055535_1002886 | Ga0055535_10028864 | 294 |
| 630 | 3300005444 | Ga0070694_100058148 | Ga0070694_1000581482 | 294 |
| 631 | 3300005467 | Ga0070706_100015182 | Ga0070706_1000151823 | 294 |
| 632 | 3300005467 | Ga0070706_100036187 | Ga0070706_1000361874 | 294 |
| 633 | 3300005467 | Ga0070706_100167031 | Ga0070706_1001670312 | 294 |
| 634 | 3300005471 | Ga0070698_100012022 | Ga0070698_1000120222 | 294 |
| 635 | 3300005518 | Ga0070699_100392168 | Ga0070699_1003921681 | 294 |
| 636 | 3300005546 | Ga0070696_100172075 | Ga0070696_1001720752 | 294 |
| 637 | 3300009148 | Ga0105243_10067097 | Ga0105243_100670972 | 294 |
| 638 | 3300025910 | Ga0207684_10015581 | Ga0207684_100155813 | 294 |
| 639 | 3300025935 | Ga0207709_10076521 | Ga0207709_100765212 | 294 |
| 640 | 3300025945 | Ga0207679_10322883 | Ga0207679_103228832 | 294 |
| 641 | 3300032005 | Ga0307411_10012258 | Ga0307411_100122582 | 294 |
| 642 | 3300042876 | Ga0451577_0131635 | Ga0451577_0131635_136_1044 | 294 |
| 643 | 3300005293 | Ga0065715_10117683 | Ga0065715_101176832 | 295 |
| 644 | 3300005471 | Ga0070698_100134799 | Ga0070698_1001347993 | 295 |
| 645 | 3300005549 | Ga0070704_100546313 | Ga0070704_1005463131 | 295 |
| 646 | 3300005617 | Ga0068859_100037658 | Ga0068859_1000376584 | 295 |
| 647 | 3300005841 | Ga0068863_100037968 | Ga0068863_1000379683 | 295 |
| 648 | 3300005841 | Ga0068863_100103833 | Ga0068863_1001038331 | 295 |
| 649 | 3300006847 | Ga0075431_100092611 | Ga0075431_1000926112 | 295 |
| 650 | 3300006931 | Ga0097620_100037660 | Ga0097620_1000376604 | 295 |
| 651 | 3300009147 | Ga0114129_10758921 | Ga0114129_107589212 | 295 |
| 652 | 3300009176 | Ga0105242_10321417 | Ga0105242_103214172 | 295 |
| 653 | 3300025942 | Ga0207689_10026688 | Ga0207689_100266885 | 295 |
| 654 | 3300026088 | Ga0207641_10023735 | Ga0207641_100237353 | 295 |
| 655 | 3300026088 | Ga0207641_10091721 | Ga0207641_100917212 | 295 |
| 656 | 3300049741 | Ga0501079_0179144 | Ga0501079_0179144_602_1489 | 295 |
| 657 | 3300050510 | nmdc:mga06r32_131982_c1 | nmdc:mga06r32_131982_c1_1178_2095 | 295 |
| 658 | 3300005468 | Ga0070707_100000045 | Ga0070707_10000004579 | 296 |
| 659 | 3300005518 | Ga0070699_100049357 | Ga0070699_1000493573 | 296 |
| 660 | 3300025922 | Ga0207646_10000097 | Ga0207646_100000975 | 296 |
| 661 | 3300050511 | nmdc:mga08y16_85639_c1 | nmdc:mga08y16_85639_c1_1691_2596 | 296 |
| 662 | 3300003203 | JGI25406J46586_10017553 | JGI25406J46586_100175535 | 297 |
| 663 | 3300005330 | Ga0070690_100386338 | Ga0070690_1003863381 | 297 |
| 664 | 3300005334 | Ga0068869_100061880 | Ga0068869_1000618802 | 297 |
| 665 | 3300005344 | Ga0070661_100092937 | Ga0070661_1000929372 | 297 |
| 666 | 3300005355 | Ga0070671_100031873 | Ga0070671_1000318732 | 297 |
| 667 | 3300005438 | Ga0070701_10036431 | Ga0070701_100364312 | 297 |
| 668 | 3300005445 | Ga0070708_100446023 | Ga0070708_1004460231 | 297 |
| 669 | 3300005471 | Ga0070698_100137108 | Ga0070698_1001371082 | 297 |
| 670 | 3300005518 | Ga0070699_100071779 | Ga0070699_1000717792 | 297 |
| 671 | 3300005518 | Ga0070699_100175259 | Ga0070699_1001752592 | 297 |
| 672 | 3300005536 | Ga0070697_100001314 | Ga0070697_1000013145 | 297 |
| 673 | 3300005536 | Ga0070697_100301228 | Ga0070697_1003012283 | 297 |
| 674 | 3300005546 | Ga0070696_100046391 | Ga0070696_1000463912 | 297 |
| 675 | 3300005546 | Ga0070696_100169631 | Ga0070696_1001696312 | 297 |
| 676 | 3300005564 | Ga0070664_100039669 | Ga0070664_1000396692 | 297 |
| 677 | 3300005844 | Ga0068862_100136793 | Ga0068862_1001367933 | 297 |
| 678 | 3300005985 | Ga0081539_10000165 | Ga0081539_1000016571 | 297 |
| 679 | 3300006038 | Ga0075365_10068373 | Ga0075365_100683732 | 297 |
| 680 | 3300014325 | Ga0163163_10240115 | Ga0163163_102401151 | 297 |
| 681 | 3300014326 | Ga0157380_10035130 | Ga0157380_100351303 | 297 |
| 682 | 3300017792 | Ga0163161_10134815 | Ga0163161_101348152 | 297 |
| 683 | 3300025923 | Ga0207681_10045260 | Ga0207681_100452603 | 297 |
| 684 | 3300026089 | Ga0207648_10200981 | Ga0207648_102009812 | 297 |
| 685 | 3300026118 | Ga0207675_100366535 | Ga0207675_1003665352 | 297 |
| 686 | 3300028653 | Ga0265323_10015393 | Ga0265323_100153933 | 297 |
| 687 | 3300042134 | Ga0450898_003226 | Ga0450898_003226_390_1310 | 297 |
| 688 | 3300042435 | Ga0439434_0006714 | Ga0439434_0006714_2187_3083 | 297 |
| 689 | 3300046539 | Ga0495621_0065902 | Ga0495621_0065902_104_997 | 297 |
| 690 | 3300047318 | Ga0495636_0032129 | Ga0495636_0032129_462_1358 | 297 |
| 691 | 3300047320 | Ga0495672_0099112 | Ga0495672_0099112_92_988 | 297 |
| 692 | 3300050491 | nmdc:mga00v17_56834_c1 | nmdc:mga00v17_56834_c1_297_1217 | 297 |
| 693 | 3300050496 | nmdc:mga07m45_15486_c1 | nmdc:mga07m45_15486_c1_1396_2316 | 297 |
| 694 | 3300053153 | Ga0500616_0000226 | Ga0500616_0000226_55210_56115 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h8j-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9572 | 7 | 295 |
| 6mg6-assembly2.cif.gz_C | crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 | 0.9517 | 9 | 290 |
| 5h8j-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9503 | 7 | 295 |
| 5h8j-assembly2.cif.gz_P | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9461 | 7 | 296 |
| 5h8k-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant | 0.9458 | 7 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h8jH00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9572 | 7 | 295 | 3.60.110.10 |
| 5h8jH00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9503 | 7 | 295 | 3.60.110.10 |
| 6mg6B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9493 | 9 | 287 | 3.60.110.10 |
| 5h8jC00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9285 | 1 | 297 | 3.60.110.10 |
| 5h8jC00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9255 | 1 | 297 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8SZN0-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9922 | 12 | 255 |
GO:0033388
GO:0050126 |
| AF-A0A7Y5FEC3-F1-model_v4 | deleted | 0.9921 | 12 | 139 |
|
| AF-A0A535BF78-F1-model_v4 | Acyltransferase | 0.9885 | 10 | 152 |
GO:0016746
GO:0016811 |
| AF-A0A7C6MMM4-F1-model_v4 | deleted | 0.988 | 12 | 239 |
|
| AF-A0A7V2CZ42-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9838 | 39 | 290 |
GO:0033388
GO:0050126 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar