F475720

General Info

Members Datasets Scaffolds Average Seq Length
694 420 1388 385

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10045374|Ga0075362_100453742
Length 403
Sequence MSTTPNGATQPLSGVRVIDFTQVMMGPCATQMLADYGADVIKIERPGAGDLSRSSIADDPDGLNNPVFRSLNRNKRSIALDLRGEAGKAIVFDLVRNADVVVNNFRAGVMERMGFGYEALSQINPRIICAFGSGFGQSGPLSHKGGQDILAQAMSGVMARKPDHSLPTSLYATALADYSAGMHMVQGILLALMQREKTGKGQQISVSLYDSMLAMQMQEASMWMQRKRELNWGAFPLTGVFDTTDGAVVIVGAFKANPLQDICRALDLPDLSANPETATFAGQMKNKAELHRQFRSKLSTNTTAYWLARLEEQDLLSAPVQTLPEALSSEQTAVNGMVVSLQANGSGRNEPLKLVGSPISMEADAFQLRHAPPSLGEHGAAILAELGYTSERIESLRASKVLT

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
119 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
120 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
226 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
362 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
363 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
367 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
368 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
369 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
370 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
371 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
372 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
373 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
374 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
375 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
376 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
377 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
378 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
379 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
380 2643221557 Ensifer sp. Root558 Isolate Unclassified
381 2643221558 Rhizobium sp. Root149 Isolate Unclassified
382 2643221610 Ensifer sp. Root74 Isolate Unclassified
383 2643221668 Ensifer sp. Root423 Isolate Unclassified
384 2643221675 Ensifer sp. Root1298 Isolate Unclassified
385 2643221680 Ensifer sp. Root1312 Isolate Unclassified
386 2643221723 Ensifer sp. Root278 Isolate Unclassified
387 2643221726 Ensifer sp. Root954 Isolate Unclassified
388 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
389 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
390 2738541277 Variovorax sp. GV051 Isolate Unclassified
391 2738541307 Variovorax sp. GV008 Isolate Unclassified
392 2738543019 Variovorax sp. GV040 Isolate Unclassified
393 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
394 2818991446 Variovorax sp. 1180 Isolate Unclassified
395 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
396 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
397 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
398 2885198086 Variovorax sp. 679 Isolate Unclassified
399 2885211737 Variovorax sp. 553 Isolate Unclassified
400 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
401 2899924645 Variovorax sp. 369 Isolate Unclassified
402 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
403 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
404 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
405 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
406 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
407 2928037797 Variovorax sp. 1126 Isolate Unclassified
408 2928044640 Variovorax sp. 1128 Isolate Unclassified
409 2928051484 Variovorax sp. 1133 Isolate Unclassified
410 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
411 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
412 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
413 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
414 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
415 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
416 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
417 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
418 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
419 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
420 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.22
Metatranscriptomes 0
Isolates 7.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 1.3
Rhizoplane 4.76
Rhizosphere 71.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10045374 3300006177 Bacteria 1952
2 JGI24740J21852_10006071 3300001979 Bacteria 5048
3 JGI25155J39150_1000242 3300002704 Bacteria 21207
4 JGI25156J39149_1000561 3300002705 Bacteria 21207
5 JGI25162J39368_1000317 3300002737 Bacteria 42748
6 JGI25162J39368_1000864 3300002737 Bacteria 19867
7 JGI25154J39366_1000464 3300002738 Bacteria 21207
8 JGI25157J39369_1000598 3300002741 Bacteria 21207
9 JGI25165J46597_1000432 3300003214 Bacteria 42748
10 JGI25165J46597_1000576 3300003214 Bacteria 32714
11 JGI25153J46596_10000205 3300003215 Bacteria 54275
12 JGI25153J46596_10037601 3300003215 Bacteria 1536
13 rootH1_10016771 3300003323 Bacteria 2605
14 JGI25160J50197_1000318 3300003354 Bacteria 33405
15 JGI25161J50226_1001492 3300003374 Bacteria 6965
16 Ga0055542_1000087 3300003762 Bacteria 123666
17 Ga0055542_1010920 3300003762 Bacteria 1635
18 Ga0055526_1005835 3300003771 Bacteria 6916
19 Ga0055536_1001378 3300003781 Bacteria 14760
20 Ga0055534_1001760 3300003784 Bacteria 8161
21 Ga0055530_10013202 3300003791 Bacteria 2830
22 Ga0055530_10019581 3300003791 Bacteria 2045
23 Ga0055540_1016266 3300003792 Bacteria 2124
24 Ga0055531_10023265 3300003794 Bacteria 2330
25 Ga0055543_1000414 3300004625 Bacteria 26885
26 Ga0065165_1002809 3300005262 Bacteria 13651
27 Ga0065707_10088465 3300005295 Bacteria 4640
28 Ga0070658_10021323 3300005327 Bacteria 5192
29 Ga0070676_10009783 3300005328 Bacteria 5186
30 Ga0070676_10046555 3300005328 Bacteria 2530
31 Ga0070690_100007793 3300005330 Bacteria 6138
32 Ga0070670_100001858 3300005331 Bacteria 17202
33 Ga0070670_100002742 3300005331 Bacteria 14546
34 Ga0068869_100000178 3300005334 Bacteria 32316
35 Ga0068869_100028538 3300005334 Bacteria 3901
36 Ga0070666_10028053 3300005335 Bacteria 3692
37 Ga0070666_10119415 3300005335 Bacteria 1827
38 Ga0068868_100007519 3300005338 Bacteria 7762
39 Ga0068868_100082962 3300005338 Bacteria 2572
40 Ga0070660_100000728 3300005339 Bacteria 21796
41 Ga0070689_100286869 3300005340 Bacteria 1367
42 Ga0070668_100014910 3300005347 Bacteria 5810
43 Ga0070668_100075656 3300005347 Bacteria 2629
44 Ga0070668_100202828 3300005347 Bacteria 1628
45 Ga0070669_100006527 3300005353 Bacteria 8398
46 Ga0070669_100167167 3300005353 Bacteria 1713
47 Ga0070675_100002209 3300005354 Bacteria 14434
48 Ga0070675_100126869 3300005354 Bacteria 2171
49 Ga0070671_100008025 3300005355 Bacteria 8449
50 Ga0070671_100020140 3300005355 Bacteria 5437
51 Ga0070671_100028642 3300005355 Bacteria 4588
52 Ga0070671_100031628 3300005355 Bacteria 4373
53 Ga0070674_100012576 3300005356 Bacteria 5202
54 Ga0070674_100161689 3300005356 Bacteria 1699
55 Ga0070673_100007554 3300005364 Bacteria 7185
56 Ga0070673_100029140 3300005364 Bacteria 4114
57 Ga0070673_100149983 3300005364 Bacteria 1974
58 Ga0070688_100020269 3300005365 Bacteria 3864
59 Ga0070659_100010938 3300005366 Bacteria 6697
60 Ga0070667_100001198 3300005367 Bacteria 23577
61 Ga0070667_100004710 3300005367 Bacteria 11440
62 Ga0070667_100065608 3300005367 Bacteria 3083
63 Ga0070667_100074348 3300005367 Bacteria 2899
64 Ga0070709_10000514 3300005434 Bacteria 22854
65 Ga0070714_100002111 3300005435 Bacteria 14588
66 Ga0070714_100029168 3300005435 Bacteria 4585
67 Ga0070713_100003455 3300005436 Bacteria 10434
68 Ga0070710_10000193 3300005437 Bacteria 28438
69 Ga0070711_100000687 3300005439 Bacteria 17734
70 Ga0070663_100088508 3300005455 Bacteria 2290
71 Ga0070663_100316307 3300005455 Bacteria 1254
72 Ga0070678_100003099 3300005456 Bacteria 9217
73 Ga0070678_100007564 3300005456 Bacteria 6454
74 Ga0070678_100008957 3300005456 Bacteria 6029
75 Ga0070678_100114266 3300005456 Bacteria 2117
76 Ga0070662_100010850 3300005457 Bacteria 6000
77 Ga0070681_10108829 3300005458 Bacteria 2711
78 Ga0068867_100000273 3300005459 Bacteria 33912
79 Ga0068867_100003231 3300005459 Bacteria 11490
80 Ga0068867_100007980 3300005459 Bacteria 7478
81 Ga0070707_100047056 3300005468 Bacteria 4128
82 Ga0070697_100077256 3300005536 Bacteria 2738
83 Ga0070672_100000495 3300005543 Bacteria 22911
84 Ga0070672_100006786 3300005543 Bacteria 7731
85 Ga0070672_100022728 3300005543 Bacteria 4612
86 Ga0070665_100001639 3300005548 Bacteria 25785
87 Ga0068855_100009005 3300005563 Bacteria 12061
88 Ga0068855_100028862 3300005563 Bacteria 6637
89 Ga0068855_100032192 3300005563 Bacteria 6261
90 Ga0070664_100026661 3300005564 Bacteria 4796
91 Ga0070664_100040340 3300005564 Bacteria 3935
92 Ga0070664_100193362 3300005564 Bacteria 1813
93 Ga0068857_100001689 3300005577 Bacteria 17740
94 Ga0068856_100006733 3300005614 Bacteria 11260
95 Ga0068856_100014753 3300005614 Bacteria 7540
96 Ga0068856_100253974 3300005614 Bacteria 1773
97 Ga0068852_100126581 3300005616 Bacteria 2347
98 Ga0068852_100157243 3300005616 Bacteria 2119
99 Ga0068852_100192479 3300005616 Bacteria 1925
100 Ga0068852_100321553 3300005616 Bacteria 1503
101 Ga0068859_100007644 3300005617 Bacteria 10984
102 Ga0068859_100069934 3300005617 Bacteria 3545
103 Ga0068859_100518267 3300005617 Bacteria 1287
104 Ga0068864_100000199 3300005618 Bacteria 54129
105 Ga0068864_100000873 3300005618 Bacteria 25393
106 Ga0068864_100112665 3300005618 Bacteria 2425
107 Ga0068866_10023797 3300005718 Bacteria 2854
108 Ga0068861_100001618 3300005719 Bacteria 14363
109 Ga0068861_100173167 3300005719 Bacteria 1790
110 Ga0068851_10101063 3300005834 Bacteria 1530
111 Ga0068870_10012094 3300005840 Bacteria 4023
112 Ga0068863_100001289 3300005841 Bacteria 25007
113 Ga0068863_100011193 3300005841 Bacteria 8693
114 Ga0068863_100231943 3300005841 Bacteria 1781
115 Ga0068858_100000413 3300005842 Bacteria 44413
116 Ga0068858_100008196 3300005842 Bacteria 10046
117 Ga0068858_100060477 3300005842 Bacteria 3502
118 Ga0068858_100151241 3300005842 Bacteria 2183
119 Ga0068860_100002069 3300005843 Bacteria 21141
120 Ga0068860_100011743 3300005843 Bacteria 8631
121 Ga0068860_100046991 3300005843 Bacteria 4114
122 Ga0068860_100384086 3300005843 Bacteria 1387
123 Ga0068862_100004502 3300005844 Bacteria 11751
124 Ga0068862_100042121 3300005844 Bacteria 3888
125 Ga0068862_100048689 3300005844 Bacteria 3619
126 Ga0081455_10020073 3300005937 Bacteria 6306
127 Ga0075365_10163249 3300006038 Bacteria 1553
128 Ga0070715_10102556 3300006163 Bacteria 1337
129 Ga0070716_100003662 3300006173 Bacteria 7272
130 Ga0070716_100210920 3300006173 Bacteria 1298
131 Ga0070712_100027178 3300006175 Bacteria 3819
132 Ga0075369_10002170 3300006186 Bacteria 6933
133 Ga0075366_10004099 3300006195 Bacteria 7794
134 Ga0075366_10015971 3300006195 Bacteria 4311
135 Ga0097621_100138812 3300006237 Bacteria 2076
136 Ga0097621_100142005 3300006237 Bacteria 2052
137 Ga0075370_10000663 3300006353 Bacteria 13407
138 Ga0075370_10003981 3300006353 Bacteria 7099
139 Ga0068871_100035913 3300006358 Bacteria 3941
140 Ga0068871_100066445 3300006358 Bacteria 2956
141 Ga0075428_100041477 3300006844 Bacteria 5062
142 Ga0075431_100000152 3300006847 Bacteria 47326
143 Ga0075434_100061513 3300006871 Bacteria 3736
144 Ga0075434_100276680 3300006871 Bacteria 1698
145 Ga0075429_100030414 3300006880 Bacteria 4691
146 Ga0068865_100003699 3300006881 Bacteria 9192
147 Ga0068865_100071709 3300006881 Bacteria 2458
148 Ga0075436_100041753 3300006914 Bacteria 3165
149 Ga0097620_100007644 3300006931 Bacteria 10984
150 Ga0097620_100069933 3300006931 Bacteria 3545
151 Ga0097620_100518292 3300006931 Bacteria 1287
152 Ga0075435_100032966 3300007076 Bacteria 4093
153 Ga0099794_10047769 3300007265 Bacteria 2053
154 Ga0105250_10025346 3300009092 Bacteria 2390
155 Ga0105240_10000290 3300009093 Bacteria 97921
156 Ga0105240_10031112 3300009093 Bacteria 6924
157 Ga0105240_10215127 3300009093 Bacteria 2242
158 Ga0105240_10241298 3300009093 Bacteria 2095
159 Ga0105240_10289198 3300009093 Bacteria 1880
160 Ga0111539_10000292 3300009094 Bacteria 60528
161 Ga0111539_10111188 3300009094 Bacteria 3215
162 Ga0111539_10379271 3300009094 Bacteria 1646
163 Ga0105245_10204566 3300009098 Bacteria 1897
164 Ga0105245_10267615 3300009098 Bacteria 1665
165 Ga0105247_10103494 3300009101 Bacteria 1823
166 Ga0114129_10000098 3300009147 Bacteria 84407
167 Ga0105243_10033029 3300009148 Bacteria 4000
168 Ga0105243_10106837 3300009148 Bacteria 2334
169 Ga0105243_10249511 3300009148 Bacteria 1584
170 Ga0105242_10232553 3300009176 Bacteria 1653
171 Ga0105248_10003661 3300009177 Bacteria 17051
172 Ga0105248_10034653 3300009177 Bacteria 5647
173 Ga0105237_10003258 3300009545 Bacteria 19406
174 Ga0105237_10077682 3300009545 Bacteria 3310
175 Ga0105249_10080172 3300009553 Bacteria 3032
176 Ga0105239_10000202 3300010375 Bacteria 87257
177 Ga0105239_10097562 3300010375 Bacteria 3248
178 Ga0157371_10061744 3300013102 Bacteria 2657
179 Ga0157370_10001158 3300013104 Bacteria 32901
180 Ga0157369_10010878 3300013105 Bacteria 10364
181 Ga0157369_10011564 3300013105 Bacteria 10021
182 Ga0157369_10172718 3300013105 Bacteria 2277
183 Ga0157369_10186318 3300013105 Bacteria 2182
184 Ga0157374_10045383 3300013296 Bacteria 4067
185 Ga0157378_10020149 3300013297 Bacteria 5865
186 Ga0157378_10031170 3300013297 Bacteria 4710
187 Ga0157378_10038379 3300013297 Bacteria 4245
188 Ga0163162_10001045 3300013306 Bacteria 25754
189 Ga0163162_10027013 3300013306 Bacteria 5677
190 Ga0163162_10090848 3300013306 Bacteria 3136
191 Ga0157372_10526155 3300013307 Bacteria 1378
192 Ga0157375_10022778 3300013308 Bacteria 5768
193 Ga0157375_10036004 3300013308 Bacteria 4730
194 Ga0157375_10072823 3300013308 Bacteria 3453
195 Ga0157375_10115435 3300013308 Bacteria 2788
196 Ga0157375_10159208 3300013308 Bacteria 2399
197 Ga0157375_10285616 3300013308 Bacteria 1813
198 Ga0157375_10339689 3300013308 Bacteria 1667
199 Ga0163163_10001130 3300014325 Bacteria 22677
200 Ga0163163_10003778 3300014325 Bacteria 12901
201 Ga0157380_10038599 3300014326 Bacteria 3709
202 Ga0157380_10093918 3300014326 Bacteria 2481
203 Ga0157379_10000910 3300014968 Bacteria 23882
204 Ga0157379_10051847 3300014968 Bacteria 3663
205 Ga0157379_10057660 3300014968 Bacteria 3470
206 Ga0157379_10400626 3300014968 Bacteria 1261
207 Ga0157376_10281819 3300014969 Bacteria 1565
208 Ga0182007_10000896 3300015262 Bacteria 16514
209 Ga0182007_10008539 3300015262 Bacteria 4200
210 Ga0182005_1012445 3300015265 Bacteria 2402
211 Ga0182005_1032106 3300015265 Bacteria 1429
212 Ga0183362_10002 3300015683 Bacteria 1432711
213 Ga0163161_10070858 3300017792 Bacteria 2549
214 Ga0163161_10084664 3300017792 Bacteria 2338
215 Ga0213876_10036617 3300021384 Bacteria 2588
216 Ga0213871_10028487 3300021441 Bacteria 1442
217 Ga0209435_100144 3300025206 Bacteria 24090
218 Ga0209436_101855 3300025208 Bacteria 6847
219 Ga0209672_100657 3300025228 Bacteria 17589
220 Ga0209563_109875 3300025230 Bacteria 1423
221 Ga0209437_100023 3300025233 Bacteria 614195
222 Ga0209437_100341 3300025233 Bacteria 56114
223 Ga0209258_100199 3300025242 Bacteria 123718
224 Ga0207425_1000706 3300025245 Bacteria 18059
225 Ga0209646_1000417 3300025246 Bacteria 24090
226 Ga0209026_1000576 3300025250 Bacteria 24236
227 Ga0209677_100626 3300025253 Bacteria 18962
228 Ga0209148_1000179 3300025254 Bacteria 126083
229 Ga0209148_1000447 3300025254 Bacteria 45273
230 Ga0209759_1000837 3300025256 Bacteria 24172
231 Ga0209759_1009248 3300025256 Bacteria 2992
232 Ga0209129_1000276 3300025258 Bacteria 49188
233 Ga0209233_1000062 3300025261 Bacteria 399685
234 Ga0209233_1000334 3300025261 Bacteria 48025
235 Ga0209233_1000355 3300025261 Bacteria 42800
236 Ga0209455_1009876 3300025272 Bacteria 2468
237 Ga0209130_1000271 3300025284 Bacteria 64956
238 Ga0209130_1005679 3300025284 Bacteria 4262
239 Ga0209675_1001427 3300025291 Bacteria 13809
240 Ga0209676_1001011 3300025292 Bacteria 32875
241 Ga0209676_1004121 3300025292 Bacteria 8282
242 Ga0209676_1010699 3300025292 Bacteria 3782
243 Ga0209025_1000558 3300025294 Bacteria 68589
244 Ga0209025_1001687 3300025294 Bacteria 26984
245 Ga0209564_1000537 3300025295 Bacteria 61336
246 Ga0209758_1000236 3300025297 Bacteria 115906
247 Ga0209758_1000503 3300025297 Bacteria 63354
248 Ga0209050_1002264 3300025298 Bacteria 17080
249 Ga0207426_1000454 3300025302 Bacteria 64956
250 Ga0209051_1001676 3300025303 Bacteria 17854
251 Ga0209051_1002225 3300025303 Bacteria 14314
252 Ga0209051_1019422 3300025303 Bacteria 2964
253 Ga0209257_1004340 3300025304 Bacteria 11078
254 Ga0209257_1012526 3300025304 Bacteria 3905
255 Ga0209257_1035989 3300025304 Bacteria 1525
256 Ga0207697_10008549 3300025315 Bacteria 4471
257 Ga0207656_10088987 3300025321 Bacteria 1399
258 Ga0207653_10012217 3300025885 Bacteria 2682
259 Ga0207682_10004720 3300025893 Bacteria 5653
260 Ga0207682_10005376 3300025893 Bacteria 5219
261 Ga0207682_10068113 3300025893 Bacteria 1503
262 Ga0207692_10001198 3300025898 Bacteria 9619
263 Ga0207642_10046361 3300025899 Bacteria 1936
264 Ga0207688_10056440 3300025901 Bacteria 2206
265 Ga0207680_10042734 3300025903 Bacteria 2654
266 Ga0207680_10060670 3300025903 Bacteria 2303
267 Ga0207680_10118722 3300025903 Bacteria 1726
268 Ga0207647_10146383 3300025904 Bacteria 1382
269 Ga0207685_10073205 3300025905 Bacteria 1395
270 Ga0207699_10002099 3300025906 Bacteria 9425
271 Ga0207645_10075480 3300025907 Bacteria 2158
272 Ga0207643_10003872 3300025908 Bacteria 8051
273 Ga0207705_10002399 3300025909 Bacteria 14469
274 Ga0207684_10246964 3300025910 Bacteria 1540
275 Ga0207695_10000385 3300025913 Bacteria 99958
276 Ga0207695_10029073 3300025913 Bacteria 6116
277 Ga0207695_10066854 3300025913 Bacteria 3689
278 Ga0207695_10088048 3300025913 Bacteria 3126
279 Ga0207695_10234054 3300025913 Bacteria 1740
280 Ga0207671_10001213 3300025914 Bacteria 30631
281 Ga0207693_10028839 3300025915 Bacteria 4386
282 Ga0207657_10000146 3300025919 Bacteria 71932
283 Ga0207657_10152273 3300025919 Bacteria 1883
284 Ga0207646_10003436 3300025922 Bacteria 17890
285 Ga0207681_10008008 3300025923 Bacteria 6464
286 Ga0207681_10035131 3300025923 Bacteria 3301
287 Ga0207681_10117625 3300025923 Bacteria 1944
288 Ga0207694_10002311 3300025924 Bacteria 15592
289 Ga0207650_10000395 3300025925 Bacteria 39717
290 Ga0207650_10011031 3300025925 Bacteria 6213
291 Ga0207650_10267282 3300025925 Bacteria 1389
292 Ga0207659_10005943 3300025926 Bacteria 7447
293 Ga0207659_10191254 3300025926 Bacteria 1629
294 Ga0207687_10051935 3300025927 Bacteria 2859
295 Ga0207687_10085996 3300025927 Bacteria 2282
296 Ga0207700_10004196 3300025928 Bacteria 8460
297 Ga0207664_10088265 3300025929 Bacteria 2537
298 Ga0207644_10041513 3300025931 Bacteria 3255
299 Ga0207690_10143940 3300025932 Bacteria 1760
300 Ga0207706_10011964 3300025933 Bacteria 7902
301 Ga0207709_10029080 3300025935 Bacteria 3201
302 Ga0207709_10059974 3300025935 Bacteria 2370
303 Ga0207704_10001633 3300025938 Bacteria 10052
304 Ga0207704_10008252 3300025938 Bacteria 4966
305 Ga0207704_10038224 3300025938 Bacteria 2781
306 Ga0207665_10002946 3300025939 Bacteria 11406
307 Ga0207665_10127871 3300025939 Bacteria 1800
308 Ga0207691_10001565 3300025940 Bacteria 22717
309 Ga0207691_10007092 3300025940 Bacteria 10819
310 Ga0207691_10035729 3300025940 Bacteria 4609
311 Ga0207691_10118119 3300025940 Bacteria 2353
312 Ga0207711_10013035 3300025941 Bacteria 6905
313 Ga0207689_10000049 3300025942 Bacteria 88948
314 Ga0207689_10282531 3300025942 Bacteria 1374
315 Ga0207679_10012458 3300025945 Bacteria 5546
316 Ga0207679_10026243 3300025945 Bacteria 4016
317 Ga0207679_10179191 3300025945 Bacteria 1751
318 Ga0207667_10025609 3300025949 Bacteria 6454
319 Ga0207667_10058578 3300025949 Bacteria 4039
320 Ga0207651_10034058 3300025960 Bacteria 3293
321 Ga0207651_10098609 3300025960 Bacteria 2161
322 Ga0207651_10118666 3300025960 Bacteria 2001
323 Ga0207668_10017098 3300025972 Bacteria 4538
324 Ga0207658_10153197 3300025986 Bacteria 1880
325 Ga0207677_10023718 3300026023 Bacteria 3796
326 Ga0207677_10063439 3300026023 Bacteria 2569
327 Ga0207703_10003906 3300026035 Bacteria 12376
328 Ga0207703_10038915 3300026035 Bacteria 3798
329 Ga0207703_10044254 3300026035 Bacteria 3577
330 Ga0207702_10007711 3300026078 Bacteria 9142
331 Ga0207702_10010905 3300026078 Bacteria 7580
332 Ga0207641_10001628 3300026088 Bacteria 21895
333 Ga0207641_10009424 3300026088 Bacteria 8044
334 Ga0207648_10000487 3300026089 Bacteria 44153
335 Ga0207648_10002306 3300026089 Bacteria 20605
336 Ga0207648_10121691 3300026089 Bacteria 2295
337 Ga0207676_10004825 3300026095 Bacteria 9564
338 Ga0207676_10011027 3300026095 Bacteria 6451
339 Ga0207676_10012619 3300026095 Bacteria 6060
340 Ga0207674_10000155 3300026116 Bacteria 80715
341 Ga0207674_10003275 3300026116 Bacteria 19914
342 Ga0207675_100000368 3300026118 Bacteria 43073
343 Ga0207675_100003946 3300026118 Bacteria 14398
344 Ga0207675_100140955 3300026118 Bacteria 2290
345 Ga0207683_10004829 3300026121 Bacteria 11608
346 Ga0207683_10018277 3300026121 Bacteria 5980
347 Ga0207698_10068163 3300026142 Bacteria 2808
348 Ga0207698_10141651 3300026142 Bacteria 2073
349 Ga0209371_1002417 3300027312 Bacteria 10478
350 Ga0209588_1022262 3300027671 Bacteria 1994
351 Ga0268266_10076699 3300028379 Bacteria 2905
352 Ga0268265_10002358 3300028380 Bacteria 14304
353 Ga0268265_10004246 3300028380 Bacteria 10003
354 Ga0268265_10121019 3300028380 Bacteria 2156
355 Ga0268264_10000624 3300028381 Bacteria 42120
356 Ga0268264_10000850 3300028381 Bacteria 32562
357 Ga0268264_10034838 3300028381 Bacteria 4143
358 Ga0307515_10000399 3300028794 Bacteria 105068
359 Ga0307515_10000424 3300028794 Bacteria 101910
360 Ga0307515_10236737 3300028794 Bacteria 1605
361 Ga0268256_1001637 3300030500 Bacteria 12932
362 Ga0265327_10000186 3300031251 Bacteria 131420
363 Ga0307513_10015075 3300031456 Bacteria 9380
364 Ga0307513_10232309 3300031456 Bacteria 1656
365 Ga0307508_10000532 3300031616 Bacteria 45338
366 Ga0307405_10005759 3300031731 Bacteria 6024
367 Ga0307413_10015566 3300031824 Bacteria 3902
368 Ga0307410_10012401 3300031852 Bacteria 4928
369 Ga0307414_10031522 3300032004 Bacteria 3479
370 Ga0307411_10226367 3300032005 Bacteria 1454
371 Ga0373946_0073741 3300035171 Bacteria 1480
372 Ga0373955_0067667 3300035172 Bacteria 1989
373 Ga0373931_0088385 3300035691 Bacteria 1722
374 Ga0373937_0032807 3300036401 Bacteria 4712
375 Ga0373925_0001392 3300037068 Bacteria 21050
376 Ga0373925_0035576 3300037068 Bacteria 3675
377 Ga0395898_0241340 3300037466 Bacteria 1723
378 Ga0395901_0014056 3300038443 Bacteria 8149
379 Ga0395901_0160860 3300038443 Bacteria 2358
380 Ga0436365_0666443 3300039437 Bacteria 1562
381 Ga0436365_1783375 3300039437 Bacteria 2026
382 Ga0436360_0852056 3300039438 Bacteria 5049
383 Ga0436361_0262290 3300039447 Bacteria 2247
384 Ga0439436_0009273 3300041404 Bacteria 3016
385 Ga0439439_0001406 3300041406 Bacteria 4774
386 Ga0439439_0018455 3300041406 Bacteria 1724
387 Ga0439453_0000029 3300041408 Bacteria 9385
388 Ga0439465_0000828 3300041413 Bacteria 9727
389 Ga0439431_0017960 3300041997 Bacteria 1669
390 Ga0439462_0005777 3300042015 Bacteria 3062
391 Ga0450923_004872 3300042125 Bacteria 2133
392 Ga0450898_000954 3300042134 Bacteria 3632
393 Ga0450899_001133 3300042135 Bacteria 3033
394 Ga0439435_0000212 3300042436 Bacteria 8204
395 Ga0439460_0003493 3300042461 Bacteria 3799
396 Ga0439460_0027573 3300042461 Bacteria 1596
397 Ga0495627_004690 3300046453 Bacteria 5653
398 Ga0495592_0010207 3300046454 Bacteria 7078
399 Ga0495590_0025064 3300046457 Bacteria 2098
400 Ga0495629_0000042 3300046459 Bacteria 112605
401 Ga0495629_0009772 3300046459 Bacteria 7002
402 Ga0495629_0016766 3300046459 Bacteria 5257
403 Ga0495638_0019667 3300046460 Bacteria 4466
404 Ga0495641_0006590 3300046461 Bacteria 7483
405 Ga0495651_0078031 3300046462 Bacteria 2506
406 Ga0495653_0013257 3300046463 Bacteria 6720
407 Ga0495650_0024031 3300046471 Bacteria 2887
408 Ga0495580_0000479 3300046472 Bacteria 33347
409 Ga0495580_0014603 3300046472 Bacteria 5952
410 Ga0495582_0000778 3300046473 Bacteria 17668
411 Ga0495605_0002559 3300046474 Bacteria 11180
412 Ga0495605_0013110 3300046474 Bacteria 4580
413 Ga0495664_0000344 3300046477 Bacteria 22543
414 Ga0495664_0039719 3300046477 Bacteria 2781
415 Ga0495664_0041532 3300046477 Bacteria 2721
416 Ga0495664_0061348 3300046477 Bacteria 2239
417 Ga0495594_0007150 3300046499 Bacteria 5744
418 Ga0495583_0004161 3300046506 Bacteria 10547
419 Ga0495583_0011018 3300046506 Bacteria 5214
420 Ga0495583_0037996 3300046506 Bacteria 2278
421 Ga0495606_0049564 3300046507 Bacteria 2753
422 Ga0495610_0016861 3300046512 Bacteria 4186
423 Ga0495618_0006127 3300046514 Bacteria 7295
424 Ga0495620_0041443 3300046515 Bacteria 2019
425 Ga0495628_0003840 3300046516 Bacteria 13397
426 Ga0495628_0021909 3300046516 Bacteria 5251
427 Ga0495628_0022620 3300046516 Bacteria 5163
428 Ga0495630_0001703 3300046517 Bacteria 15354
429 Ga0495630_0006855 3300046517 Bacteria 8118
430 Ga0495637_0000901 3300046520 Bacteria 19149
431 Ga0495643_0010277 3300046522 Bacteria 5764
432 Ga0495648_0000909 3300046524 Bacteria 30910
433 Ga0495648_0002717 3300046524 Bacteria 15980
434 Ga0495648_0004253 3300046524 Bacteria 12282
435 Ga0495648_0029227 3300046524 Bacteria 3661
436 Ga0495648_0041104 3300046524 Bacteria 2923
437 Ga0495666_0001722 3300046526 Bacteria 10792
438 Ga0495642_0012367 3300046528 Bacteria 3290
439 Ga0495652_0016109 3300046529 Bacteria 6687
440 Ga0495665_0007323 3300046531 Bacteria 5962
441 Ga0495665_0013747 3300046531 Bacteria 4371
442 Ga0495640_0002326 3300046533 Bacteria 15238
443 Ga0495586_0003517 3300046535 Bacteria 8396
444 Ga0495586_0016211 3300046535 Bacteria 3964
445 Ga0495587_0001881 3300046536 Bacteria 13965
446 Ga0495597_0004407 3300046542 Bacteria 7743
447 Ga0495645_0005460 3300046543 Bacteria 8729
448 Ga0495645_0100191 3300046543 Bacteria 2060
449 Ga0495645_0110725 3300046543 Bacteria 1943
450 Ga0495622_0011054 3300046557 Bacteria 4167
451 Ga0495656_0000150 3300046615 Bacteria 25764
452 Ga0495668_0026272 3300046616 Bacteria 3305
453 Ga0495634_0002290 3300046642 Bacteria 16016
454 Ga0495625_0151883 3300046660 Bacteria 1556
455 Ga0495635_0007409 3300046663 Bacteria 7657
456 Ga0495661_0003670 3300046665 Bacteria 11274
457 Ga0495588_0006080 3300046674 Bacteria 5417
458 Ga0495588_0006224 3300046674 Bacteria 5364
459 Ga0495599_0013555 3300046678 Bacteria 5036
460 Ga0495623_0027377 3300046679 Bacteria 3667
461 Ga0495623_0034052 3300046679 Bacteria 3267
462 Ga0495646_0013476 3300046680 Bacteria 5196
463 Ga0495646_0014462 3300046680 Bacteria 5019
464 Ga0495646_0040371 3300046680 Bacteria 2875
465 Ga0495647_0012271 3300046681 Bacteria 2948
466 Ga0495658_0124424 3300046683 Bacteria 1563
467 Ga0495669_0015016 3300046684 Bacteria 3312
468 Ga0495613_0039117 3300046689 Bacteria 3516
469 Ga0495624_0000075 3300046690 Bacteria 64684
470 Ga0495624_0009522 3300046690 Bacteria 6728
471 Ga0495671_0002256 3300046692 Bacteria 12249
472 Ga0495671_0016710 3300046692 Bacteria 3913
473 Ga0495649_0003850 3300046694 Bacteria 9937
474 Ga0495589_0015981 3300046794 Bacteria 3858
475 Ga0495589_0048173 3300046794 Bacteria 2110
476 Ga0495600_0020766 3300046809 Bacteria 4202
477 Ga0495600_0049456 3300046809 Bacteria 2743
478 Ga0495581_0001173 3300047315 Bacteria 14368
479 Ga0495581_0027568 3300047315 Bacteria 3294
480 Ga0495604_0004823 3300047317 Bacteria 10692
481 Ga0495604_0006838 3300047317 Bacteria 9035
482 Ga0495604_0049253 3300047317 Bacteria 3274
483 Ga0495674_0009080 3300047319 Bacteria 9443
484 Ga0495674_0014689 3300047319 Bacteria 7327
485 Ga0495674_0031684 3300047319 Bacteria 4800
486 Ga0495674_0100053 3300047319 Bacteria 2468
487 Ga0495672_0022133 3300047320 Bacteria 4137
488 Ga0495672_0051961 3300047320 Bacteria 2410
489 Ga0495680_0003981 3300047322 Bacteria 14271
490 Ga0495680_0014609 3300047322 Bacteria 6795
491 Ga0495680_0064330 3300047322 Bacteria 2813
492 Ga0495680_0071796 3300047322 Bacteria 2634
493 Ga0495683_0055178 3300047323 Bacteria 1978
494 Ga0495687_000147 3300047443 Bacteria 107007
495 Ga0495687_021603 3300047443 Bacteria 3109
496 Ga0495687_049561 3300047443 Bacteria 1794
497 Ga0495675_0016798 3300047444 Bacteria 4628
498 Ga0495675_0022124 3300047444 Bacteria 4052
499 Ga0495679_001149 3300047446 Bacteria 15834
500 Ga0495684_0013565 3300047471 Bacteria 6274
501 Ga0495593_0001649 3300047673 Bacteria 13211
502 Ga0495593_0001848 3300047673 Bacteria 12592
503 Ga0495593_0003306 3300047673 Bacteria 9659
504 Ga0495593_0010126 3300047673 Bacteria 5455
505 Ga0495602_0005852 3300048088 Bacteria 12905
506 Ga0495602_0020836 3300048088 Bacteria 6470
507 Ga0495602_0028183 3300048088 Bacteria 5379
508 Ga0495614_0006482 3300048089 Bacteria 5251
509 Ga0495626_0039910 3300048091 Bacteria 2219
510 Ga0496100_0025131 3300048903 Bacteria 3640
511 Ga0496100_0025833 3300048903 Bacteria 3594
512 Ga0496100_0062160 3300048903 Bacteria 2463
513 Ga0496100_0091384 3300048903 Bacteria 2077
514 Ga0496100_0137685 3300048903 Bacteria 1727
515 Ga0496101_0001910 3300048904 Bacteria 12588
516 Ga0496101_0054911 3300048904 Bacteria 2875
517 Ga0496101_0073423 3300048904 Bacteria 2513
518 Ga0496102_0003005 3300048905 Bacteria 14284
519 Ga0496102_0015420 3300048905 Bacteria 6656
520 Ga0496103_0033353 3300048906 Bacteria 3145
521 Ga0496103_0035343 3300048906 Bacteria 3059
522 Ga0496104_0001735 3300048907 Bacteria 18835
523 Ga0496105_0002350 3300048908 Bacteria 13708
524 Ga0496105_0011976 3300048908 Bacteria 6866
525 Ga0496105_0053987 3300048908 Bacteria 3318
526 Ga0496106_0009132 3300048909 Bacteria 7327
527 Ga0496107_0210955 3300048910 Bacteria 1444
528 Ga0496108_0010142 3300048911 Bacteria 7645
529 Ga0496108_0370951 3300048911 Bacteria 1249
530 Ga0496109_0012474 3300048912 Bacteria 7338
531 Ga0496109_0066846 3300048912 Bacteria 3292
532 Ga0496110_0149321 3300048913 Bacteria 2115
533 Ga0496111_0069869 3300048914 Bacteria 2554
534 Ga0496112_0004400 3300048915 Bacteria 11918
535 Ga0496113_0001673 3300048916 Bacteria 12543
536 Ga0496113_0090440 3300048916 Bacteria 2358
537 Ga0496113_0260344 3300048916 Bacteria 1386
538 Ga0496113_0369561 3300048916 Bacteria 1151
539 Ga0496114_0073808 3300048917 Bacteria 2871
540 Ga0496115_0018218 3300048918 Bacteria 5387
541 Ga0496115_0139786 3300048918 Bacteria 1998
542 Ga0496116_0072222 3300048919 Bacteria 2182
543 Ga0496117_0014859 3300048920 Bacteria 6680
544 Ga0496117_0052334 3300048920 Bacteria 2877
545 Ga0496117_0088750 3300048920 Bacteria 1999
546 Ga0496118_0008375 3300048921 Bacteria 10696
547 Ga0496118_0011188 3300048921 Bacteria 8785
548 Ga0496119_0014868 3300048922 Bacteria 6051
549 Ga0496119_0080118 3300048922 Bacteria 1884
550 Ga0496120_0036007 3300048923 Bacteria 2951
551 Ga0496121_0000084 3300048924 Bacteria 225942
552 Ga0496121_0003493 3300048924 Bacteria 22347
553 Ga0496121_0011485 3300048924 Bacteria 9820
554 Ga0496121_0072323 3300048924 Bacteria 2769
555 Ga0496122_0006869 3300048925 Bacteria 12885
556 Ga0496122_0010408 3300048925 Bacteria 9596
557 Ga0496122_0019831 3300048925 Bacteria 6120
558 Ga0496122_0027177 3300048925 Bacteria 4901
559 Ga0496122_0119418 3300048925 Bacteria 1705
560 Ga0496123_0036994 3300048926 Bacteria 3452
561 Ga0496123_0048088 3300048926 Bacteria 2873
562 Ga0496124_0004794 3300048927 Bacteria 15575
563 Ga0496124_0054025 3300048927 Bacteria 3402
564 Ga0496125_0001087 3300048928 Bacteria 41885
565 Ga0496125_0001432 3300048928 Bacteria 34774
566 Ga0496125_0002419 3300048928 Bacteria 24266
567 Ga0496125_0002566 3300048928 Bacteria 23401
568 Ga0496125_0125913 3300048928 Bacteria 1816
569 Ga0496125_0167050 3300048928 Bacteria 1485
570 Ga0496126_0023704 3300048929 Bacteria 5944
571 Ga0496126_0089826 3300048929 Bacteria 2703
572 Ga0496126_0097403 3300048929 Bacteria 2578
573 Ga0495682_0004314 3300049460 Bacteria 6122
574 Ga0501031_0042011 3300049568 Bacteria 2985
575 Ga0501032_0002637 3300049569 Bacteria 13986
576 Ga0501032_0029949 3300049569 Bacteria 3733
577 Ga0501033_0000276 3300049570 Bacteria 49581
578 Ga0501033_0036165 3300049570 Bacteria 3701
579 Ga0501034_0000379 3300049571 Bacteria 75837
580 Ga0501036_0108310 3300049572 Bacteria 2349
581 Ga0501037_0000143 3300049573 Bacteria 66427
582 Ga0501037_0040213 3300049573 Bacteria 3441
583 Ga0501038_0056727 3300049574 Bacteria 3364
584 Ga0501043_0000032 3300049579 Bacteria 140037
585 Ga0501047_0014489 3300049581 Bacteria 7499
586 Ga0501047_0040382 3300049581 Bacteria 4512
587 Ga0501068_0012091 3300049584 Bacteria 4885
588 Ga0501069_0000040 3300049585 Bacteria 81558
589 Ga0501069_0034666 3300049585 Bacteria 2779
590 Ga0501069_0092312 3300049585 Bacteria 1712
591 Ga0501070_0000715 3300049586 Bacteria 30313
592 Ga0501070_0000836 3300049586 Bacteria 27961
593 Ga0501070_0005073 3300049586 Bacteria 11219
594 Ga0501071_0065038 3300049587 Bacteria 2647
595 Ga0501071_0153903 3300049587 Bacteria 1716
596 Ga0501074_0000057 3300049590 Bacteria 55240
597 Ga0501074_0124027 3300049590 Bacteria 1847
598 Ga0501080_0000098 3300049742 Bacteria 59158
599 Ga0501080_0009194 3300049742 Bacteria 9003
600 Ga0501080_0014666 3300049742 Bacteria 7217
601 Ga0501080_0291856 3300049742 Bacteria 1481
602 Ga0501083_0000036 3300049744 Bacteria 95904
603 Ga0501035_0000025 3300049822 Bacteria 204195
604 Ga0501035_0008631 3300049822 Bacteria 9483
605 Ga0501035_0010411 3300049822 Bacteria 8620
606 Ga0501035_0017473 3300049822 Bacteria 6616
607 Ga0501035_0064407 3300049822 Bacteria 3258
608 Ga0501044_0000031 3300049823 Bacteria 173135
609 Ga0501044_0028094 3300049823 Bacteria 5937
610 Ga0501044_0055031 3300049823 Bacteria 4087
611 Ga0501044_0082985 3300049823 Bacteria 3241
612 Ga0501044_0088230 3300049823 Bacteria 3131
613 Ga0501044_0267461 3300049823 Bacteria 1646
614 nmdc:mga03683_4152_c1 3300050489 Bacteria 4766
615 nmdc:mga0k408_60168_c1 3300050493 Bacteria 2207
616 nmdc:mga06z11_25860_c1 3300050494 Bacteria 2787
617 nmdc:mga07m45_198_c1 3300050496 Bacteria 23815
618 nmdc:mga05p37_46_c1 3300050507 Bacteria 105665
619 nmdc:mga09592_19040_c1 3300050508 Bacteria 5633
620 nmdc:mga0qj67_7572_c1 3300050509 Bacteria 8023
621 nmdc:mga06r32_73_c1 3300050510 Bacteria 65778
622 nmdc:mga08y16_721_c1 3300050511 Bacteria 31352
623 nmdc:mga0n895_243935_c1 3300050512 Bacteria 1823
624 nmdc:mga0n895_513967_c1 3300050512 Bacteria 1206
625 nmdc:mga0n895_95971_c1 3300050512 Bacteria 2970
626 nmdc:mga0rr50_75925_c1 3300050513 Bacteria 2578
627 nmdc:mga08x19_90094_c1 3300050514 Bacteria 2023
628 nmdc:mga0a205_83909_c1 3300050515 Bacteria 3077
629 nmdc:mga0sz30_1446_c1 3300050516 Bacteria 8488
630 Ga0495601_0022135 3300053077 Bacteria 3901
631 Ga0500610_0000499 3300053079 Bacteria 12075
632 Ga0500610_0003403 3300053079 Bacteria 6096
633 Ga0500593_000167 3300053117 Bacteria 26501
634 Ga0500607_002228 3300053121 Bacteria 16005
635 Ga0500607_007791 3300053121 Bacteria 6575
636 Ga0500608_001220 3300053122 Bacteria 9189
637 Ga0500618_017455 3300053125 Bacteria 1785
638 Ga0500568_0003013 3300053139 Bacteria 9632
639 Ga0500616_0000294 3300053153 Bacteria 72551
640 Ga0500634_0000177 3300053161 Bacteria 21112
641 2511170887 2510917026 Bacteria 7046020
642 2511194183 2510917030 Bacteria 7460662
643 2514591189 2513237351 Bacteria 6968952
644 2563065010 2562617112 Bacteria 10918404
645 2585278014 2582581308 Bacteria 7413247
646 2585328310 2582581315 Bacteria 7318924
647 2585536933 2585427527 Bacteria 7273426
648 2585554569 2585427530 Bacteria 7383882
649 2585996416 2585427633 Bacteria 6413184
650 2586001026 2585427634 Bacteria 6455027
651 2616309064 2615840626 Bacteria 7921970
652 2616552588 2615840698 Bacteria 7319877
653 2617383191 2617270742 Bacteria 6808054
654 2643808899 2643221557 Bacteria 7184309
655 2643811234 2643221558 Bacteria 5460675
656 2644064337 2643221610 Bacteria 7480339
657 2644379710 2643221668 Bacteria 7306521
658 2644416168 2643221675 Bacteria 7473456
659 2644449209 2643221680 Bacteria 7473610
660 2644674087 2643221723 Bacteria 7095460
661 2644691966 2643221726 Bacteria 7455827
662 2671116722 2667528174 Bacteria 6435400
663 2713482001 2711768613 Bacteria 11048459
664 2738722149 2738541277 Bacteria 7458140
665 2738881213 2738541307 Bacteria 8606193
666 2739282513 2738543019 Bacteria 7459457
667 2778178836 2775507266 Bacteria 7392367
668 2819596421 2818991446 Bacteria 7757362
669 2819644019 2818991453 Bacteria 7181617
670 2842485734 2842482326 Bacteria 7212537
671 2852394753 2852387548 Bacteria 8025568
672 2885199554 2885198086 Bacteria 7212419
673 2885213173 2885211737 Bacteria 7212420
674 2885278794 2885270888 Bacteria 9831543
675 2899931131 2899924645 Bacteria 7487985
676 2901307534 2901300506 Bacteria 8463898
677 2919104746 2919100787 Bacteria 7710546
678 2919174501 2919171160 Bacteria 6499771
679 2919414139 2919408235 Bacteria 6149349
680 2920827444 2920822456 Bacteria 6897201
681 2928038091 2928037797 Bacteria 7273642
682 2928046303 2928044640 Bacteria 7271509
683 2928053998 2928051484 Bacteria 7773759
684 2928065750 2928064002 Bacteria 7419480
685 2945969297 2945968032 Bacteria 4111363
686 2995393931 2995392953 Bacteria 4539380
687 2996312338 2996310559 Bacteria 6357320
688 3005410384 3005409236 Bacteria 7188837
689 3005423492 3005416602 Bacteria 7064308
690 8005321006 8005314921 Bacteria 7072929
691 8005486340 8005484373 Bacteria 6297373
692 8005683953 8005682033 Bacteria 6726518
693 8018151197 8018150411 Bacteria 5549903
694 8046771300 8046767195 Bacteria 7547379
695 Ga0075362_10045374
696 JGI24740J21852_10006071
697 JGI25155J39150_1000242
698 JGI25156J39149_1000561
699 JGI25162J39368_1000317
700 JGI25162J39368_1000864
701 JGI25154J39366_1000464
702 JGI25157J39369_1000598
703 JGI25165J46597_1000432
704 JGI25165J46597_1000576
705 JGI25153J46596_10000205
706 JGI25153J46596_10037601
707 rootH1_10016771
708 JGI25160J50197_1000318
709 JGI25161J50226_1001492
710 Ga0055542_1000087
711 Ga0055542_1010920
712 Ga0055526_1005835
713 Ga0055536_1001378
714 Ga0055534_1001760
715 Ga0055530_10013202
716 Ga0055530_10019581
717 Ga0055540_1016266
718 Ga0055531_10023265
719 Ga0055543_1000414
720 Ga0065165_1002809
721 Ga0065707_10088465
722 Ga0070658_10021323
723 Ga0070676_10009783
724 Ga0070676_10046555
725 Ga0070690_100007793
726 Ga0070670_100001858
727 Ga0070670_100002742
728 Ga0068869_100000178
729 Ga0068869_100028538
730 Ga0070666_10028053
731 Ga0070666_10119415
732 Ga0068868_100007519
733 Ga0068868_100082962
734 Ga0070660_100000728
735 Ga0070689_100286869
736 Ga0070668_100014910
737 Ga0070668_100075656
738 Ga0070668_100202828
739 Ga0070669_100006527
740 Ga0070669_100167167
741 Ga0070675_100002209
742 Ga0070675_100126869
743 Ga0070671_100008025
744 Ga0070671_100020140
745 Ga0070671_100028642
746 Ga0070671_100031628
747 Ga0070674_100012576
748 Ga0070674_100161689
749 Ga0070673_100007554
750 Ga0070673_100029140
751 Ga0070673_100149983
752 Ga0070688_100020269
753 Ga0070659_100010938
754 Ga0070667_100001198
755 Ga0070667_100004710
756 Ga0070667_100065608
757 Ga0070667_100074348
758 Ga0070709_10000514
759 Ga0070714_100002111
760 Ga0070714_100029168
761 Ga0070713_100003455
762 Ga0070710_10000193
763 Ga0070711_100000687
764 Ga0070663_100088508
765 Ga0070663_100316307
766 Ga0070678_100003099
767 Ga0070678_100007564
768 Ga0070678_100008957
769 Ga0070678_100114266
770 Ga0070662_100010850
771 Ga0070681_10108829
772 Ga0068867_100000273
773 Ga0068867_100003231
774 Ga0068867_100007980
775 Ga0070707_100047056
776 Ga0070697_100077256
777 Ga0070672_100000495
778 Ga0070672_100006786
779 Ga0070672_100022728
780 Ga0070665_100001639
781 Ga0068855_100009005
782 Ga0068855_100028862
783 Ga0068855_100032192
784 Ga0070664_100026661
785 Ga0070664_100040340
786 Ga0070664_100193362
787 Ga0068857_100001689
788 Ga0068856_100006733
789 Ga0068856_100014753
790 Ga0068856_100253974
791 Ga0068852_100126581
792 Ga0068852_100157243
793 Ga0068852_100192479
794 Ga0068852_100321553
795 Ga0068859_100007644
796 Ga0068859_100069934
797 Ga0068859_100518267
798 Ga0068864_100000199
799 Ga0068864_100000873
800 Ga0068864_100112665
801 Ga0068866_10023797
802 Ga0068861_100001618
803 Ga0068861_100173167
804 Ga0068851_10101063
805 Ga0068870_10012094
806 Ga0068863_100001289
807 Ga0068863_100011193
808 Ga0068863_100231943
809 Ga0068858_100000413
810 Ga0068858_100008196
811 Ga0068858_100060477
812 Ga0068858_100151241
813 Ga0068860_100002069
814 Ga0068860_100011743
815 Ga0068860_100046991
816 Ga0068860_100384086
817 Ga0068862_100004502
818 Ga0068862_100042121
819 Ga0068862_100048689
820 Ga0081455_10020073
821 Ga0075365_10163249
822 Ga0070715_10102556
823 Ga0070716_100003662
824 Ga0070716_100210920
825 Ga0070712_100027178
826 Ga0075369_10002170
827 Ga0075366_10004099
828 Ga0075366_10015971
829 Ga0097621_100138812
830 Ga0097621_100142005
831 Ga0075370_10000663
832 Ga0075370_10003981
833 Ga0068871_100035913
834 Ga0068871_100066445
835 Ga0075428_100041477
836 Ga0075431_100000152
837 Ga0075434_100061513
838 Ga0075434_100276680
839 Ga0075429_100030414
840 Ga0068865_100003699
841 Ga0068865_100071709
842 Ga0075436_100041753
843 Ga0097620_100007644
844 Ga0097620_100069933
845 Ga0097620_100518292
846 Ga0075435_100032966
847 Ga0099794_10047769
848 Ga0105250_10025346
849 Ga0105240_10000290
850 Ga0105240_10031112
851 Ga0105240_10215127
852 Ga0105240_10241298
853 Ga0105240_10289198
854 Ga0111539_10000292
855 Ga0111539_10111188
856 Ga0111539_10379271
857 Ga0105245_10204566
858 Ga0105245_10267615
859 Ga0105247_10103494
860 Ga0114129_10000098
861 Ga0105243_10033029
862 Ga0105243_10106837
863 Ga0105243_10249511
864 Ga0105242_10232553
865 Ga0105248_10003661
866 Ga0105248_10034653
867 Ga0105237_10003258
868 Ga0105237_10077682
869 Ga0105249_10080172
870 Ga0105239_10000202
871 Ga0105239_10097562
872 Ga0157371_10061744
873 Ga0157370_10001158
874 Ga0157369_10010878
875 Ga0157369_10011564
876 Ga0157369_10172718
877 Ga0157369_10186318
878 Ga0157374_10045383
879 Ga0157378_10020149
880 Ga0157378_10031170
881 Ga0157378_10038379
882 Ga0163162_10001045
883 Ga0163162_10027013
884 Ga0163162_10090848
885 Ga0157372_10526155
886 Ga0157375_10022778
887 Ga0157375_10036004
888 Ga0157375_10072823
889 Ga0157375_10115435
890 Ga0157375_10159208
891 Ga0157375_10285616
892 Ga0157375_10339689
893 Ga0163163_10001130
894 Ga0163163_10003778
895 Ga0157380_10038599
896 Ga0157380_10093918
897 Ga0157379_10000910
898 Ga0157379_10051847
899 Ga0157379_10057660
900 Ga0157379_10400626
901 Ga0157376_10281819
902 Ga0182007_10000896
903 Ga0182007_10008539
904 Ga0182005_1012445
905 Ga0182005_1032106
906 Ga0183362_10002
907 Ga0163161_10070858
908 Ga0163161_10084664
909 Ga0213876_10036617
910 Ga0213871_10028487
911 Ga0209435_100144
912 Ga0209436_101855
913 Ga0209672_100657
914 Ga0209563_109875
915 Ga0209437_100023
916 Ga0209437_100341
917 Ga0209258_100199
918 Ga0207425_1000706
919 Ga0209646_1000417
920 Ga0209026_1000576
921 Ga0209677_100626
922 Ga0209148_1000179
923 Ga0209148_1000447
924 Ga0209759_1000837
925 Ga0209759_1009248
926 Ga0209129_1000276
927 Ga0209233_1000062
928 Ga0209233_1000334
929 Ga0209233_1000355
930 Ga0209455_1009876
931 Ga0209130_1000271
932 Ga0209130_1005679
933 Ga0209675_1001427
934 Ga0209676_1001011
935 Ga0209676_1004121
936 Ga0209676_1010699
937 Ga0209025_1000558
938 Ga0209025_1001687
939 Ga0209564_1000537
940 Ga0209758_1000236
941 Ga0209758_1000503
942 Ga0209050_1002264
943 Ga0207426_1000454
944 Ga0209051_1001676
945 Ga0209051_1002225
946 Ga0209051_1019422
947 Ga0209257_1004340
948 Ga0209257_1012526
949 Ga0209257_1035989
950 Ga0207697_10008549
951 Ga0207656_10088987
952 Ga0207653_10012217
953 Ga0207682_10004720
954 Ga0207682_10005376
955 Ga0207682_10068113
956 Ga0207692_10001198
957 Ga0207642_10046361
958 Ga0207688_10056440
959 Ga0207680_10042734
960 Ga0207680_10060670
961 Ga0207680_10118722
962 Ga0207647_10146383
963 Ga0207685_10073205
964 Ga0207699_10002099
965 Ga0207645_10075480
966 Ga0207643_10003872
967 Ga0207705_10002399
968 Ga0207684_10246964
969 Ga0207695_10000385
970 Ga0207695_10029073
971 Ga0207695_10066854
972 Ga0207695_10088048
973 Ga0207695_10234054
974 Ga0207671_10001213
975 Ga0207693_10028839
976 Ga0207657_10000146
977 Ga0207657_10152273
978 Ga0207646_10003436
979 Ga0207681_10008008
980 Ga0207681_10035131
981 Ga0207681_10117625
982 Ga0207694_10002311
983 Ga0207650_10000395
984 Ga0207650_10011031
985 Ga0207650_10267282
986 Ga0207659_10005943
987 Ga0207659_10191254
988 Ga0207687_10051935
989 Ga0207687_10085996
990 Ga0207700_10004196
991 Ga0207664_10088265
992 Ga0207644_10041513
993 Ga0207690_10143940
994 Ga0207706_10011964
995 Ga0207709_10029080
996 Ga0207709_10059974
997 Ga0207704_10001633
998 Ga0207704_10008252
999 Ga0207704_10038224
1000 Ga0207665_10002946
1001 Ga0207665_10127871
1002 Ga0207691_10001565
1003 Ga0207691_10007092
1004 Ga0207691_10035729
1005 Ga0207691_10118119
1006 Ga0207711_10013035
1007 Ga0207689_10000049
1008 Ga0207689_10282531
1009 Ga0207679_10012458
1010 Ga0207679_10026243
1011 Ga0207679_10179191
1012 Ga0207667_10025609
1013 Ga0207667_10058578
1014 Ga0207651_10034058
1015 Ga0207651_10098609
1016 Ga0207651_10118666
1017 Ga0207668_10017098
1018 Ga0207658_10153197
1019 Ga0207677_10023718
1020 Ga0207677_10063439
1021 Ga0207703_10003906
1022 Ga0207703_10038915
1023 Ga0207703_10044254
1024 Ga0207702_10007711
1025 Ga0207702_10010905
1026 Ga0207641_10001628
1027 Ga0207641_10009424
1028 Ga0207648_10000487
1029 Ga0207648_10002306
1030 Ga0207648_10121691
1031 Ga0207676_10004825
1032 Ga0207676_10011027
1033 Ga0207676_10012619
1034 Ga0207674_10000155
1035 Ga0207674_10003275
1036 Ga0207675_100000368
1037 Ga0207675_100003946
1038 Ga0207675_100140955
1039 Ga0207683_10004829
1040 Ga0207683_10018277
1041 Ga0207698_10068163
1042 Ga0207698_10141651
1043 Ga0209371_1002417
1044 Ga0209588_1022262
1045 Ga0268266_10076699
1046 Ga0268265_10002358
1047 Ga0268265_10004246
1048 Ga0268265_10121019
1049 Ga0268264_10000624
1050 Ga0268264_10000850
1051 Ga0268264_10034838
1052 Ga0307515_10000399
1053 Ga0307515_10000424
1054 Ga0307515_10236737
1055 Ga0268256_1001637
1056 Ga0265327_10000186
1057 Ga0307513_10015075
1058 Ga0307513_10232309
1059 Ga0307508_10000532
1060 Ga0307405_10005759
1061 Ga0307413_10015566
1062 Ga0307410_10012401
1063 Ga0307414_10031522
1064 Ga0307411_10226367
1065 Ga0373946_0073741
1066 Ga0373955_0067667
1067 Ga0373931_0088385
1068 Ga0373937_0032807
1069 Ga0373925_0001392
1070 Ga0373925_0035576
1071 Ga0395898_0241340
1072 Ga0395901_0014056
1073 Ga0395901_0160860
1074 Ga0436365_0666443
1075 Ga0436365_1783375
1076 Ga0436360_0852056
1077 Ga0436361_0262290
1078 Ga0439436_0009273
1079 Ga0439439_0001406
1080 Ga0439439_0018455
1081 Ga0439453_0000029
1082 Ga0439465_0000828
1083 Ga0439431_0017960
1084 Ga0439462_0005777
1085 Ga0450923_004872
1086 Ga0450898_000954
1087 Ga0450899_001133
1088 Ga0439435_0000212
1089 Ga0439460_0003493
1090 Ga0439460_0027573
1091 Ga0495627_004690
1092 Ga0495592_0010207
1093 Ga0495590_0025064
1094 Ga0495629_0000042
1095 Ga0495629_0009772
1096 Ga0495629_0016766
1097 Ga0495638_0019667
1098 Ga0495641_0006590
1099 Ga0495651_0078031
1100 Ga0495653_0013257
1101 Ga0495650_0024031
1102 Ga0495580_0000479
1103 Ga0495580_0014603
1104 Ga0495582_0000778
1105 Ga0495605_0002559
1106 Ga0495605_0013110
1107 Ga0495664_0000344
1108 Ga0495664_0039719
1109 Ga0495664_0041532
1110 Ga0495664_0061348
1111 Ga0495594_0007150
1112 Ga0495583_0004161
1113 Ga0495583_0011018
1114 Ga0495583_0037996
1115 Ga0495606_0049564
1116 Ga0495610_0016861
1117 Ga0495618_0006127
1118 Ga0495620_0041443
1119 Ga0495628_0003840
1120 Ga0495628_0021909
1121 Ga0495628_0022620
1122 Ga0495630_0001703
1123 Ga0495630_0006855
1124 Ga0495637_0000901
1125 Ga0495643_0010277
1126 Ga0495648_0000909
1127 Ga0495648_0002717
1128 Ga0495648_0004253
1129 Ga0495648_0029227
1130 Ga0495648_0041104
1131 Ga0495666_0001722
1132 Ga0495642_0012367
1133 Ga0495652_0016109
1134 Ga0495665_0007323
1135 Ga0495665_0013747
1136 Ga0495640_0002326
1137 Ga0495586_0003517
1138 Ga0495586_0016211
1139 Ga0495587_0001881
1140 Ga0495597_0004407
1141 Ga0495645_0005460
1142 Ga0495645_0100191
1143 Ga0495645_0110725
1144 Ga0495622_0011054
1145 Ga0495656_0000150
1146 Ga0495668_0026272
1147 Ga0495634_0002290
1148 Ga0495625_0151883
1149 Ga0495635_0007409
1150 Ga0495661_0003670
1151 Ga0495588_0006080
1152 Ga0495588_0006224
1153 Ga0495599_0013555
1154 Ga0495623_0027377
1155 Ga0495623_0034052
1156 Ga0495646_0013476
1157 Ga0495646_0014462
1158 Ga0495646_0040371
1159 Ga0495647_0012271
1160 Ga0495658_0124424
1161 Ga0495669_0015016
1162 Ga0495613_0039117
1163 Ga0495624_0000075
1164 Ga0495624_0009522
1165 Ga0495671_0002256
1166 Ga0495671_0016710
1167 Ga0495649_0003850
1168 Ga0495589_0015981
1169 Ga0495589_0048173
1170 Ga0495600_0020766
1171 Ga0495600_0049456
1172 Ga0495581_0001173
1173 Ga0495581_0027568
1174 Ga0495604_0004823
1175 Ga0495604_0006838
1176 Ga0495604_0049253
1177 Ga0495674_0009080
1178 Ga0495674_0014689
1179 Ga0495674_0031684
1180 Ga0495674_0100053
1181 Ga0495672_0022133
1182 Ga0495672_0051961
1183 Ga0495680_0003981
1184 Ga0495680_0014609
1185 Ga0495680_0064330
1186 Ga0495680_0071796
1187 Ga0495683_0055178
1188 Ga0495687_000147
1189 Ga0495687_021603
1190 Ga0495687_049561
1191 Ga0495675_0016798
1192 Ga0495675_0022124
1193 Ga0495679_001149
1194 Ga0495684_0013565
1195 Ga0495593_0001649
1196 Ga0495593_0001848
1197 Ga0495593_0003306
1198 Ga0495593_0010126
1199 Ga0495602_0005852
1200 Ga0495602_0020836
1201 Ga0495602_0028183
1202 Ga0495614_0006482
1203 Ga0495626_0039910
1204 Ga0496100_0025131
1205 Ga0496100_0025833
1206 Ga0496100_0062160
1207 Ga0496100_0091384
1208 Ga0496100_0137685
1209 Ga0496101_0001910
1210 Ga0496101_0054911
1211 Ga0496101_0073423
1212 Ga0496102_0003005
1213 Ga0496102_0015420
1214 Ga0496103_0033353
1215 Ga0496103_0035343
1216 Ga0496104_0001735
1217 Ga0496105_0002350
1218 Ga0496105_0011976
1219 Ga0496105_0053987
1220 Ga0496106_0009132
1221 Ga0496107_0210955
1222 Ga0496108_0010142
1223 Ga0496108_0370951
1224 Ga0496109_0012474
1225 Ga0496109_0066846
1226 Ga0496110_0149321
1227 Ga0496111_0069869
1228 Ga0496112_0004400
1229 Ga0496113_0001673
1230 Ga0496113_0090440
1231 Ga0496113_0260344
1232 Ga0496113_0369561
1233 Ga0496114_0073808
1234 Ga0496115_0018218
1235 Ga0496115_0139786
1236 Ga0496116_0072222
1237 Ga0496117_0014859
1238 Ga0496117_0052334
1239 Ga0496117_0088750
1240 Ga0496118_0008375
1241 Ga0496118_0011188
1242 Ga0496119_0014868
1243 Ga0496119_0080118
1244 Ga0496120_0036007
1245 Ga0496121_0000084
1246 Ga0496121_0003493
1247 Ga0496121_0011485
1248 Ga0496121_0072323
1249 Ga0496122_0006869
1250 Ga0496122_0010408
1251 Ga0496122_0019831
1252 Ga0496122_0027177
1253 Ga0496122_0119418
1254 Ga0496123_0036994
1255 Ga0496123_0048088
1256 Ga0496124_0004794
1257 Ga0496124_0054025
1258 Ga0496125_0001087
1259 Ga0496125_0001432
1260 Ga0496125_0002419
1261 Ga0496125_0002566
1262 Ga0496125_0125913
1263 Ga0496125_0167050
1264 Ga0496126_0023704
1265 Ga0496126_0089826
1266 Ga0496126_0097403
1267 Ga0495682_0004314
1268 Ga0501031_0042011
1269 Ga0501032_0002637
1270 Ga0501032_0029949
1271 Ga0501033_0000276
1272 Ga0501033_0036165
1273 Ga0501034_0000379
1274 Ga0501036_0108310
1275 Ga0501037_0000143
1276 Ga0501037_0040213
1277 Ga0501038_0056727
1278 Ga0501043_0000032
1279 Ga0501047_0014489
1280 Ga0501047_0040382
1281 Ga0501068_0012091
1282 Ga0501069_0000040
1283 Ga0501069_0034666
1284 Ga0501069_0092312
1285 Ga0501070_0000715
1286 Ga0501070_0000836
1287 Ga0501070_0005073
1288 Ga0501071_0065038
1289 Ga0501071_0153903
1290 Ga0501074_0000057
1291 Ga0501074_0124027
1292 Ga0501080_0000098
1293 Ga0501080_0009194
1294 Ga0501080_0014666
1295 Ga0501080_0291856
1296 Ga0501083_0000036
1297 Ga0501035_0000025
1298 Ga0501035_0008631
1299 Ga0501035_0010411
1300 Ga0501035_0017473
1301 Ga0501035_0064407
1302 Ga0501044_0000031
1303 Ga0501044_0028094
1304 Ga0501044_0055031
1305 Ga0501044_0082985
1306 Ga0501044_0088230
1307 Ga0501044_0267461
1308 nmdc:mga03683_4152_c1
1309 nmdc:mga0k408_60168_c1
1310 nmdc:mga06z11_25860_c1
1311 nmdc:mga07m45_198_c1
1312 nmdc:mga05p37_46_c1
1313 nmdc:mga09592_19040_c1
1314 nmdc:mga0qj67_7572_c1
1315 nmdc:mga06r32_73_c1
1316 nmdc:mga08y16_721_c1
1317 nmdc:mga0n895_243935_c1
1318 nmdc:mga0n895_513967_c1
1319 nmdc:mga0n895_95971_c1
1320 nmdc:mga0rr50_75925_c1
1321 nmdc:mga08x19_90094_c1
1322 nmdc:mga0a205_83909_c1
1323 nmdc:mga0sz30_1446_c1
1324 Ga0495601_0022135
1325 Ga0500610_0000499
1326 Ga0500610_0003403
1327 Ga0500593_000167
1328 Ga0500607_002228
1329 Ga0500607_007791
1330 Ga0500608_001220
1331 Ga0500618_017455
1332 Ga0500568_0003013
1333 Ga0500616_0000294
1334 Ga0500634_0000177
1335 2511170887
1336 2511194183
1337 2514591189
1338 2563065010
1339 2585278014
1340 2585328310
1341 2585536933
1342 2585554569
1343 2585996416
1344 2586001026
1345 2616309064
1346 2616552588
1347 2617383191
1348 2643808899
1349 2643811234
1350 2644064337
1351 2644379710
1352 2644416168
1353 2644449209
1354 2644674087
1355 2644691966
1356 2671116722
1357 2713482001
1358 2738722149
1359 2738881213
1360 2739282513
1361 2778178836
1362 2819596421
1363 2819644019
1364 2842485734
1365 2852394753
1366 2885199554
1367 2885213173
1368 2885278794
1369 2899931131
1370 2901307534
1371 2919104746
1372 2919174501
1373 2919414139
1374 2920827444
1375 2928038091
1376 2928046303
1377 2928053998
1378 2928065750
1379 2945969297
1380 2995393931
1381 2996312338
1382 3005410384
1383 3005423492
1384 8005321006
1385 8005486340
1386 8005683953
1387 8018151197
1388 8046771300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

12

379

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yit-assembly1.cif.gz_A crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9189 6 376
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9138 6 376
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9122 6 374
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9122 6 375
5yx6-assembly1.cif.gz_B crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9118 6 376
ID Description Score Start End Superfamily
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9317 30 228 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9186 9 379 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9086 237 315 3.30.1540.10
4ed9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9055 6 380 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.903 9 379 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A0F9NUV7-F1-model_v4 Formyl-CoA transferase 0.9595 7 142 GO:0003824
AF-A0A505DQC8-F1-model_v4 CoA transferase 0.9585 7 138 GO:0008410
AF-A0A661VNR7-F1-model_v4 CoA transferase 0.9513 7 126 GO:0008410
AF-A0A2M8NEL9-F1-model_v4 Carnitine dehydratase 0.9496 28 128 GO:0008410
AF-A0A401U1S0-F1-model_v4 Formyl-CoA transferase 0.948 11 142 GO:0008410

Map