F475722

General Info

Members Datasets Scaffolds Average Seq Length
694 532 1388 303

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10003693|Ga0099795_100036933
Length 333
Sequence MSSELRASRFVNGGQNGSRDSGQQRRIRVSFEFFPPKNDDMERTLWDSITRLAPLQPNFVSVTYGAGGSTRERTHSTVKRIVNETNLAPAAHLTCVAATRGEIDSVIRSYVATGVRHIVSLRGDPIGGIGERYAPHPGGYHNGADLVAGIKRISDVEVSVSAYPEKHPDSPTVEADIDTLKAKVDAGASRAITQFFFDNDFYFRYLDRVRARGISIPVVPGILPVQNFKQMKSFATRCGTSVPDWLAERFDGLDDDAATRKLIAAAVAAEQVLDLVDRGVTDFHFYTMNRADLVYAVCHLLGLRPAVGVDVVSVGIGGVSAVSVSTAGHANSV

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
147 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
148 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
261 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
262 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
263 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
264 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
265 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
266 2512875024
267 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
268 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
269 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
270 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
271 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
272 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
273 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
274 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
275 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
276 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
277 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
278 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
279 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
280 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
281 2643221734 Bosea sp. Root670 Isolate Unclassified
282 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
283 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
284 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
285 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
286 2751185800 Brucella pituitosa AA2 Isolate Unclassified
287 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
288 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
289 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
290 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
291 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
292 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
293 2841760612 Bosea sp. Tri-49 Isolate Nodule
294 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
295 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
296 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
297 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
298 2844104063 Bosea sp. Tri-39 Isolate Nodule
299 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
300 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
301 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
302 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
303 2851246043 Bosea sp. Tri-54 Isolate Nodule
304 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
305 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
306 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
307 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
308 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
309 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
310 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
311 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
312 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
313 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
314 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
315 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
316 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
317 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
318 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
319 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
320 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
321 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
322 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
323 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
324 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
325 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
326 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
327 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
328 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
329 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
330 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
331 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
332 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
333 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
334 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
335 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
336 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
337 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
338 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
339 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
340 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
341 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
342 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
343 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
344 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
345 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
346 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
347 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
348 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
349 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
350 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
351 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
352 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
353 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
354 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
355 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
356 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
357 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
358 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
359 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
360 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
361 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
362 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
363 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
364 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
365 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
366 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
367 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
368 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
369 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
370 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
371 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
372 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
373 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
374 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
375 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
376 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
377 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
378 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
379 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
380 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
381 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
382 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
383 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
384 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
385 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
386 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
387 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
388 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
389 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
390 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
391 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
392 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
393 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
394 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
395 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
396 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
397 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
398 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
399 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
400 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
401 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
402 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
403 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
404 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
405 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
406 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
407 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
408 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
409 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
410 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
411 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
412 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
413 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
414 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
415 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
416 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
417 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
418 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
419 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
420 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
421 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
422 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
423 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
424 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
425 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
426 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
427 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
428 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
429 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
430 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
431 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
432 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
433 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
434 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
435 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
436 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
437 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
438 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
439 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
440 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
441 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
442 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
443 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
444 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
445 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
446 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
447 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
448 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
449 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
450 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
451 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
452 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
453 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
454 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
455 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
456 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
457 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
458 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
459 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
460 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
461 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
462 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
463 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
464 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
465 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
466 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
467 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
468 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
469 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
470 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
471 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
472 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
473 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
474 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
475 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
476 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
477 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
478 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
479 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
480 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
481 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
482 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
483 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
484 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
485 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
486 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
487 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
488 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
489 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
490 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
491 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
492 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
493 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
494 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
495 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
496 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
497 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
498 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
499 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
500 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
501 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
502 3004167301 Mesorhizobium loti 582 Isolate Unclassified
503 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
504 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
505 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
506 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
507 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
508 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
509 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
510 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
511 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
512 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
513 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
514 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
515 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
516 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
517 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
518 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
519 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
520 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
521 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
522 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
523 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
524 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
525 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
526 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
527 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
528 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
529 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
530 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
531 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
532 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.23
Metatranscriptomes 0.14
Isolates 39.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.76
Nodule 32.42
Rhizoplane 5.48
Rhizosphere 46.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10003693 3300007788 Bacteria 3832
2 JGI25157J39369_1000162 3300002741 Bacteria 55941
3 JGI25151J46595_10000028 3300003187 Bacteria 208373
4 JGI25165J46597_1000015 3300003214 Bacteria 380891
5 JGI25153J46596_10005347 3300003215 Bacteria 6744
6 Ga0006562J51391_1095403 3300003578 Bacteria 3049
7 Ga0055542_1006895 3300003762 Bacteria 2370
8 Ga0055526_1002197 3300003771 Bacteria 13373
9 Ga0055524_1000043 3300003775 Bacteria 152518
10 Ga0065704_10124532 3300005289 Bacteria 1714
11 Ga0070660_100041313 3300005339 Bacteria 3514
12 Ga0070689_100002613 3300005340 Bacteria 11797
13 Ga0070668_100229496 3300005347 Bacteria 1534
14 Ga0070675_100011441 3300005354 Bacteria 6946
15 Ga0070671_100001377 3300005355 Bacteria 18201
16 Ga0070671_100071319 3300005355 Bacteria 2899
17 Ga0070674_100116550 3300005356 Bacteria 1971
18 Ga0070674_100315937 3300005356 Bacteria 1251
19 Ga0070673_100197564 3300005364 Bacteria 1731
20 Ga0070688_100018427 3300005365 Bacteria 4029
21 Ga0070713_100178828 3300005436 Bacteria 1905
22 Ga0070711_100074921 3300005439 Bacteria 2395
23 Ga0070711_100186765 3300005439 Bacteria 1590
24 Ga0070663_100214236 3300005455 Bacteria 1510
25 Ga0070678_100080802 3300005456 Bacteria 2463
26 Ga0070685_10112120 3300005466 Bacteria 1682
27 Ga0070706_100186686 3300005467 Bacteria 1937
28 Ga0070684_100183518 3300005535 Bacteria 1902
29 Ga0070695_100088389 3300005545 Bacteria 2063
30 Ga0070695_100089520 3300005545 Bacteria 2052
31 Ga0070665_100045782 3300005548 Bacteria 4394
32 Ga0070704_100038439 3300005549 Bacteria 3279
33 Ga0070664_100235277 3300005564 Bacteria 1643
34 Ga0068864_100283549 3300005618 Bacteria 1547
35 Ga0068864_100374659 3300005618 Bacteria 1348
36 Ga0068866_10061848 3300005718 Bacteria 1946
37 Ga0068858_100128290 3300005842 Bacteria 2377
38 Ga0081455_10147547 3300005937 Bacteria 1817
39 Ga0081538_10039583 3300005981 Bacteria 3022
40 Ga0081540_1020887 3300005983 Bacteria 3921
41 Ga0081540_1053141 3300005983 Bacteria 1989
42 Ga0081539_10001816 3300005985 Bacteria 33727
43 Ga0070717_10112965 3300006028 Bacteria 2319
44 Ga0075364_10035198 3300006051 Bacteria 3235
45 Ga0075364_10114310 3300006051 Bacteria 1803
46 Ga0070712_100002623 3300006175 Bacteria 11102
47 Ga0075362_10121066 3300006177 Bacteria 1238
48 Ga0075367_10044346 3300006178 Bacteria 2606
49 Ga0075367_10120858 3300006178 Bacteria 1614
50 Ga0075366_10004499 3300006195 Bacteria 7480
51 Ga0075366_10129446 3300006195 Bacteria 1523
52 Ga0075370_10152514 3300006353 Bacteria 1354
53 Ga0068871_100294101 3300006358 Bacteria 1424
54 Ga0075428_100532190 3300006844 Bacteria 1257
55 Ga0075430_100192507 3300006846 Bacteria 1695
56 Ga0075431_100053456 3300006847 Bacteria 4164
57 Ga0075434_100057841 3300006871 Bacteria 3853
58 Ga0068865_100174691 3300006881 Bacteria 1650
59 Ga0099794_10034856 3300007265 Bacteria 2373
60 Ga0105240_10057146 3300009093 Bacteria 4878
61 Ga0105240_10065706 3300009093 Bacteria 4502
62 Ga0111539_10590288 3300009094 Bacteria 1294
63 Ga0105245_10119623 3300009098 Bacteria 2459
64 Ga0105245_10609815 3300009098 Bacteria 1119
65 Ga0105243_10528676 3300009148 Bacteria 1123
66 Ga0105243_10742619 3300009148 Bacteria 961
67 Ga0105242_10313214 3300009176 Bacteria 1437
68 Ga0105242_10398851 3300009176 Bacteria 1283
69 Ga0105248_10090892 3300009177 Bacteria 3438
70 Ga0105248_10442205 3300009177 Bacteria 1465
71 Ga0105237_10022241 3300009545 Bacteria 6506
72 Ga0105238_10171554 3300009551 Bacteria 2145
73 Ga0105249_10258175 3300009553 Bacteria 1730
74 Ga0099796_10000720 3300010159 Bacteria 5874
75 Ga0105239_10040032 3300010375 Bacteria 5134
76 Ga0105239_10180761 3300010375 Bacteria 2360
77 Ga0105239_10340651 3300010375 Bacteria 1692
78 Ga0157369_10133990 3300013105 Bacteria 2624
79 Ga0157369_10173584 3300013105 Bacteria 2270
80 Ga0157374_10358158 3300013296 Bacteria 1450
81 Ga0163163_10170227 3300014325 Bacteria 2225
82 Ga0157380_10241886 3300014326 Bacteria 1628
83 Ga0182008_10079048 3300014497 Bacteria 1618
84 Ga0157377_10203137 3300014745 Bacteria 1259
85 Ga0157379_10217570 3300014968 Bacteria 1730
86 Ga0182005_1055851 3300015265 Bacteria 1076
87 Ga0163161_10082262 3300017792 Bacteria 2372
88 Ga0163161_10479548 3300017792 Bacteria 1010
89 Ga0209026_1000025 3300025250 Bacteria 352548
90 Ga0209148_1000181 3300025254 Bacteria 124691
91 Ga0209759_1000121 3300025256 Bacteria 138469
92 Ga0209233_1000010 3300025261 Bacteria 1194329
93 Ga0209455_1000127 3300025272 Bacteria 162518
94 Ga0209673_1023151 3300025273 Bacteria 2123
95 Ga0209675_1005525 3300025291 Bacteria 5275
96 Ga0209025_1000008 3300025294 Bacteria 1130876
97 Ga0209025_1013512 3300025294 Bacteria 5123
98 Ga0209025_1021195 3300025294 Bacteria 3513
99 Ga0209025_1043540 3300025294 Bacteria 1890
100 Ga0209564_1000049 3300025295 Bacteria 362075
101 Ga0209758_1000157 3300025297 Bacteria 156173
102 Ga0209256_1000014 3300025299 Bacteria 687409
103 Ga0209256_1000208 3300025299 Bacteria 110551
104 Ga0207688_10071173 3300025901 Bacteria 1974
105 Ga0207647_10115910 3300025904 Bacteria 1582
106 Ga0207647_10116865 3300025904 Bacteria 1575
107 Ga0207645_10095000 3300025907 Bacteria 1919
108 Ga0207695_10041970 3300025913 Bacteria 4891
109 Ga0207671_10075860 3300025914 Bacteria 2515
110 Ga0207671_10118132 3300025914 Bacteria 2025
111 Ga0207671_10240204 3300025914 Bacteria 1423
112 Ga0207693_10004439 3300025915 Bacteria 11856
113 Ga0207693_10019058 3300025915 Bacteria 5462
114 Ga0207663_10038181 3300025916 Bacteria 2901
115 Ga0207662_10030632 3300025918 Bacteria 3124
116 Ga0207646_10384304 3300025922 Bacteria 1268
117 Ga0207694_10003031 3300025924 Bacteria 13465
118 Ga0207694_10077076 3300025924 Bacteria 2612
119 Ga0207650_10005080 3300025925 Bacteria 8983
120 Ga0207659_10097136 3300025926 Bacteria 2212
121 Ga0207659_10109876 3300025926 Bacteria 2094
122 Ga0207687_10272736 3300025927 Bacteria 1353
123 Ga0207700_10131789 3300025928 Bacteria 2042
124 Ga0207664_10294751 3300025929 Bacteria 1426
125 Ga0207644_10127507 3300025931 Bacteria 1944
126 Ga0207644_10160855 3300025931 Bacteria 1745
127 Ga0207706_10259902 3300025933 Bacteria 1516
128 Ga0207686_10038079 3300025934 Bacteria 2907
129 Ga0207670_10008170 3300025936 Bacteria 5892
130 Ga0207669_10004970 3300025937 Bacteria 5917
131 Ga0207669_10034099 3300025937 Bacteria 2881
132 Ga0207704_10082262 3300025938 Bacteria 2085
133 Ga0207704_10169201 3300025938 Bacteria 1565
134 Ga0207691_10228389 3300025940 Bacteria 1612
135 Ga0207711_10014688 3300025941 Bacteria 6507
136 Ga0207679_10358542 3300025945 Bacteria 1273
137 Ga0207667_10173153 3300025949 Bacteria 2218
138 Ga0207651_10103847 3300025960 Bacteria 2116
139 Ga0207712_10245766 3300025961 Bacteria 1444
140 Ga0207668_10035829 3300025972 Bacteria 3308
141 Ga0207668_10039677 3300025972 Bacteria 3172
142 Ga0207658_10115734 3300025986 Bacteria 2129
143 Ga0207639_10017843 3300026041 Bacteria 5034
144 Ga0207639_10247853 3300026041 Bacteria 1552
145 Ga0207678_10116489 3300026067 Bacteria 2279
146 Ga0207676_10115261 3300026095 Bacteria 2256
147 Ga0207676_10411386 3300026095 Bacteria 1266
148 Ga0207674_10375905 3300026116 Bacteria 1373
149 Ga0207698_10115186 3300026142 Bacteria 2263
150 Ga0268266_10013179 3300028379 Bacteria 7130
151 Ga0268265_10324800 3300028380 Bacteria 1395
152 Ga0265324_10065526 3300029957 Bacteria 1239
153 Ga0265328_10000024 3300031239 Bacteria 123047
154 Ga0265328_10010474 3300031239 Bacteria 3730
155 Ga0265331_10000057 3300031250 Bacteria 175827
156 Ga0265331_10005289 3300031250 Bacteria 7814
157 Ga0265331_10035645 3300031250 Bacteria 2447
158 Ga0265316_10001084 3300031344 Bacteria 29463
159 Ga0265316_10308573 3300031344 Bacteria 1151
160 Ga0307408_100056538 3300031548 Bacteria 2845
161 Ga0307413_10024979 3300031824 Bacteria 3266
162 Ga0307413_10128793 3300031824 Bacteria 1728
163 Ga0307413_10187803 3300031824 Bacteria 1481
164 Ga0307407_10160721 3300031903 Bacteria 1470
165 Ga0307412_10061684 3300031911 Bacteria 2522
166 Ga0307412_10117150 3300031911 Bacteria 1912
167 Ga0307409_100056021 3300031995 Bacteria 3047
168 Ga0307414_10297196 3300032004 Bacteria 1364
169 Ga0307414_10389571 3300032004 Bacteria 1207
170 Ga0307411_10010324 3300032005 Bacteria 4970
171 Ga0307411_10024266 3300032005 Bacteria 3611
172 Ga0307411_10179941 3300032005 Bacteria 1604
173 Ga0373952_0024559 3300035092 Bacteria 1295
174 Ga0373923_0085855 3300035111 Bacteria 1371
175 Ga0373936_0045242 3300035113 Bacteria 1772
176 Ga0373941_0033007 3300035115 Bacteria 1553
177 Ga0373943_0008399 3300035170 Bacteria 4633
178 Ga0373943_0083065 3300035170 Bacteria 1646
179 Ga0373946_0008989 3300035171 Bacteria 3675
180 Ga0373946_0010287 3300035171 Bacteria 3460
181 Ga0373931_0013804 3300035691 Bacteria 3938
182 Ga0373931_0014574 3300035691 Bacteria 3845
183 Ga0373927_0063088 3300035695 Bacteria 2396
184 Ga0373927_0293240 3300035695 Bacteria 1070
185 Ga0373947_0038833 3300035725 Bacteria 2831
186 Ga0373947_0186211 3300035725 Bacteria 1353
187 Ga0373937_0184544 3300036401 Bacteria 1959
188 Ga0373925_0038149 3300037068 Bacteria 3550
189 Ga0373925_0101323 3300037068 Bacteria 2214
190 Ga0395899_0000117 3300037312 Bacteria 130159
191 Ga0395899_0102614 3300037312 Bacteria 2064
192 Ga0395900_0000020 3300037418 Bacteria 353500
193 Ga0395900_0175426 3300037418 Bacteria 2180
194 Ga0395900_0179218 3300037418 Bacteria 2154
195 Ga0395900_0199313 3300037418 Bacteria 2026
196 Ga0395898_0000259 3300037466 Bacteria 130131
197 Ga0395898_0053937 3300037466 Bacteria 3925
198 Ga0395905_0000019 3300037471 Bacteria 353500
199 Ga0395905_0072266 3300037471 Bacteria 3234
200 Ga0395905_0161421 3300037471 Bacteria 2106
201 Ga0436364_0671347 3300037853 Bacteria 2534
202 Ga0395901_0000016 3300038443 Bacteria 354008
203 Ga0395901_0446470 3300038443 Bacteria 1323
204 Ga0395901_0453421 3300038443 Bacteria 1311
205 Ga0237819_05382 3300038705 Bacteria 2015
206 Ga0400485_01213 3300038735 Bacteria 2971
207 Ga0400485_14356 3300038735 Bacteria 1163
208 Ga0439453_0002089 3300041408 Bacteria 2702
209 Ga0439443_017491 3300042003 Bacteria 1103
210 Ga0439445_0091742 3300042004 Bacteria 856
211 Ga0439460_0087737 3300042461 Bacteria 985
212 Ga0466972_0023488 3300044658 Bacteria 3066
213 Ga0453684_0057382 3300044712 Bacteria 5040
214 Ga0451576_0005525 3300045051 Bacteria 15791
215 Ga0495603_0020062 3300046455 Bacteria 4051
216 Ga0495629_0034266 3300046459 Bacteria 3589
217 Ga0495638_0107827 3300046460 Bacteria 1658
218 Ga0495582_0059138 3300046473 Bacteria 2114
219 Ga0495664_0215408 3300046477 Bacteria 1163
220 Ga0495584_0008419 3300046491 Bacteria 5342
221 Ga0495584_0049293 3300046491 Bacteria 2122
222 Ga0495594_0120728 3300046499 Bacteria 1481
223 Ga0495607_0116881 3300046501 Bacteria 1406
224 Ga0495608_0186535 3300046511 Bacteria 1311
225 Ga0495610_0087716 3300046512 Bacteria 1415
226 Ga0495620_0046800 3300046515 Bacteria 1866
227 Ga0495630_0054561 3300046517 Bacteria 2994
228 Ga0495630_0085962 3300046517 Bacteria 2375
229 Ga0495631_0050806 3300046518 Bacteria 1813
230 Ga0495643_0020118 3300046522 Bacteria 3855
231 Ga0495648_0105538 3300046524 Bacteria 1545
232 Ga0495663_0002197 3300046525 Bacteria 5937
233 Ga0495665_0030425 3300046531 Bacteria 2889
234 Ga0495640_0022925 3300046533 Bacteria 4560
235 Ga0495621_0002331 3300046539 Bacteria 5098
236 Ga0495621_0003721 3300046539 Bacteria 4224
237 Ga0495633_0014426 3300046558 Bacteria 4134
238 Ga0495633_0034162 3300046558 Bacteria 2447
239 Ga0495667_0077754 3300046559 Bacteria 2158
240 Ga0495656_0016649 3300046615 Bacteria 2792
241 Ga0495668_0052725 3300046616 Bacteria 2250
242 Ga0495668_0088386 3300046616 Bacteria 1699
243 Ga0495611_0068240 3300046648 Bacteria 1623
244 Ga0495625_0085486 3300046660 Bacteria 2189
245 Ga0495661_0068879 3300046665 Bacteria 2075
246 Ga0495658_0026938 3300046683 Bacteria 3087
247 Ga0495613_0046371 3300046689 Bacteria 3214
248 Ga0495670_0163156 3300046691 Bacteria 1171
249 Ga0495674_0196555 3300047319 Bacteria 1675
250 Ga0495676_0011515 3300047321 Bacteria 7978
251 Ga0495685_085051 3300047447 Bacteria 1051
252 Ga0495602_0238774 3300048088 Bacteria 1361
253 Ga0496100_0014191 3300048903 Bacteria 4619
254 Ga0496101_0048651 3300048904 Bacteria 3048
255 Ga0496101_0129728 3300048904 Bacteria 1913
256 Ga0496102_0116409 3300048905 Bacteria 2494
257 Ga0496102_0152188 3300048905 Bacteria 2174
258 Ga0496102_0367056 3300048905 Bacteria 1355
259 Ga0496103_0104962 3300048906 Bacteria 1791
260 Ga0496104_0000102 3300048907 Bacteria 81318
261 Ga0496104_0000423 3300048907 Bacteria 36966
262 Ga0496104_0020816 3300048907 Bacteria 6014
263 Ga0496104_0046437 3300048907 Bacteria 4090
264 Ga0496104_0317346 3300048907 Bacteria 1471
265 Ga0496104_0391117 3300048907 Bacteria 1303
266 Ga0496105_0000066 3300048908 Bacteria 83056
267 Ga0496105_0001835 3300048908 Bacteria 15210
268 Ga0496105_0108522 3300048908 Bacteria 2291
269 Ga0496105_0132603 3300048908 Bacteria 2053
270 Ga0496105_0337002 3300048908 Bacteria 1206
271 Ga0496106_0050975 3300048909 Bacteria 3120
272 Ga0496107_0068985 3300048910 Bacteria 2565
273 Ga0496108_0002705 3300048911 Bacteria 14172
274 Ga0496108_0061965 3300048911 Bacteria 3149
275 Ga0496108_0244408 3300048911 Bacteria 1561
276 Ga0496108_0301529 3300048911 Bacteria 1396
277 Ga0496108_0382596 3300048911 Bacteria 1229
278 Ga0496109_0180177 3300048912 Bacteria 1984
279 Ga0496110_0197859 3300048913 Bacteria 1825
280 Ga0496111_0080859 3300048914 Bacteria 2371
281 Ga0496112_0005264 3300048915 Bacteria 11148
282 Ga0496112_0035122 3300048915 Bacteria 4880
283 Ga0496112_0303676 3300048915 Bacteria 1541
284 Ga0496113_0001007 3300048916 Bacteria 15109
285 Ga0496114_0014379 3300048917 Bacteria 6351
286 Ga0496114_0413075 3300048917 Bacteria 1195
287 Ga0496114_0619939 3300048917 Bacteria 953
288 Ga0496115_0067482 3300048918 Bacteria 2893
289 Ga0496115_0259130 3300048918 Bacteria 1430
290 Ga0496117_0021321 3300048920 Bacteria 5247
291 Ga0496119_0001143 3300048922 Bacteria 33302
292 Ga0496119_0003713 3300048922 Bacteria 15637
293 Ga0496119_0067282 3300048922 Bacteria 2113
294 Ga0496119_0121381 3300048922 Bacteria 1436
295 Ga0496119_0186792 3300048922 Bacteria 1083
296 Ga0496120_0003090 3300048923 Bacteria 15675
297 Ga0496122_0027052 3300048925 Bacteria 4918
298 Ga0496122_0049808 3300048925 Bacteria 3201
299 Ga0496123_0034050 3300048926 Bacteria 3655
300 Ga0496125_0072808 3300048928 Bacteria 2675
301 Ga0496125_0089930 3300048928 Bacteria 2307
302 Ga0496125_0100096 3300048928 Bacteria 2138
303 Ga0496125_0220860 3300048928 Bacteria 1221
304 Ga0496126_0026799 3300048929 Bacteria 5519
305 Ga0496126_0458432 3300048929 Bacteria 1025
306 Ga0501031_0000036 3300049568 Bacteria 73760
307 Ga0501031_0054189 3300049568 Bacteria 2614
308 Ga0501032_0000100 3300049569 Bacteria 73505
309 Ga0501032_0011516 3300049569 Bacteria 6354
310 Ga0501032_0074003 3300049569 Bacteria 2270
311 Ga0501032_0095150 3300049569 Bacteria 1975
312 Ga0501033_0000088 3300049570 Bacteria 87638
313 Ga0501033_0004092 3300049570 Bacteria 11764
314 Ga0501033_0048857 3300049570 Bacteria 3142
315 Ga0501033_0073998 3300049570 Bacteria 2501
316 Ga0501033_0082301 3300049570 Bacteria 2360
317 Ga0501033_0200268 3300049570 Bacteria 1426
318 Ga0501034_0000397 3300049571 Bacteria 73511
319 Ga0501034_0015682 3300049571 Bacteria 7781
320 Ga0501034_0031927 3300049571 Bacteria 5350
321 Ga0501034_0090548 3300049571 Bacteria 3057
322 Ga0501034_0096491 3300049571 Bacteria 2952
323 Ga0501034_0380060 3300049571 Bacteria 1337
324 Ga0501036_0000056 3300049572 Bacteria 73511
325 Ga0501037_0000119 3300049573 Bacteria 73510
326 Ga0501037_0217425 3300049573 Bacteria 1345
327 Ga0501038_0000098 3300049574 Bacteria 73471
328 Ga0501038_0002573 3300049574 Bacteria 16929
329 Ga0501038_0043625 3300049574 Bacteria 3899
330 Ga0501038_0126624 3300049574 Bacteria 2102
331 Ga0501038_0149128 3300049574 Bacteria 1907
332 Ga0501038_0195743 3300049574 Bacteria 1625
333 Ga0501038_0290395 3300049574 Bacteria 1285
334 Ga0501039_0000013 3300049575 Bacteria 234418
335 Ga0501040_0002600 3300049576 Bacteria 11640
336 Ga0501040_0215248 3300049576 Bacteria 1366
337 Ga0501042_0066132 3300049578 Bacteria 2584
338 Ga0501043_0001500 3300049579 Bacteria 20376
339 Ga0501043_0031208 3300049579 Bacteria 4189
340 Ga0501046_0100763 3300049580 Bacteria 2216
341 Ga0501046_0103842 3300049580 Bacteria 2178
342 Ga0501046_0146730 3300049580 Bacteria 1781
343 Ga0501047_0002744 3300049581 Bacteria 16765
344 Ga0501047_0003462 3300049581 Bacteria 14913
345 Ga0501047_0004753 3300049581 Bacteria 12775
346 Ga0501047_0024659 3300049581 Bacteria 5774
347 Ga0501047_0045336 3300049581 Bacteria 4252
348 Ga0501047_0086264 3300049581 Bacteria 3016
349 Ga0501047_0092503 3300049581 Bacteria 2902
350 Ga0501047_0109525 3300049581 Bacteria 2645
351 Ga0501067_0194922 3300049583 Bacteria 1128
352 Ga0501068_0108732 3300049584 Bacteria 1723
353 Ga0501069_0001649 3300049585 Bacteria 11086
354 Ga0501069_0148272 3300049585 Bacteria 1347
355 Ga0501069_0204526 3300049585 Bacteria 1145
356 Ga0501070_0000264 3300049586 Bacteria 49510
357 Ga0501070_0009622 3300049586 Bacteria 8167
358 Ga0501070_0129205 3300049586 Bacteria 2088
359 Ga0501071_0150774 3300049587 Bacteria 1734
360 Ga0501071_0279934 3300049587 Bacteria 1262
361 Ga0501073_0005786 3300049589 Bacteria 9241
362 Ga0501073_0008362 3300049589 Bacteria 7675
363 Ga0501073_0054540 3300049589 Bacteria 2798
364 Ga0501073_0119080 3300049589 Bacteria 1830
365 Ga0501074_0007044 3300049590 Bacteria 8121
366 Ga0501077_0132850 3300049593 Bacteria 1578
367 Ga0501079_0144672 3300049741 Bacteria 1853
368 Ga0501080_0003495 3300049742 Bacteria 13843
369 Ga0501080_0020492 3300049742 Bacteria 6122
370 Ga0501083_0015637 3300049744 Bacteria 5312
371 Ga0501083_0267825 3300049744 Bacteria 1111
372 Ga0501035_0000053 3300049822 Bacteria 142860
373 Ga0501035_0002015 3300049822 Bacteria 20268
374 Ga0501035_0028224 3300049822 Bacteria 5122
375 Ga0501035_0062122 3300049822 Bacteria 3323
376 Ga0501044_0000214 3300049823 Bacteria 73483
377 Ga0501044_0006017 3300049823 Bacteria 13402
378 Ga0501044_0007800 3300049823 Bacteria 11765
379 Ga0501044_0019399 3300049823 Bacteria 7276
380 Ga0501044_0024315 3300049823 Bacteria 6434
381 Ga0501044_0043550 3300049823 Bacteria 4662
382 Ga0501044_0046044 3300049823 Bacteria 4517
383 Ga0501044_0414194 3300049823 Bacteria 1258
384 Ga0501045_0022424 3300049824 Bacteria 4522
385 nmdc:mga0k408_131792_c1 3300050493 Bacteria 1484
386 nmdc:mga0k408_35826_c1 3300050493 Bacteria 2846
387 nmdc:mga06z11_2786_c1 3300050494 Bacteria 6698
388 nmdc:mga06z11_52857_c1 3300050494 Bacteria 2086
389 nmdc:mga06z11_7272_c2 3300050494 Bacteria 2149
390 nmdc:mga04h51_17773_c1 3300050495 Bacteria 2085
391 nmdc:mga07m45_258438_c1 3300050496 Bacteria 1013
392 nmdc:mga05p37_525036_c1 3300050507 Bacteria 1353
393 nmdc:mga05p37_55434_c1 3300050507 Bacteria 4878
394 nmdc:mga09592_375808_c1 3300050508 Bacteria 1229
395 nmdc:mga0qj67_175833_c1 3300050509 Bacteria 1738
396 nmdc:mga06r32_147014_c1 3300050510 Bacteria 2334
397 nmdc:mga06r32_159143_c1 3300050510 Bacteria 2240
398 nmdc:mga06r32_52964_c1 3300050510 Bacteria 3887
399 nmdc:mga06r32_88046_c1 3300050510 Bacteria 3031
400 nmdc:mga08y16_495154_c1 3300050511 Bacteria 1242
401 nmdc:mga0rr50_483271_c1 3300050513 Bacteria 1052
402 nmdc:mga0sz30_69808_c1 3300050516 Bacteria 1511
403 Ga0495601_0043319 3300053077 Bacteria 2827
404 Ga0495601_0068742 3300053077 Bacteria 2258
405 Ga0495601_0094647 3300053077 Bacteria 1925
406 Ga0495601_0160265 3300053077 Bacteria 1470
407 Ga0495612_0016030 3300053078 Bacteria 3003
408 Ga0495595_0046308 3300053084 Bacteria 2003
409 Ga0495619_0105283 3300053085 Bacteria 1923
410 Ga0495619_0155742 3300053085 Bacteria 1576
411 Ga0495619_0222260 3300053085 Bacteria 1308
412 Ga0495619_0300133 3300053085 Bacteria 1113
413 Ga0500555_030967 3300053103 Bacteria 1517
414 Ga0500562_005865 3300053108 Bacteria 3092
415 Ga0500658_0080189 3300053134 Bacteria 1394
416 Ga0500616_0029947 3300053153 Bacteria 2992
417 Ga0500627_0097490 3300053158 Bacteria 1318
418 Ga0501084_0157708 3300054114 Bacteria 1914
419 Ga0530510_0072258 3300061734 Bacteria 2504
420 2509113146 2508501123 Bacteria 6283661
421 2509143295 2508501127 Bacteria 7037543
422 2509367810 2509276018 Bacteria 6910194
423 2509396319 2509276022 Bacteria 6200534
424 2512032649 2511231221 Bacteria 6846400
425 2512931485 2512875016 Bacteria 6529530
426 2512959316 2512875024 Bacteria 7195110
427 2513590239 2513237087 Bacteria 5817514
428 2513612735 2513237090 Bacteria 7096802
429 2514033637 2513237164 Bacteria 7563725
430 2514420891 2513237305 Bacteria 7293571
431 2514589259 2513237351 Bacteria 6968952
432 2523106566 2522572158 Bacteria 6514390
433 2588517321 2588253730 Bacteria 6881675
434 2597813218 2597489875 Bacteria 7010078
435 2599104898 2597490356 Bacteria 7030811
436 2599936741 2599185301 Bacteria 6161860
437 2643840023 2643221564 Bacteria 4193379
438 2643984410 2643221595 Bacteria 6565519
439 2644129374 2643221623 Bacteria 5239945
440 2644153267 2643221627 Bacteria 6761570
441 2644734943 2643221734 Bacteria 5365412
442 2688598457 2687453392 Bacteria 6880454
443 2694631081 2693429783 Bacteria 7019804
444 2694636421 2693429784 Bacteria 7241525
445 2723575389 2721755686 Bacteria 7343952
446 2753359780 2751185800 Bacteria 5467370
447 2756675455 2756170246 Bacteria 7451806
448 2757572326 2757320392 Bacteria 3737298
449 2758642041 2758568016 Bacteria 5645291
450 2792749252 2791355123 Bacteria 8049106
451 2837654519 2837651117 Bacteria 3772164
452 2837679156 2837678835 Bacteria 5252418
453 2841760849 2841760612 Bacteria 6454112
454 2841912853 2841911363 Bacteria 6173697
455 2841918600 2841917233 Bacteria 6173500
456 2844007412 2844002411 Bacteria 7168230
457 2844013715 2844009547 Bacteria 6728125
458 2844106506 2844104063 Bacteria 6440972
459 2846954381 2846952575 Bacteria 6587527
460 2847675622 2847670302 Bacteria 6165597
461 2847692266 2847686936 Bacteria 6278406
462 2848859361 2848858292 Bacteria 7391279
463 2848861583 2848858292 Bacteria 7391279
464 2851246862 2851246043 Bacteria 6439203
465 2856319509 2856314179 Bacteria 6477897
466 2856327465 2856320880 Bacteria 7263508
467 2856334577 2856328259 Bacteria 6528202
468 2856340878 2856334872 Bacteria 7037011
469 2856344944 2856342000 Bacteria 7176905
470 2856355618 2856349417 Bacteria 6230045
471 2856361936 2856356410 Bacteria 6297484
472 2856369470 2856364286 Bacteria 6939991
473 2857351143 2857349434 Bacteria 7926032
474 2857370759 2857367948 Bacteria 6965560
475 2869169071 2869162929 Bacteria 6399702
476 2869236536 2869234852 Bacteria 6654993
477 2869248996 2869242130 Bacteria 6609239
478 2869253871 2869249662 Bacteria 6868783
479 2869260285 2869256925 Bacteria 6981691
480 2869268399 2869264136 Bacteria 6880765
481 2869284944 2869278585 Bacteria 7077053
482 2869286456 2869285874 Bacteria 6901219
483 2871434609 2871429161 Bacteria 6547891
484 2871448913 2871444079 Bacteria 6423508
485 2871457901 2871451962 Bacteria 7336357
486 2871481661 2871481445 Bacteria 6700002
487 2871494532 2871488783 Bacteria 6929816
488 2871501388 2871495908 Bacteria 6935695
489 2874103720 2874102143 Bacteria 6342645
490 2874112543 2874109183 Bacteria 6517025
491 2874121075 2874116593 Bacteria 6674494
492 2874130610 2874123672 Bacteria 7238285
493 2874132098 2874131515 Bacteria 6820270
494 2874145886 2874139085 Bacteria 7021506
495 2874149814 2874146452 Bacteria 7533118
496 2874158073 2874155637 Bacteria 6724144
497 2874168502 2874162495 Bacteria 6174670
498 2874169871 2874168670 Bacteria 8062617
499 2876368466 2876363079 Bacteria 6544991
500 2876373082 2876369609 Bacteria 6807521
501 2876383040 2876377896 Bacteria 6565995
502 2876389898 2876386047 Bacteria 6698674
503 2876398451 2876392853 Bacteria 6660880
504 2876400201 2876399893 Bacteria 6927900
505 2876411842 2876406927 Bacteria 6191900
506 2876416277 2876413966 Bacteria 6831344
507 2876426875 2876420981 Bacteria 6687741
508 2878040744 2878035449 Bacteria 6555736
509 2878751742 2878745973 Bacteria 6867388
510 2878758886 2878753008 Bacteria 6922523
511 2878765368 2878760144 Bacteria 6823465
512 2878773076 2878767105 Bacteria 6898628
513 2878777908 2878774303 Bacteria 6108671
514 2878784529 2878781027 Bacteria 6834456
515 2878790745 2878788777 Bacteria 6567085
516 2881151342 2881147464 Bacteria 7779814
517 2881155317 2881155292 Bacteria 6461656
518 2881167541 2881161766 Bacteria 7127907
519 2881852852 2881845957 Bacteria 6611900
520 2881867302 2881861095 Bacteria 7128710
521 2882636285 2882632389 Bacteria 8154593
522 2882917621 2882912400 Bacteria 6801539
523 2885309443 2885305155 Bacteria 7348390
524 2885317980 2885312484 Bacteria 6415165
525 2885323709 2885318864 Bacteria 6729568
526 2885331184 2885326080 Bacteria 7134805
527 2885349623 2885342637 Bacteria 7011821
528 2885356707 2885350715 Bacteria 6787678
529 2888339436 2888337043 Bacteria 6629336
530 2888346831 2888343758 Bacteria 6611049
531 2888355769 2888350351 Bacteria 7372807
532 2889010706 2889010040 Bacteria 6749192
533 2889017597 2889016732 Bacteria 6700763
534 2889792986 2889790730 Bacteria 5689708
535 2889919430 2889914905 Bacteria 5702301
536 2897809849 2897803580 Bacteria 7000062
537 2903451330 2903448605 Bacteria 7357801
538 2903503875 2903492973 Bacteria 13473544
539 2903504687 2903492973 Bacteria 13473544
540 2903521302 2903513507 Bacteria 6344008
541 2903527465 2903521522 Bacteria 6525694
542 2903533919 2903528002 Bacteria 6586099
543 2903546199 2903540706 Bacteria 7062119
544 2904665006 2904659560 Bacteria 6685615
545 2906314140 2906308376 Bacteria 6841989
546 2906327306 2906321335 Bacteria 6579571
547 2906359702 2906354277 Bacteria 6991324
548 2906368582 2906363423 Bacteria 6856682
549 2906372617 2906370794 Bacteria 6881062
550 2906391047 2906386501 Bacteria 5977019
551 2906405402 2906401398 Bacteria 6693206
552 2906408916 2906408224 Bacteria 6162342
553 2906420229 2906414383 Bacteria 6580790
554 2922134685 2922130491 Bacteria 7173936
555 2922152083 2922151315 Bacteria 6902399
556 2922162846 2922158528 Bacteria 6573167
557 2922173127 2922172374 Bacteria 6167644
558 2922187921 2922185730 Bacteria 7113964
559 2924724960 2924718760 Bacteria 6331356
560 2924732688 2924726620 Bacteria 6271473
561 2924736427 2924733363 Bacteria 7574837
562 2924746146 2924741084 Bacteria 6661321
563 2924750100 2924748358 Bacteria 6154725
564 2924757189 2924754689 Bacteria 6774424
565 2924764236 2924762789 Bacteria 6561353
566 2924789090 2924784321 Bacteria 7416538
567 2937815750 2937813078 Bacteria 7783518
568 2937824474 2937822353 Bacteria 7290551
569 2937848034 2937843397 Bacteria 5256375
570 2937853172 2937848649 Bacteria 6983481
571 2937862967 2937861824 Bacteria 6660327
572 2937869614 2937868953 Bacteria 6639878
573 2937882111 2937877337 Bacteria 7246526
574 2937894765 2937891427 Bacteria 6357007
575 2937978571 2937972304 Bacteria 7532020
576 2937986244 2937980651 Bacteria 6517427
577 2938000057 2937994558 Bacteria 7036190
578 2938019047 2938014810 Bacteria 6700592
579 2958040646 2958034702 Bacteria 6989922
580 2958056728 2958041894 Bacteria 13082850
581 2958064364 2958064165 Bacteria 7158582
582 2958089233 2958084443 Bacteria 7312792
583 2958092418 2958092219 Bacteria 6861151
584 2958105754 2958100919 Bacteria 6800575
585 2958113943 2958108152 Bacteria 6681128
586 2958118470 2958115193 Bacteria 6923548
587 2958126458 2958122699 Bacteria 7280457
588 2958130859 2958130278 Bacteria 6897202
589 2958141070 2958137437 Bacteria 6050276
590 2958170521 2958165035 Bacteria 6906348
591 2958178337 2958172287 Bacteria 6716688
592 2958184780 2958179912 Bacteria 6874908
593 2961082947 2961077736 Bacteria 7079850
594 2961120005 2961114664 Bacteria 6680456
595 2961132258 2961127735 Bacteria 7196641
596 2961142409 2961136820 Bacteria 6775228
597 2961168976 2961163497 Bacteria 6901077
598 2961176035 2961170736 Bacteria 7072258
599 2961187773 2961183825 Bacteria 6688536
600 2963647727 2963644680 Bacteria 6530403
601 2965024263 2965018300 Bacteria 6883036
602 2965031741 2965025482 Bacteria 6532201
603 2965035472 2965032056 Bacteria 6887443
604 2965044798 2965040258 Bacteria 6855979
605 2965054923 2965047637 Bacteria 6623551
606 2965066013 2965062239 Bacteria 7412989
607 2965092974 2965089291 Bacteria 6866420
608 2965108923 2965102966 Bacteria 6800987
609 2965112434 2965110997 Bacteria 6693150
610 2965123695 2965119406 Bacteria 6956431
611 2968001923 2967996073 Bacteria 6787468
612 2968009053 2968003550 Bacteria 6929263
613 2968018434 2968016561 Bacteria 7022047
614 2968090360 2968083720 Bacteria 7351627
615 2968096375 2968091066 Bacteria 6052692
616 2968098876 2968097103 Bacteria 6107094
617 2968116362 2968110612 Bacteria 6814636
618 2968120643 2968117919 Bacteria 6536078
619 2968129194 2968128360 Bacteria 6270294
620 2968177370 2968171901 Bacteria 6894245
621 2970471393 2970469710 Bacteria 6969209
622 2970491105 2970489779 Bacteria 6517260
623 2970508701 2970503327 Bacteria 7099517
624 2970514632 2970510686 Bacteria 7006402
625 2970528601 2970524798 Bacteria 6840927
626 2970537888 2970532167 Bacteria 6553173
627 2970544783 2970540015 Bacteria 6977556
628 2970552012 2970547951 Bacteria 6931819
629 2970560216 2970554993 Bacteria 6814252
630 2970599559 2970593180 Bacteria 7073582
631 2970625439 2970619444 Bacteria 6986144
632 2970631570 2970627176 Bacteria 6680862
633 2977827426 2977821940 Bacteria 6906439
634 2977834269 2977828996 Bacteria 7007971
635 2977845985 2977843712 Bacteria 6753583
636 2977853021 2977851361 Bacteria 6694324
637 2977859269 2977858184 Bacteria 6215359
638 2977867079 2977864932 Bacteria 7534097
639 2977876910 2977872689 Bacteria 7270173
640 2977916768 2977915119 Bacteria 6829656
641 2977924236 2977922695 Bacteria 6956781
642 2977941189 2977935797 Bacteria 6252826
643 2977942758 2977942078 Bacteria 7570577
644 2977952277 2977950692 Bacteria 6893264
645 2977975982 2977971508 Bacteria 7472917
646 2977986579 2977986579 Bacteria 6581278
647 2979717534 2979710463 Bacteria 6785254
648 2979771088 2979764755 Bacteria 6610066
649 2979774000 2979772303 Bacteria 6618277
650 2979781291 2979779861 Bacteria 6219781
651 2979800105 2979793036 Bacteria 6808957
652 2979811651 2979808191 Bacteria 7179355
653 2987638327 2987636660 Bacteria 8088555
654 2987645786 2987645492 Bacteria 6117018
655 2987654650 2987652177 Bacteria 6969023
656 2987665007 2987659509 Bacteria 6966464
657 2987669231 2987666974 Bacteria 6509233
658 2987679099 2987673487 Bacteria 6884027
659 2996314067 2996310559 Bacteria 6357320
660 2996345080 2996341866 Bacteria 6643098
661 2996350181 2996348954 Bacteria 7239054
662 2996391435 2996386984 Bacteria 6978667
663 3000140647 3000135777 Bacteria 6891109
664 3004168916 3004167301 Bacteria 8330599
665 3004194064 3004188549 Bacteria 6952365
666 3004200752 3004195979 Bacteria 6776956
667 3004205429 3004203850 Bacteria 7307914
668 3004215971 3004211236 Bacteria 7417683
669 3004223721 3004218560 Bacteria 7421728
670 3004233400 3004232784 Bacteria 6662140
671 3004246602 3004239961 Bacteria 6892290
672 3004254696 3004248173 Bacteria 6563236
673 3004274956 3004268573 Bacteria 7043476
674 3004276880 3004275668 Bacteria 7114440
675 3004289402 3004289098 Bacteria 6135450
676 3004334341 3004334049 Bacteria 8449246
677 637074585 637000159 Bacteria 7596297
678 649872983 649633066 Bacteria 6690028
679 8002060863 8002060224 Bacteria 4026565
680 8002289033 8002285264 Bacteria 6717907
681 8004303632 8004300914 Bacteria 6132239
682 8004319932 8004312739 Bacteria 7444653
683 8004366767 8004361976 Bacteria 6858373
684 8004380407 8004374579 Bacteria 6898112
685 8004393630 8004387939 Bacteria 7049250
686 8004397583 8004395343 Bacteria 6620908
687 8004450190 8004445564 Bacteria 6322258
688 8004634840 8004633249 Bacteria 6723080
689 8004640809 8004640170 Bacteria 6723001
690 8004709372 8004703790 Bacteria 8006957
691 8004720398 8004714634 Bacteria 6776161
692 8045864566 8045864390 Bacteria 5043873
693 8054006165 8054002106 Bacteria 7987183
694 8055620784 8055617313 Bacteria 7548464
695 Ga0099795_10003693
696 JGI25157J39369_1000162
697 JGI25151J46595_10000028
698 JGI25165J46597_1000015
699 JGI25153J46596_10005347
700 Ga0006562J51391_1095403
701 Ga0055542_1006895
702 Ga0055526_1002197
703 Ga0055524_1000043
704 Ga0065704_10124532
705 Ga0070660_100041313
706 Ga0070689_100002613
707 Ga0070668_100229496
708 Ga0070675_100011441
709 Ga0070671_100001377
710 Ga0070671_100071319
711 Ga0070674_100116550
712 Ga0070674_100315937
713 Ga0070673_100197564
714 Ga0070688_100018427
715 Ga0070713_100178828
716 Ga0070711_100074921
717 Ga0070711_100186765
718 Ga0070663_100214236
719 Ga0070678_100080802
720 Ga0070685_10112120
721 Ga0070706_100186686
722 Ga0070684_100183518
723 Ga0070695_100088389
724 Ga0070695_100089520
725 Ga0070665_100045782
726 Ga0070704_100038439
727 Ga0070664_100235277
728 Ga0068864_100283549
729 Ga0068864_100374659
730 Ga0068866_10061848
731 Ga0068858_100128290
732 Ga0081455_10147547
733 Ga0081538_10039583
734 Ga0081540_1020887
735 Ga0081540_1053141
736 Ga0081539_10001816
737 Ga0070717_10112965
738 Ga0075364_10035198
739 Ga0075364_10114310
740 Ga0070712_100002623
741 Ga0075362_10121066
742 Ga0075367_10044346
743 Ga0075367_10120858
744 Ga0075366_10004499
745 Ga0075366_10129446
746 Ga0075370_10152514
747 Ga0068871_100294101
748 Ga0075428_100532190
749 Ga0075430_100192507
750 Ga0075431_100053456
751 Ga0075434_100057841
752 Ga0068865_100174691
753 Ga0099794_10034856
754 Ga0105240_10057146
755 Ga0105240_10065706
756 Ga0111539_10590288
757 Ga0105245_10119623
758 Ga0105245_10609815
759 Ga0105243_10528676
760 Ga0105243_10742619
761 Ga0105242_10313214
762 Ga0105242_10398851
763 Ga0105248_10090892
764 Ga0105248_10442205
765 Ga0105237_10022241
766 Ga0105238_10171554
767 Ga0105249_10258175
768 Ga0099796_10000720
769 Ga0105239_10040032
770 Ga0105239_10180761
771 Ga0105239_10340651
772 Ga0157369_10133990
773 Ga0157369_10173584
774 Ga0157374_10358158
775 Ga0163163_10170227
776 Ga0157380_10241886
777 Ga0182008_10079048
778 Ga0157377_10203137
779 Ga0157379_10217570
780 Ga0182005_1055851
781 Ga0163161_10082262
782 Ga0163161_10479548
783 Ga0209026_1000025
784 Ga0209148_1000181
785 Ga0209759_1000121
786 Ga0209233_1000010
787 Ga0209455_1000127
788 Ga0209673_1023151
789 Ga0209675_1005525
790 Ga0209025_1000008
791 Ga0209025_1013512
792 Ga0209025_1021195
793 Ga0209025_1043540
794 Ga0209564_1000049
795 Ga0209758_1000157
796 Ga0209256_1000014
797 Ga0209256_1000208
798 Ga0207688_10071173
799 Ga0207647_10115910
800 Ga0207647_10116865
801 Ga0207645_10095000
802 Ga0207695_10041970
803 Ga0207671_10075860
804 Ga0207671_10118132
805 Ga0207671_10240204
806 Ga0207693_10004439
807 Ga0207693_10019058
808 Ga0207663_10038181
809 Ga0207662_10030632
810 Ga0207646_10384304
811 Ga0207694_10003031
812 Ga0207694_10077076
813 Ga0207650_10005080
814 Ga0207659_10097136
815 Ga0207659_10109876
816 Ga0207687_10272736
817 Ga0207700_10131789
818 Ga0207664_10294751
819 Ga0207644_10127507
820 Ga0207644_10160855
821 Ga0207706_10259902
822 Ga0207686_10038079
823 Ga0207670_10008170
824 Ga0207669_10004970
825 Ga0207669_10034099
826 Ga0207704_10082262
827 Ga0207704_10169201
828 Ga0207691_10228389
829 Ga0207711_10014688
830 Ga0207679_10358542
831 Ga0207667_10173153
832 Ga0207651_10103847
833 Ga0207712_10245766
834 Ga0207668_10035829
835 Ga0207668_10039677
836 Ga0207658_10115734
837 Ga0207639_10017843
838 Ga0207639_10247853
839 Ga0207678_10116489
840 Ga0207676_10115261
841 Ga0207676_10411386
842 Ga0207674_10375905
843 Ga0207698_10115186
844 Ga0268266_10013179
845 Ga0268265_10324800
846 Ga0265324_10065526
847 Ga0265328_10000024
848 Ga0265328_10010474
849 Ga0265331_10000057
850 Ga0265331_10005289
851 Ga0265331_10035645
852 Ga0265316_10001084
853 Ga0265316_10308573
854 Ga0307408_100056538
855 Ga0307413_10024979
856 Ga0307413_10128793
857 Ga0307413_10187803
858 Ga0307407_10160721
859 Ga0307412_10061684
860 Ga0307412_10117150
861 Ga0307409_100056021
862 Ga0307414_10297196
863 Ga0307414_10389571
864 Ga0307411_10010324
865 Ga0307411_10024266
866 Ga0307411_10179941
867 Ga0373952_0024559
868 Ga0373923_0085855
869 Ga0373936_0045242
870 Ga0373941_0033007
871 Ga0373943_0008399
872 Ga0373943_0083065
873 Ga0373946_0008989
874 Ga0373946_0010287
875 Ga0373931_0013804
876 Ga0373931_0014574
877 Ga0373927_0063088
878 Ga0373927_0293240
879 Ga0373947_0038833
880 Ga0373947_0186211
881 Ga0373937_0184544
882 Ga0373925_0038149
883 Ga0373925_0101323
884 Ga0395899_0000117
885 Ga0395899_0102614
886 Ga0395900_0000020
887 Ga0395900_0175426
888 Ga0395900_0179218
889 Ga0395900_0199313
890 Ga0395898_0000259
891 Ga0395898_0053937
892 Ga0395905_0000019
893 Ga0395905_0072266
894 Ga0395905_0161421
895 Ga0436364_0671347
896 Ga0395901_0000016
897 Ga0395901_0446470
898 Ga0395901_0453421
899 Ga0237819_05382
900 Ga0400485_01213
901 Ga0400485_14356
902 Ga0439453_0002089
903 Ga0439443_017491
904 Ga0439445_0091742
905 Ga0439460_0087737
906 Ga0466972_0023488
907 Ga0453684_0057382
908 Ga0451576_0005525
909 Ga0495603_0020062
910 Ga0495629_0034266
911 Ga0495638_0107827
912 Ga0495582_0059138
913 Ga0495664_0215408
914 Ga0495584_0008419
915 Ga0495584_0049293
916 Ga0495594_0120728
917 Ga0495607_0116881
918 Ga0495608_0186535
919 Ga0495610_0087716
920 Ga0495620_0046800
921 Ga0495630_0054561
922 Ga0495630_0085962
923 Ga0495631_0050806
924 Ga0495643_0020118
925 Ga0495648_0105538
926 Ga0495663_0002197
927 Ga0495665_0030425
928 Ga0495640_0022925
929 Ga0495621_0002331
930 Ga0495621_0003721
931 Ga0495633_0014426
932 Ga0495633_0034162
933 Ga0495667_0077754
934 Ga0495656_0016649
935 Ga0495668_0052725
936 Ga0495668_0088386
937 Ga0495611_0068240
938 Ga0495625_0085486
939 Ga0495661_0068879
940 Ga0495658_0026938
941 Ga0495613_0046371
942 Ga0495670_0163156
943 Ga0495674_0196555
944 Ga0495676_0011515
945 Ga0495685_085051
946 Ga0495602_0238774
947 Ga0496100_0014191
948 Ga0496101_0048651
949 Ga0496101_0129728
950 Ga0496102_0116409
951 Ga0496102_0152188
952 Ga0496102_0367056
953 Ga0496103_0104962
954 Ga0496104_0000102
955 Ga0496104_0000423
956 Ga0496104_0020816
957 Ga0496104_0046437
958 Ga0496104_0317346
959 Ga0496104_0391117
960 Ga0496105_0000066
961 Ga0496105_0001835
962 Ga0496105_0108522
963 Ga0496105_0132603
964 Ga0496105_0337002
965 Ga0496106_0050975
966 Ga0496107_0068985
967 Ga0496108_0002705
968 Ga0496108_0061965
969 Ga0496108_0244408
970 Ga0496108_0301529
971 Ga0496108_0382596
972 Ga0496109_0180177
973 Ga0496110_0197859
974 Ga0496111_0080859
975 Ga0496112_0005264
976 Ga0496112_0035122
977 Ga0496112_0303676
978 Ga0496113_0001007
979 Ga0496114_0014379
980 Ga0496114_0413075
981 Ga0496114_0619939
982 Ga0496115_0067482
983 Ga0496115_0259130
984 Ga0496117_0021321
985 Ga0496119_0001143
986 Ga0496119_0003713
987 Ga0496119_0067282
988 Ga0496119_0121381
989 Ga0496119_0186792
990 Ga0496120_0003090
991 Ga0496122_0027052
992 Ga0496122_0049808
993 Ga0496123_0034050
994 Ga0496125_0072808
995 Ga0496125_0089930
996 Ga0496125_0100096
997 Ga0496125_0220860
998 Ga0496126_0026799
999 Ga0496126_0458432
1000 Ga0501031_0000036
1001 Ga0501031_0054189
1002 Ga0501032_0000100
1003 Ga0501032_0011516
1004 Ga0501032_0074003
1005 Ga0501032_0095150
1006 Ga0501033_0000088
1007 Ga0501033_0004092
1008 Ga0501033_0048857
1009 Ga0501033_0073998
1010 Ga0501033_0082301
1011 Ga0501033_0200268
1012 Ga0501034_0000397
1013 Ga0501034_0015682
1014 Ga0501034_0031927
1015 Ga0501034_0090548
1016 Ga0501034_0096491
1017 Ga0501034_0380060
1018 Ga0501036_0000056
1019 Ga0501037_0000119
1020 Ga0501037_0217425
1021 Ga0501038_0000098
1022 Ga0501038_0002573
1023 Ga0501038_0043625
1024 Ga0501038_0126624
1025 Ga0501038_0149128
1026 Ga0501038_0195743
1027 Ga0501038_0290395
1028 Ga0501039_0000013
1029 Ga0501040_0002600
1030 Ga0501040_0215248
1031 Ga0501042_0066132
1032 Ga0501043_0001500
1033 Ga0501043_0031208
1034 Ga0501046_0100763
1035 Ga0501046_0103842
1036 Ga0501046_0146730
1037 Ga0501047_0002744
1038 Ga0501047_0003462
1039 Ga0501047_0004753
1040 Ga0501047_0024659
1041 Ga0501047_0045336
1042 Ga0501047_0086264
1043 Ga0501047_0092503
1044 Ga0501047_0109525
1045 Ga0501067_0194922
1046 Ga0501068_0108732
1047 Ga0501069_0001649
1048 Ga0501069_0148272
1049 Ga0501069_0204526
1050 Ga0501070_0000264
1051 Ga0501070_0009622
1052 Ga0501070_0129205
1053 Ga0501071_0150774
1054 Ga0501071_0279934
1055 Ga0501073_0005786
1056 Ga0501073_0008362
1057 Ga0501073_0054540
1058 Ga0501073_0119080
1059 Ga0501074_0007044
1060 Ga0501077_0132850
1061 Ga0501079_0144672
1062 Ga0501080_0003495
1063 Ga0501080_0020492
1064 Ga0501083_0015637
1065 Ga0501083_0267825
1066 Ga0501035_0000053
1067 Ga0501035_0002015
1068 Ga0501035_0028224
1069 Ga0501035_0062122
1070 Ga0501044_0000214
1071 Ga0501044_0006017
1072 Ga0501044_0007800
1073 Ga0501044_0019399
1074 Ga0501044_0024315
1075 Ga0501044_0043550
1076 Ga0501044_0046044
1077 Ga0501044_0414194
1078 Ga0501045_0022424
1079 nmdc:mga0k408_131792_c1
1080 nmdc:mga0k408_35826_c1
1081 nmdc:mga06z11_2786_c1
1082 nmdc:mga06z11_52857_c1
1083 nmdc:mga06z11_7272_c2
1084 nmdc:mga04h51_17773_c1
1085 nmdc:mga07m45_258438_c1
1086 nmdc:mga05p37_525036_c1
1087 nmdc:mga05p37_55434_c1
1088 nmdc:mga09592_375808_c1
1089 nmdc:mga0qj67_175833_c1
1090 nmdc:mga06r32_147014_c1
1091 nmdc:mga06r32_159143_c1
1092 nmdc:mga06r32_52964_c1
1093 nmdc:mga06r32_88046_c1
1094 nmdc:mga08y16_495154_c1
1095 nmdc:mga0rr50_483271_c1
1096 nmdc:mga0sz30_69808_c1
1097 Ga0495601_0043319
1098 Ga0495601_0068742
1099 Ga0495601_0094647
1100 Ga0495601_0160265
1101 Ga0495612_0016030
1102 Ga0495595_0046308
1103 Ga0495619_0105283
1104 Ga0495619_0155742
1105 Ga0495619_0222260
1106 Ga0495619_0300133
1107 Ga0500555_030967
1108 Ga0500562_005865
1109 Ga0500658_0080189
1110 Ga0500616_0029947
1111 Ga0500627_0097490
1112 Ga0501084_0157708
1113 Ga0530510_0072258
1114 2509113146
1115 2509143295
1116 2509367810
1117 2509396319
1118 2512032649
1119 2512931485
1120 2512959316
1121 2513590239
1122 2513612735
1123 2514033637
1124 2514420891
1125 2514589259
1126 2523106566
1127 2588517321
1128 2597813218
1129 2599104898
1130 2599936741
1131 2643840023
1132 2643984410
1133 2644129374
1134 2644153267
1135 2644734943
1136 2688598457
1137 2694631081
1138 2694636421
1139 2723575389
1140 2753359780
1141 2756675455
1142 2757572326
1143 2758642041
1144 2792749252
1145 2837654519
1146 2837679156
1147 2841760849
1148 2841912853
1149 2841918600
1150 2844007412
1151 2844013715
1152 2844106506
1153 2846954381
1154 2847675622
1155 2847692266
1156 2848859361
1157 2848861583
1158 2851246862
1159 2856319509
1160 2856327465
1161 2856334577
1162 2856340878
1163 2856344944
1164 2856355618
1165 2856361936
1166 2856369470
1167 2857351143
1168 2857370759
1169 2869169071
1170 2869236536
1171 2869248996
1172 2869253871
1173 2869260285
1174 2869268399
1175 2869284944
1176 2869286456
1177 2871434609
1178 2871448913
1179 2871457901
1180 2871481661
1181 2871494532
1182 2871501388
1183 2874103720
1184 2874112543
1185 2874121075
1186 2874130610
1187 2874132098
1188 2874145886
1189 2874149814
1190 2874158073
1191 2874168502
1192 2874169871
1193 2876368466
1194 2876373082
1195 2876383040
1196 2876389898
1197 2876398451
1198 2876400201
1199 2876411842
1200 2876416277
1201 2876426875
1202 2878040744
1203 2878751742
1204 2878758886
1205 2878765368
1206 2878773076
1207 2878777908
1208 2878784529
1209 2878790745
1210 2881151342
1211 2881155317
1212 2881167541
1213 2881852852
1214 2881867302
1215 2882636285
1216 2882917621
1217 2885309443
1218 2885317980
1219 2885323709
1220 2885331184
1221 2885349623
1222 2885356707
1223 2888339436
1224 2888346831
1225 2888355769
1226 2889010706
1227 2889017597
1228 2889792986
1229 2889919430
1230 2897809849
1231 2903451330
1232 2903503875
1233 2903504687
1234 2903521302
1235 2903527465
1236 2903533919
1237 2903546199
1238 2904665006
1239 2906314140
1240 2906327306
1241 2906359702
1242 2906368582
1243 2906372617
1244 2906391047
1245 2906405402
1246 2906408916
1247 2906420229
1248 2922134685
1249 2922152083
1250 2922162846
1251 2922173127
1252 2922187921
1253 2924724960
1254 2924732688
1255 2924736427
1256 2924746146
1257 2924750100
1258 2924757189
1259 2924764236
1260 2924789090
1261 2937815750
1262 2937824474
1263 2937848034
1264 2937853172
1265 2937862967
1266 2937869614
1267 2937882111
1268 2937894765
1269 2937978571
1270 2937986244
1271 2938000057
1272 2938019047
1273 2958040646
1274 2958056728
1275 2958064364
1276 2958089233
1277 2958092418
1278 2958105754
1279 2958113943
1280 2958118470
1281 2958126458
1282 2958130859
1283 2958141070
1284 2958170521
1285 2958178337
1286 2958184780
1287 2961082947
1288 2961120005
1289 2961132258
1290 2961142409
1291 2961168976
1292 2961176035
1293 2961187773
1294 2963647727
1295 2965024263
1296 2965031741
1297 2965035472
1298 2965044798
1299 2965054923
1300 2965066013
1301 2965092974
1302 2965108923
1303 2965112434
1304 2965123695
1305 2968001923
1306 2968009053
1307 2968018434
1308 2968090360
1309 2968096375
1310 2968098876
1311 2968116362
1312 2968120643
1313 2968129194
1314 2968177370
1315 2970471393
1316 2970491105
1317 2970508701
1318 2970514632
1319 2970528601
1320 2970537888
1321 2970544783
1322 2970552012
1323 2970560216
1324 2970599559
1325 2970625439
1326 2970631570
1327 2977827426
1328 2977834269
1329 2977845985
1330 2977853021
1331 2977859269
1332 2977867079
1333 2977876910
1334 2977916768
1335 2977924236
1336 2977941189
1337 2977942758
1338 2977952277
1339 2977975982
1340 2977986579
1341 2979717534
1342 2979771088
1343 2979774000
1344 2979781291
1345 2979800105
1346 2979811651
1347 2987638327
1348 2987645786
1349 2987654650
1350 2987665007
1351 2987669231
1352 2987679099
1353 2996314067
1354 2996345080
1355 2996350181
1356 2996391435
1357 3000140647
1358 3004168916
1359 3004194064
1360 3004200752
1361 3004205429
1362 3004215971
1363 3004223721
1364 3004233400
1365 3004246602
1366 3004254696
1367 3004274956
1368 3004276880
1369 3004289402
1370 3004334341
1371 637074585
1372 649872983
1373 8002060863
1374 8002289033
1375 8004303632
1376 8004319932
1377 8004366767
1378 8004380407
1379 8004393630
1380 8004397583
1381 8004450190
1382 8004634840
1383 8004640809
1384 8004709372
1385 8004720398
1386 8045864566
1387 8054006165
1388 8055620784

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

18

302

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b5t-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase 0.9582 16 293
2fmo-assembly1.cif.gz_B-1 ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9548 11 293
1zrq-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 6.0 0.9543 16 293
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.951 16 293
1zpt-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9504 16 293
ID Description Score Start End Superfamily
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9496 16 292 3.20.20.220
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9337 87 290 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9263 10 293 3.20.20.220
af_Q5AEI0_1_296_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9229 15 293 3.20.20.220
af_A4IC95_4_307_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9134 12 293 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A659UAU7-F1-model_v4 Methylenetetrahydrofolate reductase 0.9997 90 185 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A659UAU7-F1-model_v4 Methylenetetrahydrofolate reductase 0.9894 90 185 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D5UU54-F1-model_v4 Methylenetetrahydrofolate reductase 0.9762 78 190 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A2J4RD57-F1-model_v4 Methylenetetrahydrofolate reductase 0.9733 133 293 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A520J7B8-F1-model_v4 Methylenetetrahydrofolate reductase 0.9732 165 293 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Map