F475722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 532 | 1388 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10003693|Ga0099795_100036933 |
| Length | 333 |
| Sequence | MSSELRASRFVNGGQNGSRDSGQQRRIRVSFEFFPPKNDDMERTLWDSITRLAPLQPNFVSVTYGAGGSTRERTHSTVKRIVNETNLAPAAHLTCVAATRGEIDSVIRSYVATGVRHIVSLRGDPIGGIGERYAPHPGGYHNGADLVAGIKRISDVEVSVSAYPEKHPDSPTVEADIDTLKAKVDAGASRAITQFFFDNDFYFRYLDRVRARGISIPVVPGILPVQNFKQMKSFATRCGTSVPDWLAERFDGLDDDAATRKLIAAAVAAEQVLDLVDRGVTDFHFYTMNRADLVYAVCHLLGLRPAVGVDVVSVGIGGVSAVSVSTAGHANSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 2 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 41 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 130 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 147 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 148 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 149 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 150 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 151 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 240 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 255 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 256 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 260 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 261 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 262 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 263 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 264 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 265 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 266 | 2512875024 | |||
| 267 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 268 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 269 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 270 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 271 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 272 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 273 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 274 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 275 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 276 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 277 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 278 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 279 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 280 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 281 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 282 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 283 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 284 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 285 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 286 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 287 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 288 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 289 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 290 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 291 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 292 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 293 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 294 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 295 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 296 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 297 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 298 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 299 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 300 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 301 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 302 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 303 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 304 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 305 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 306 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 307 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 308 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 309 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 310 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 311 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 312 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 313 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 314 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 315 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 316 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 317 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 318 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 319 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 320 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 321 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 322 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 323 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 324 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 325 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 326 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 327 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 328 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 329 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 330 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 331 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 332 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 333 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 334 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 335 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 336 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 337 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 338 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 339 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 340 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 341 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 342 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 343 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 344 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 345 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 346 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 347 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 348 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 349 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 350 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 351 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 352 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 353 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 354 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 355 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 356 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 357 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 358 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 359 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 360 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 361 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 362 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 363 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 364 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 365 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 366 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 367 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 368 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 369 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 370 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 371 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 372 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 373 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 374 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 375 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 376 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 377 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 378 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 379 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 380 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 381 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 382 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 383 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 384 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 385 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 386 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 387 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 388 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 389 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 390 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 391 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 392 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 393 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 394 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 395 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 396 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 397 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 398 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 399 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 400 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 401 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 402 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 403 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 404 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 405 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 406 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 407 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 408 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 409 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 410 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 411 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 412 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 413 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 414 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 415 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 416 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 417 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 418 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 419 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 420 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 421 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 422 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 423 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 424 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 425 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 426 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 427 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 428 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 429 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 430 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 431 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 432 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 433 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 434 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 435 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 436 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 437 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 438 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 439 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 440 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 441 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 442 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 443 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 444 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 445 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 446 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 447 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 448 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 449 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 450 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 451 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 452 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 453 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 454 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 455 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 456 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 457 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 458 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 459 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 460 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 461 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 462 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 463 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 464 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 465 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 466 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 467 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 468 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 469 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 470 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 471 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 472 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 473 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 474 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 475 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 476 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 477 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 478 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 479 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 480 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 481 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 482 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 483 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 484 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 485 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 486 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 487 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 488 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 489 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 490 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 491 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 492 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 493 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 494 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 495 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 496 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 497 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 498 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 499 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 500 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 501 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 502 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 503 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 504 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 505 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 506 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 507 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 508 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 509 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 510 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 511 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 512 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 513 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 514 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 515 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 516 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 517 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 518 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 519 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 520 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 521 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 522 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 523 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 524 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 525 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 526 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 527 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 528 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 529 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 530 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 531 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 532 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.23 |
| Metatranscriptomes | 0.14 |
| Isolates | 39.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.76 |
| Nodule | 32.42 |
| Rhizoplane | 5.48 |
| Rhizosphere | 46.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099795_10003693 | 3300007788 | Bacteria | 3832 |
| 2 | JGI25157J39369_1000162 | 3300002741 | Bacteria | 55941 |
| 3 | JGI25151J46595_10000028 | 3300003187 | Bacteria | 208373 |
| 4 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 5 | JGI25153J46596_10005347 | 3300003215 | Bacteria | 6744 |
| 6 | Ga0006562J51391_1095403 | 3300003578 | Bacteria | 3049 |
| 7 | Ga0055542_1006895 | 3300003762 | Bacteria | 2370 |
| 8 | Ga0055526_1002197 | 3300003771 | Bacteria | 13373 |
| 9 | Ga0055524_1000043 | 3300003775 | Bacteria | 152518 |
| 10 | Ga0065704_10124532 | 3300005289 | Bacteria | 1714 |
| 11 | Ga0070660_100041313 | 3300005339 | Bacteria | 3514 |
| 12 | Ga0070689_100002613 | 3300005340 | Bacteria | 11797 |
| 13 | Ga0070668_100229496 | 3300005347 | Bacteria | 1534 |
| 14 | Ga0070675_100011441 | 3300005354 | Bacteria | 6946 |
| 15 | Ga0070671_100001377 | 3300005355 | Bacteria | 18201 |
| 16 | Ga0070671_100071319 | 3300005355 | Bacteria | 2899 |
| 17 | Ga0070674_100116550 | 3300005356 | Bacteria | 1971 |
| 18 | Ga0070674_100315937 | 3300005356 | Bacteria | 1251 |
| 19 | Ga0070673_100197564 | 3300005364 | Bacteria | 1731 |
| 20 | Ga0070688_100018427 | 3300005365 | Bacteria | 4029 |
| 21 | Ga0070713_100178828 | 3300005436 | Bacteria | 1905 |
| 22 | Ga0070711_100074921 | 3300005439 | Bacteria | 2395 |
| 23 | Ga0070711_100186765 | 3300005439 | Bacteria | 1590 |
| 24 | Ga0070663_100214236 | 3300005455 | Bacteria | 1510 |
| 25 | Ga0070678_100080802 | 3300005456 | Bacteria | 2463 |
| 26 | Ga0070685_10112120 | 3300005466 | Bacteria | 1682 |
| 27 | Ga0070706_100186686 | 3300005467 | Bacteria | 1937 |
| 28 | Ga0070684_100183518 | 3300005535 | Bacteria | 1902 |
| 29 | Ga0070695_100088389 | 3300005545 | Bacteria | 2063 |
| 30 | Ga0070695_100089520 | 3300005545 | Bacteria | 2052 |
| 31 | Ga0070665_100045782 | 3300005548 | Bacteria | 4394 |
| 32 | Ga0070704_100038439 | 3300005549 | Bacteria | 3279 |
| 33 | Ga0070664_100235277 | 3300005564 | Bacteria | 1643 |
| 34 | Ga0068864_100283549 | 3300005618 | Bacteria | 1547 |
| 35 | Ga0068864_100374659 | 3300005618 | Bacteria | 1348 |
| 36 | Ga0068866_10061848 | 3300005718 | Bacteria | 1946 |
| 37 | Ga0068858_100128290 | 3300005842 | Bacteria | 2377 |
| 38 | Ga0081455_10147547 | 3300005937 | Bacteria | 1817 |
| 39 | Ga0081538_10039583 | 3300005981 | Bacteria | 3022 |
| 40 | Ga0081540_1020887 | 3300005983 | Bacteria | 3921 |
| 41 | Ga0081540_1053141 | 3300005983 | Bacteria | 1989 |
| 42 | Ga0081539_10001816 | 3300005985 | Bacteria | 33727 |
| 43 | Ga0070717_10112965 | 3300006028 | Bacteria | 2319 |
| 44 | Ga0075364_10035198 | 3300006051 | Bacteria | 3235 |
| 45 | Ga0075364_10114310 | 3300006051 | Bacteria | 1803 |
| 46 | Ga0070712_100002623 | 3300006175 | Bacteria | 11102 |
| 47 | Ga0075362_10121066 | 3300006177 | Bacteria | 1238 |
| 48 | Ga0075367_10044346 | 3300006178 | Bacteria | 2606 |
| 49 | Ga0075367_10120858 | 3300006178 | Bacteria | 1614 |
| 50 | Ga0075366_10004499 | 3300006195 | Bacteria | 7480 |
| 51 | Ga0075366_10129446 | 3300006195 | Bacteria | 1523 |
| 52 | Ga0075370_10152514 | 3300006353 | Bacteria | 1354 |
| 53 | Ga0068871_100294101 | 3300006358 | Bacteria | 1424 |
| 54 | Ga0075428_100532190 | 3300006844 | Bacteria | 1257 |
| 55 | Ga0075430_100192507 | 3300006846 | Bacteria | 1695 |
| 56 | Ga0075431_100053456 | 3300006847 | Bacteria | 4164 |
| 57 | Ga0075434_100057841 | 3300006871 | Bacteria | 3853 |
| 58 | Ga0068865_100174691 | 3300006881 | Bacteria | 1650 |
| 59 | Ga0099794_10034856 | 3300007265 | Bacteria | 2373 |
| 60 | Ga0105240_10057146 | 3300009093 | Bacteria | 4878 |
| 61 | Ga0105240_10065706 | 3300009093 | Bacteria | 4502 |
| 62 | Ga0111539_10590288 | 3300009094 | Bacteria | 1294 |
| 63 | Ga0105245_10119623 | 3300009098 | Bacteria | 2459 |
| 64 | Ga0105245_10609815 | 3300009098 | Bacteria | 1119 |
| 65 | Ga0105243_10528676 | 3300009148 | Bacteria | 1123 |
| 66 | Ga0105243_10742619 | 3300009148 | Bacteria | 961 |
| 67 | Ga0105242_10313214 | 3300009176 | Bacteria | 1437 |
| 68 | Ga0105242_10398851 | 3300009176 | Bacteria | 1283 |
| 69 | Ga0105248_10090892 | 3300009177 | Bacteria | 3438 |
| 70 | Ga0105248_10442205 | 3300009177 | Bacteria | 1465 |
| 71 | Ga0105237_10022241 | 3300009545 | Bacteria | 6506 |
| 72 | Ga0105238_10171554 | 3300009551 | Bacteria | 2145 |
| 73 | Ga0105249_10258175 | 3300009553 | Bacteria | 1730 |
| 74 | Ga0099796_10000720 | 3300010159 | Bacteria | 5874 |
| 75 | Ga0105239_10040032 | 3300010375 | Bacteria | 5134 |
| 76 | Ga0105239_10180761 | 3300010375 | Bacteria | 2360 |
| 77 | Ga0105239_10340651 | 3300010375 | Bacteria | 1692 |
| 78 | Ga0157369_10133990 | 3300013105 | Bacteria | 2624 |
| 79 | Ga0157369_10173584 | 3300013105 | Bacteria | 2270 |
| 80 | Ga0157374_10358158 | 3300013296 | Bacteria | 1450 |
| 81 | Ga0163163_10170227 | 3300014325 | Bacteria | 2225 |
| 82 | Ga0157380_10241886 | 3300014326 | Bacteria | 1628 |
| 83 | Ga0182008_10079048 | 3300014497 | Bacteria | 1618 |
| 84 | Ga0157377_10203137 | 3300014745 | Bacteria | 1259 |
| 85 | Ga0157379_10217570 | 3300014968 | Bacteria | 1730 |
| 86 | Ga0182005_1055851 | 3300015265 | Bacteria | 1076 |
| 87 | Ga0163161_10082262 | 3300017792 | Bacteria | 2372 |
| 88 | Ga0163161_10479548 | 3300017792 | Bacteria | 1010 |
| 89 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 90 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 91 | Ga0209759_1000121 | 3300025256 | Bacteria | 138469 |
| 92 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 93 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 94 | Ga0209673_1023151 | 3300025273 | Bacteria | 2123 |
| 95 | Ga0209675_1005525 | 3300025291 | Bacteria | 5275 |
| 96 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 97 | Ga0209025_1013512 | 3300025294 | Bacteria | 5123 |
| 98 | Ga0209025_1021195 | 3300025294 | Bacteria | 3513 |
| 99 | Ga0209025_1043540 | 3300025294 | Bacteria | 1890 |
| 100 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 101 | Ga0209758_1000157 | 3300025297 | Bacteria | 156173 |
| 102 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 103 | Ga0209256_1000208 | 3300025299 | Bacteria | 110551 |
| 104 | Ga0207688_10071173 | 3300025901 | Bacteria | 1974 |
| 105 | Ga0207647_10115910 | 3300025904 | Bacteria | 1582 |
| 106 | Ga0207647_10116865 | 3300025904 | Bacteria | 1575 |
| 107 | Ga0207645_10095000 | 3300025907 | Bacteria | 1919 |
| 108 | Ga0207695_10041970 | 3300025913 | Bacteria | 4891 |
| 109 | Ga0207671_10075860 | 3300025914 | Bacteria | 2515 |
| 110 | Ga0207671_10118132 | 3300025914 | Bacteria | 2025 |
| 111 | Ga0207671_10240204 | 3300025914 | Bacteria | 1423 |
| 112 | Ga0207693_10004439 | 3300025915 | Bacteria | 11856 |
| 113 | Ga0207693_10019058 | 3300025915 | Bacteria | 5462 |
| 114 | Ga0207663_10038181 | 3300025916 | Bacteria | 2901 |
| 115 | Ga0207662_10030632 | 3300025918 | Bacteria | 3124 |
| 116 | Ga0207646_10384304 | 3300025922 | Bacteria | 1268 |
| 117 | Ga0207694_10003031 | 3300025924 | Bacteria | 13465 |
| 118 | Ga0207694_10077076 | 3300025924 | Bacteria | 2612 |
| 119 | Ga0207650_10005080 | 3300025925 | Bacteria | 8983 |
| 120 | Ga0207659_10097136 | 3300025926 | Bacteria | 2212 |
| 121 | Ga0207659_10109876 | 3300025926 | Bacteria | 2094 |
| 122 | Ga0207687_10272736 | 3300025927 | Bacteria | 1353 |
| 123 | Ga0207700_10131789 | 3300025928 | Bacteria | 2042 |
| 124 | Ga0207664_10294751 | 3300025929 | Bacteria | 1426 |
| 125 | Ga0207644_10127507 | 3300025931 | Bacteria | 1944 |
| 126 | Ga0207644_10160855 | 3300025931 | Bacteria | 1745 |
| 127 | Ga0207706_10259902 | 3300025933 | Bacteria | 1516 |
| 128 | Ga0207686_10038079 | 3300025934 | Bacteria | 2907 |
| 129 | Ga0207670_10008170 | 3300025936 | Bacteria | 5892 |
| 130 | Ga0207669_10004970 | 3300025937 | Bacteria | 5917 |
| 131 | Ga0207669_10034099 | 3300025937 | Bacteria | 2881 |
| 132 | Ga0207704_10082262 | 3300025938 | Bacteria | 2085 |
| 133 | Ga0207704_10169201 | 3300025938 | Bacteria | 1565 |
| 134 | Ga0207691_10228389 | 3300025940 | Bacteria | 1612 |
| 135 | Ga0207711_10014688 | 3300025941 | Bacteria | 6507 |
| 136 | Ga0207679_10358542 | 3300025945 | Bacteria | 1273 |
| 137 | Ga0207667_10173153 | 3300025949 | Bacteria | 2218 |
| 138 | Ga0207651_10103847 | 3300025960 | Bacteria | 2116 |
| 139 | Ga0207712_10245766 | 3300025961 | Bacteria | 1444 |
| 140 | Ga0207668_10035829 | 3300025972 | Bacteria | 3308 |
| 141 | Ga0207668_10039677 | 3300025972 | Bacteria | 3172 |
| 142 | Ga0207658_10115734 | 3300025986 | Bacteria | 2129 |
| 143 | Ga0207639_10017843 | 3300026041 | Bacteria | 5034 |
| 144 | Ga0207639_10247853 | 3300026041 | Bacteria | 1552 |
| 145 | Ga0207678_10116489 | 3300026067 | Bacteria | 2279 |
| 146 | Ga0207676_10115261 | 3300026095 | Bacteria | 2256 |
| 147 | Ga0207676_10411386 | 3300026095 | Bacteria | 1266 |
| 148 | Ga0207674_10375905 | 3300026116 | Bacteria | 1373 |
| 149 | Ga0207698_10115186 | 3300026142 | Bacteria | 2263 |
| 150 | Ga0268266_10013179 | 3300028379 | Bacteria | 7130 |
| 151 | Ga0268265_10324800 | 3300028380 | Bacteria | 1395 |
| 152 | Ga0265324_10065526 | 3300029957 | Bacteria | 1239 |
| 153 | Ga0265328_10000024 | 3300031239 | Bacteria | 123047 |
| 154 | Ga0265328_10010474 | 3300031239 | Bacteria | 3730 |
| 155 | Ga0265331_10000057 | 3300031250 | Bacteria | 175827 |
| 156 | Ga0265331_10005289 | 3300031250 | Bacteria | 7814 |
| 157 | Ga0265331_10035645 | 3300031250 | Bacteria | 2447 |
| 158 | Ga0265316_10001084 | 3300031344 | Bacteria | 29463 |
| 159 | Ga0265316_10308573 | 3300031344 | Bacteria | 1151 |
| 160 | Ga0307408_100056538 | 3300031548 | Bacteria | 2845 |
| 161 | Ga0307413_10024979 | 3300031824 | Bacteria | 3266 |
| 162 | Ga0307413_10128793 | 3300031824 | Bacteria | 1728 |
| 163 | Ga0307413_10187803 | 3300031824 | Bacteria | 1481 |
| 164 | Ga0307407_10160721 | 3300031903 | Bacteria | 1470 |
| 165 | Ga0307412_10061684 | 3300031911 | Bacteria | 2522 |
| 166 | Ga0307412_10117150 | 3300031911 | Bacteria | 1912 |
| 167 | Ga0307409_100056021 | 3300031995 | Bacteria | 3047 |
| 168 | Ga0307414_10297196 | 3300032004 | Bacteria | 1364 |
| 169 | Ga0307414_10389571 | 3300032004 | Bacteria | 1207 |
| 170 | Ga0307411_10010324 | 3300032005 | Bacteria | 4970 |
| 171 | Ga0307411_10024266 | 3300032005 | Bacteria | 3611 |
| 172 | Ga0307411_10179941 | 3300032005 | Bacteria | 1604 |
| 173 | Ga0373952_0024559 | 3300035092 | Bacteria | 1295 |
| 174 | Ga0373923_0085855 | 3300035111 | Bacteria | 1371 |
| 175 | Ga0373936_0045242 | 3300035113 | Bacteria | 1772 |
| 176 | Ga0373941_0033007 | 3300035115 | Bacteria | 1553 |
| 177 | Ga0373943_0008399 | 3300035170 | Bacteria | 4633 |
| 178 | Ga0373943_0083065 | 3300035170 | Bacteria | 1646 |
| 179 | Ga0373946_0008989 | 3300035171 | Bacteria | 3675 |
| 180 | Ga0373946_0010287 | 3300035171 | Bacteria | 3460 |
| 181 | Ga0373931_0013804 | 3300035691 | Bacteria | 3938 |
| 182 | Ga0373931_0014574 | 3300035691 | Bacteria | 3845 |
| 183 | Ga0373927_0063088 | 3300035695 | Bacteria | 2396 |
| 184 | Ga0373927_0293240 | 3300035695 | Bacteria | 1070 |
| 185 | Ga0373947_0038833 | 3300035725 | Bacteria | 2831 |
| 186 | Ga0373947_0186211 | 3300035725 | Bacteria | 1353 |
| 187 | Ga0373937_0184544 | 3300036401 | Bacteria | 1959 |
| 188 | Ga0373925_0038149 | 3300037068 | Bacteria | 3550 |
| 189 | Ga0373925_0101323 | 3300037068 | Bacteria | 2214 |
| 190 | Ga0395899_0000117 | 3300037312 | Bacteria | 130159 |
| 191 | Ga0395899_0102614 | 3300037312 | Bacteria | 2064 |
| 192 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 193 | Ga0395900_0175426 | 3300037418 | Bacteria | 2180 |
| 194 | Ga0395900_0179218 | 3300037418 | Bacteria | 2154 |
| 195 | Ga0395900_0199313 | 3300037418 | Bacteria | 2026 |
| 196 | Ga0395898_0000259 | 3300037466 | Bacteria | 130131 |
| 197 | Ga0395898_0053937 | 3300037466 | Bacteria | 3925 |
| 198 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 199 | Ga0395905_0072266 | 3300037471 | Bacteria | 3234 |
| 200 | Ga0395905_0161421 | 3300037471 | Bacteria | 2106 |
| 201 | Ga0436364_0671347 | 3300037853 | Bacteria | 2534 |
| 202 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 203 | Ga0395901_0446470 | 3300038443 | Bacteria | 1323 |
| 204 | Ga0395901_0453421 | 3300038443 | Bacteria | 1311 |
| 205 | Ga0237819_05382 | 3300038705 | Bacteria | 2015 |
| 206 | Ga0400485_01213 | 3300038735 | Bacteria | 2971 |
| 207 | Ga0400485_14356 | 3300038735 | Bacteria | 1163 |
| 208 | Ga0439453_0002089 | 3300041408 | Bacteria | 2702 |
| 209 | Ga0439443_017491 | 3300042003 | Bacteria | 1103 |
| 210 | Ga0439445_0091742 | 3300042004 | Bacteria | 856 |
| 211 | Ga0439460_0087737 | 3300042461 | Bacteria | 985 |
| 212 | Ga0466972_0023488 | 3300044658 | Bacteria | 3066 |
| 213 | Ga0453684_0057382 | 3300044712 | Bacteria | 5040 |
| 214 | Ga0451576_0005525 | 3300045051 | Bacteria | 15791 |
| 215 | Ga0495603_0020062 | 3300046455 | Bacteria | 4051 |
| 216 | Ga0495629_0034266 | 3300046459 | Bacteria | 3589 |
| 217 | Ga0495638_0107827 | 3300046460 | Bacteria | 1658 |
| 218 | Ga0495582_0059138 | 3300046473 | Bacteria | 2114 |
| 219 | Ga0495664_0215408 | 3300046477 | Bacteria | 1163 |
| 220 | Ga0495584_0008419 | 3300046491 | Bacteria | 5342 |
| 221 | Ga0495584_0049293 | 3300046491 | Bacteria | 2122 |
| 222 | Ga0495594_0120728 | 3300046499 | Bacteria | 1481 |
| 223 | Ga0495607_0116881 | 3300046501 | Bacteria | 1406 |
| 224 | Ga0495608_0186535 | 3300046511 | Bacteria | 1311 |
| 225 | Ga0495610_0087716 | 3300046512 | Bacteria | 1415 |
| 226 | Ga0495620_0046800 | 3300046515 | Bacteria | 1866 |
| 227 | Ga0495630_0054561 | 3300046517 | Bacteria | 2994 |
| 228 | Ga0495630_0085962 | 3300046517 | Bacteria | 2375 |
| 229 | Ga0495631_0050806 | 3300046518 | Bacteria | 1813 |
| 230 | Ga0495643_0020118 | 3300046522 | Bacteria | 3855 |
| 231 | Ga0495648_0105538 | 3300046524 | Bacteria | 1545 |
| 232 | Ga0495663_0002197 | 3300046525 | Bacteria | 5937 |
| 233 | Ga0495665_0030425 | 3300046531 | Bacteria | 2889 |
| 234 | Ga0495640_0022925 | 3300046533 | Bacteria | 4560 |
| 235 | Ga0495621_0002331 | 3300046539 | Bacteria | 5098 |
| 236 | Ga0495621_0003721 | 3300046539 | Bacteria | 4224 |
| 237 | Ga0495633_0014426 | 3300046558 | Bacteria | 4134 |
| 238 | Ga0495633_0034162 | 3300046558 | Bacteria | 2447 |
| 239 | Ga0495667_0077754 | 3300046559 | Bacteria | 2158 |
| 240 | Ga0495656_0016649 | 3300046615 | Bacteria | 2792 |
| 241 | Ga0495668_0052725 | 3300046616 | Bacteria | 2250 |
| 242 | Ga0495668_0088386 | 3300046616 | Bacteria | 1699 |
| 243 | Ga0495611_0068240 | 3300046648 | Bacteria | 1623 |
| 244 | Ga0495625_0085486 | 3300046660 | Bacteria | 2189 |
| 245 | Ga0495661_0068879 | 3300046665 | Bacteria | 2075 |
| 246 | Ga0495658_0026938 | 3300046683 | Bacteria | 3087 |
| 247 | Ga0495613_0046371 | 3300046689 | Bacteria | 3214 |
| 248 | Ga0495670_0163156 | 3300046691 | Bacteria | 1171 |
| 249 | Ga0495674_0196555 | 3300047319 | Bacteria | 1675 |
| 250 | Ga0495676_0011515 | 3300047321 | Bacteria | 7978 |
| 251 | Ga0495685_085051 | 3300047447 | Bacteria | 1051 |
| 252 | Ga0495602_0238774 | 3300048088 | Bacteria | 1361 |
| 253 | Ga0496100_0014191 | 3300048903 | Bacteria | 4619 |
| 254 | Ga0496101_0048651 | 3300048904 | Bacteria | 3048 |
| 255 | Ga0496101_0129728 | 3300048904 | Bacteria | 1913 |
| 256 | Ga0496102_0116409 | 3300048905 | Bacteria | 2494 |
| 257 | Ga0496102_0152188 | 3300048905 | Bacteria | 2174 |
| 258 | Ga0496102_0367056 | 3300048905 | Bacteria | 1355 |
| 259 | Ga0496103_0104962 | 3300048906 | Bacteria | 1791 |
| 260 | Ga0496104_0000102 | 3300048907 | Bacteria | 81318 |
| 261 | Ga0496104_0000423 | 3300048907 | Bacteria | 36966 |
| 262 | Ga0496104_0020816 | 3300048907 | Bacteria | 6014 |
| 263 | Ga0496104_0046437 | 3300048907 | Bacteria | 4090 |
| 264 | Ga0496104_0317346 | 3300048907 | Bacteria | 1471 |
| 265 | Ga0496104_0391117 | 3300048907 | Bacteria | 1303 |
| 266 | Ga0496105_0000066 | 3300048908 | Bacteria | 83056 |
| 267 | Ga0496105_0001835 | 3300048908 | Bacteria | 15210 |
| 268 | Ga0496105_0108522 | 3300048908 | Bacteria | 2291 |
| 269 | Ga0496105_0132603 | 3300048908 | Bacteria | 2053 |
| 270 | Ga0496105_0337002 | 3300048908 | Bacteria | 1206 |
| 271 | Ga0496106_0050975 | 3300048909 | Bacteria | 3120 |
| 272 | Ga0496107_0068985 | 3300048910 | Bacteria | 2565 |
| 273 | Ga0496108_0002705 | 3300048911 | Bacteria | 14172 |
| 274 | Ga0496108_0061965 | 3300048911 | Bacteria | 3149 |
| 275 | Ga0496108_0244408 | 3300048911 | Bacteria | 1561 |
| 276 | Ga0496108_0301529 | 3300048911 | Bacteria | 1396 |
| 277 | Ga0496108_0382596 | 3300048911 | Bacteria | 1229 |
| 278 | Ga0496109_0180177 | 3300048912 | Bacteria | 1984 |
| 279 | Ga0496110_0197859 | 3300048913 | Bacteria | 1825 |
| 280 | Ga0496111_0080859 | 3300048914 | Bacteria | 2371 |
| 281 | Ga0496112_0005264 | 3300048915 | Bacteria | 11148 |
| 282 | Ga0496112_0035122 | 3300048915 | Bacteria | 4880 |
| 283 | Ga0496112_0303676 | 3300048915 | Bacteria | 1541 |
| 284 | Ga0496113_0001007 | 3300048916 | Bacteria | 15109 |
| 285 | Ga0496114_0014379 | 3300048917 | Bacteria | 6351 |
| 286 | Ga0496114_0413075 | 3300048917 | Bacteria | 1195 |
| 287 | Ga0496114_0619939 | 3300048917 | Bacteria | 953 |
| 288 | Ga0496115_0067482 | 3300048918 | Bacteria | 2893 |
| 289 | Ga0496115_0259130 | 3300048918 | Bacteria | 1430 |
| 290 | Ga0496117_0021321 | 3300048920 | Bacteria | 5247 |
| 291 | Ga0496119_0001143 | 3300048922 | Bacteria | 33302 |
| 292 | Ga0496119_0003713 | 3300048922 | Bacteria | 15637 |
| 293 | Ga0496119_0067282 | 3300048922 | Bacteria | 2113 |
| 294 | Ga0496119_0121381 | 3300048922 | Bacteria | 1436 |
| 295 | Ga0496119_0186792 | 3300048922 | Bacteria | 1083 |
| 296 | Ga0496120_0003090 | 3300048923 | Bacteria | 15675 |
| 297 | Ga0496122_0027052 | 3300048925 | Bacteria | 4918 |
| 298 | Ga0496122_0049808 | 3300048925 | Bacteria | 3201 |
| 299 | Ga0496123_0034050 | 3300048926 | Bacteria | 3655 |
| 300 | Ga0496125_0072808 | 3300048928 | Bacteria | 2675 |
| 301 | Ga0496125_0089930 | 3300048928 | Bacteria | 2307 |
| 302 | Ga0496125_0100096 | 3300048928 | Bacteria | 2138 |
| 303 | Ga0496125_0220860 | 3300048928 | Bacteria | 1221 |
| 304 | Ga0496126_0026799 | 3300048929 | Bacteria | 5519 |
| 305 | Ga0496126_0458432 | 3300048929 | Bacteria | 1025 |
| 306 | Ga0501031_0000036 | 3300049568 | Bacteria | 73760 |
| 307 | Ga0501031_0054189 | 3300049568 | Bacteria | 2614 |
| 308 | Ga0501032_0000100 | 3300049569 | Bacteria | 73505 |
| 309 | Ga0501032_0011516 | 3300049569 | Bacteria | 6354 |
| 310 | Ga0501032_0074003 | 3300049569 | Bacteria | 2270 |
| 311 | Ga0501032_0095150 | 3300049569 | Bacteria | 1975 |
| 312 | Ga0501033_0000088 | 3300049570 | Bacteria | 87638 |
| 313 | Ga0501033_0004092 | 3300049570 | Bacteria | 11764 |
| 314 | Ga0501033_0048857 | 3300049570 | Bacteria | 3142 |
| 315 | Ga0501033_0073998 | 3300049570 | Bacteria | 2501 |
| 316 | Ga0501033_0082301 | 3300049570 | Bacteria | 2360 |
| 317 | Ga0501033_0200268 | 3300049570 | Bacteria | 1426 |
| 318 | Ga0501034_0000397 | 3300049571 | Bacteria | 73511 |
| 319 | Ga0501034_0015682 | 3300049571 | Bacteria | 7781 |
| 320 | Ga0501034_0031927 | 3300049571 | Bacteria | 5350 |
| 321 | Ga0501034_0090548 | 3300049571 | Bacteria | 3057 |
| 322 | Ga0501034_0096491 | 3300049571 | Bacteria | 2952 |
| 323 | Ga0501034_0380060 | 3300049571 | Bacteria | 1337 |
| 324 | Ga0501036_0000056 | 3300049572 | Bacteria | 73511 |
| 325 | Ga0501037_0000119 | 3300049573 | Bacteria | 73510 |
| 326 | Ga0501037_0217425 | 3300049573 | Bacteria | 1345 |
| 327 | Ga0501038_0000098 | 3300049574 | Bacteria | 73471 |
| 328 | Ga0501038_0002573 | 3300049574 | Bacteria | 16929 |
| 329 | Ga0501038_0043625 | 3300049574 | Bacteria | 3899 |
| 330 | Ga0501038_0126624 | 3300049574 | Bacteria | 2102 |
| 331 | Ga0501038_0149128 | 3300049574 | Bacteria | 1907 |
| 332 | Ga0501038_0195743 | 3300049574 | Bacteria | 1625 |
| 333 | Ga0501038_0290395 | 3300049574 | Bacteria | 1285 |
| 334 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 335 | Ga0501040_0002600 | 3300049576 | Bacteria | 11640 |
| 336 | Ga0501040_0215248 | 3300049576 | Bacteria | 1366 |
| 337 | Ga0501042_0066132 | 3300049578 | Bacteria | 2584 |
| 338 | Ga0501043_0001500 | 3300049579 | Bacteria | 20376 |
| 339 | Ga0501043_0031208 | 3300049579 | Bacteria | 4189 |
| 340 | Ga0501046_0100763 | 3300049580 | Bacteria | 2216 |
| 341 | Ga0501046_0103842 | 3300049580 | Bacteria | 2178 |
| 342 | Ga0501046_0146730 | 3300049580 | Bacteria | 1781 |
| 343 | Ga0501047_0002744 | 3300049581 | Bacteria | 16765 |
| 344 | Ga0501047_0003462 | 3300049581 | Bacteria | 14913 |
| 345 | Ga0501047_0004753 | 3300049581 | Bacteria | 12775 |
| 346 | Ga0501047_0024659 | 3300049581 | Bacteria | 5774 |
| 347 | Ga0501047_0045336 | 3300049581 | Bacteria | 4252 |
| 348 | Ga0501047_0086264 | 3300049581 | Bacteria | 3016 |
| 349 | Ga0501047_0092503 | 3300049581 | Bacteria | 2902 |
| 350 | Ga0501047_0109525 | 3300049581 | Bacteria | 2645 |
| 351 | Ga0501067_0194922 | 3300049583 | Bacteria | 1128 |
| 352 | Ga0501068_0108732 | 3300049584 | Bacteria | 1723 |
| 353 | Ga0501069_0001649 | 3300049585 | Bacteria | 11086 |
| 354 | Ga0501069_0148272 | 3300049585 | Bacteria | 1347 |
| 355 | Ga0501069_0204526 | 3300049585 | Bacteria | 1145 |
| 356 | Ga0501070_0000264 | 3300049586 | Bacteria | 49510 |
| 357 | Ga0501070_0009622 | 3300049586 | Bacteria | 8167 |
| 358 | Ga0501070_0129205 | 3300049586 | Bacteria | 2088 |
| 359 | Ga0501071_0150774 | 3300049587 | Bacteria | 1734 |
| 360 | Ga0501071_0279934 | 3300049587 | Bacteria | 1262 |
| 361 | Ga0501073_0005786 | 3300049589 | Bacteria | 9241 |
| 362 | Ga0501073_0008362 | 3300049589 | Bacteria | 7675 |
| 363 | Ga0501073_0054540 | 3300049589 | Bacteria | 2798 |
| 364 | Ga0501073_0119080 | 3300049589 | Bacteria | 1830 |
| 365 | Ga0501074_0007044 | 3300049590 | Bacteria | 8121 |
| 366 | Ga0501077_0132850 | 3300049593 | Bacteria | 1578 |
| 367 | Ga0501079_0144672 | 3300049741 | Bacteria | 1853 |
| 368 | Ga0501080_0003495 | 3300049742 | Bacteria | 13843 |
| 369 | Ga0501080_0020492 | 3300049742 | Bacteria | 6122 |
| 370 | Ga0501083_0015637 | 3300049744 | Bacteria | 5312 |
| 371 | Ga0501083_0267825 | 3300049744 | Bacteria | 1111 |
| 372 | Ga0501035_0000053 | 3300049822 | Bacteria | 142860 |
| 373 | Ga0501035_0002015 | 3300049822 | Bacteria | 20268 |
| 374 | Ga0501035_0028224 | 3300049822 | Bacteria | 5122 |
| 375 | Ga0501035_0062122 | 3300049822 | Bacteria | 3323 |
| 376 | Ga0501044_0000214 | 3300049823 | Bacteria | 73483 |
| 377 | Ga0501044_0006017 | 3300049823 | Bacteria | 13402 |
| 378 | Ga0501044_0007800 | 3300049823 | Bacteria | 11765 |
| 379 | Ga0501044_0019399 | 3300049823 | Bacteria | 7276 |
| 380 | Ga0501044_0024315 | 3300049823 | Bacteria | 6434 |
| 381 | Ga0501044_0043550 | 3300049823 | Bacteria | 4662 |
| 382 | Ga0501044_0046044 | 3300049823 | Bacteria | 4517 |
| 383 | Ga0501044_0414194 | 3300049823 | Bacteria | 1258 |
| 384 | Ga0501045_0022424 | 3300049824 | Bacteria | 4522 |
| 385 | nmdc:mga0k408_131792_c1 | 3300050493 | Bacteria | 1484 |
| 386 | nmdc:mga0k408_35826_c1 | 3300050493 | Bacteria | 2846 |
| 387 | nmdc:mga06z11_2786_c1 | 3300050494 | Bacteria | 6698 |
| 388 | nmdc:mga06z11_52857_c1 | 3300050494 | Bacteria | 2086 |
| 389 | nmdc:mga06z11_7272_c2 | 3300050494 | Bacteria | 2149 |
| 390 | nmdc:mga04h51_17773_c1 | 3300050495 | Bacteria | 2085 |
| 391 | nmdc:mga07m45_258438_c1 | 3300050496 | Bacteria | 1013 |
| 392 | nmdc:mga05p37_525036_c1 | 3300050507 | Bacteria | 1353 |
| 393 | nmdc:mga05p37_55434_c1 | 3300050507 | Bacteria | 4878 |
| 394 | nmdc:mga09592_375808_c1 | 3300050508 | Bacteria | 1229 |
| 395 | nmdc:mga0qj67_175833_c1 | 3300050509 | Bacteria | 1738 |
| 396 | nmdc:mga06r32_147014_c1 | 3300050510 | Bacteria | 2334 |
| 397 | nmdc:mga06r32_159143_c1 | 3300050510 | Bacteria | 2240 |
| 398 | nmdc:mga06r32_52964_c1 | 3300050510 | Bacteria | 3887 |
| 399 | nmdc:mga06r32_88046_c1 | 3300050510 | Bacteria | 3031 |
| 400 | nmdc:mga08y16_495154_c1 | 3300050511 | Bacteria | 1242 |
| 401 | nmdc:mga0rr50_483271_c1 | 3300050513 | Bacteria | 1052 |
| 402 | nmdc:mga0sz30_69808_c1 | 3300050516 | Bacteria | 1511 |
| 403 | Ga0495601_0043319 | 3300053077 | Bacteria | 2827 |
| 404 | Ga0495601_0068742 | 3300053077 | Bacteria | 2258 |
| 405 | Ga0495601_0094647 | 3300053077 | Bacteria | 1925 |
| 406 | Ga0495601_0160265 | 3300053077 | Bacteria | 1470 |
| 407 | Ga0495612_0016030 | 3300053078 | Bacteria | 3003 |
| 408 | Ga0495595_0046308 | 3300053084 | Bacteria | 2003 |
| 409 | Ga0495619_0105283 | 3300053085 | Bacteria | 1923 |
| 410 | Ga0495619_0155742 | 3300053085 | Bacteria | 1576 |
| 411 | Ga0495619_0222260 | 3300053085 | Bacteria | 1308 |
| 412 | Ga0495619_0300133 | 3300053085 | Bacteria | 1113 |
| 413 | Ga0500555_030967 | 3300053103 | Bacteria | 1517 |
| 414 | Ga0500562_005865 | 3300053108 | Bacteria | 3092 |
| 415 | Ga0500658_0080189 | 3300053134 | Bacteria | 1394 |
| 416 | Ga0500616_0029947 | 3300053153 | Bacteria | 2992 |
| 417 | Ga0500627_0097490 | 3300053158 | Bacteria | 1318 |
| 418 | Ga0501084_0157708 | 3300054114 | Bacteria | 1914 |
| 419 | Ga0530510_0072258 | 3300061734 | Bacteria | 2504 |
| 420 | 2509113146 | 2508501123 | Bacteria | 6283661 |
| 421 | 2509143295 | 2508501127 | Bacteria | 7037543 |
| 422 | 2509367810 | 2509276018 | Bacteria | 6910194 |
| 423 | 2509396319 | 2509276022 | Bacteria | 6200534 |
| 424 | 2512032649 | 2511231221 | Bacteria | 6846400 |
| 425 | 2512931485 | 2512875016 | Bacteria | 6529530 |
| 426 | 2512959316 | 2512875024 | Bacteria | 7195110 |
| 427 | 2513590239 | 2513237087 | Bacteria | 5817514 |
| 428 | 2513612735 | 2513237090 | Bacteria | 7096802 |
| 429 | 2514033637 | 2513237164 | Bacteria | 7563725 |
| 430 | 2514420891 | 2513237305 | Bacteria | 7293571 |
| 431 | 2514589259 | 2513237351 | Bacteria | 6968952 |
| 432 | 2523106566 | 2522572158 | Bacteria | 6514390 |
| 433 | 2588517321 | 2588253730 | Bacteria | 6881675 |
| 434 | 2597813218 | 2597489875 | Bacteria | 7010078 |
| 435 | 2599104898 | 2597490356 | Bacteria | 7030811 |
| 436 | 2599936741 | 2599185301 | Bacteria | 6161860 |
| 437 | 2643840023 | 2643221564 | Bacteria | 4193379 |
| 438 | 2643984410 | 2643221595 | Bacteria | 6565519 |
| 439 | 2644129374 | 2643221623 | Bacteria | 5239945 |
| 440 | 2644153267 | 2643221627 | Bacteria | 6761570 |
| 441 | 2644734943 | 2643221734 | Bacteria | 5365412 |
| 442 | 2688598457 | 2687453392 | Bacteria | 6880454 |
| 443 | 2694631081 | 2693429783 | Bacteria | 7019804 |
| 444 | 2694636421 | 2693429784 | Bacteria | 7241525 |
| 445 | 2723575389 | 2721755686 | Bacteria | 7343952 |
| 446 | 2753359780 | 2751185800 | Bacteria | 5467370 |
| 447 | 2756675455 | 2756170246 | Bacteria | 7451806 |
| 448 | 2757572326 | 2757320392 | Bacteria | 3737298 |
| 449 | 2758642041 | 2758568016 | Bacteria | 5645291 |
| 450 | 2792749252 | 2791355123 | Bacteria | 8049106 |
| 451 | 2837654519 | 2837651117 | Bacteria | 3772164 |
| 452 | 2837679156 | 2837678835 | Bacteria | 5252418 |
| 453 | 2841760849 | 2841760612 | Bacteria | 6454112 |
| 454 | 2841912853 | 2841911363 | Bacteria | 6173697 |
| 455 | 2841918600 | 2841917233 | Bacteria | 6173500 |
| 456 | 2844007412 | 2844002411 | Bacteria | 7168230 |
| 457 | 2844013715 | 2844009547 | Bacteria | 6728125 |
| 458 | 2844106506 | 2844104063 | Bacteria | 6440972 |
| 459 | 2846954381 | 2846952575 | Bacteria | 6587527 |
| 460 | 2847675622 | 2847670302 | Bacteria | 6165597 |
| 461 | 2847692266 | 2847686936 | Bacteria | 6278406 |
| 462 | 2848859361 | 2848858292 | Bacteria | 7391279 |
| 463 | 2848861583 | 2848858292 | Bacteria | 7391279 |
| 464 | 2851246862 | 2851246043 | Bacteria | 6439203 |
| 465 | 2856319509 | 2856314179 | Bacteria | 6477897 |
| 466 | 2856327465 | 2856320880 | Bacteria | 7263508 |
| 467 | 2856334577 | 2856328259 | Bacteria | 6528202 |
| 468 | 2856340878 | 2856334872 | Bacteria | 7037011 |
| 469 | 2856344944 | 2856342000 | Bacteria | 7176905 |
| 470 | 2856355618 | 2856349417 | Bacteria | 6230045 |
| 471 | 2856361936 | 2856356410 | Bacteria | 6297484 |
| 472 | 2856369470 | 2856364286 | Bacteria | 6939991 |
| 473 | 2857351143 | 2857349434 | Bacteria | 7926032 |
| 474 | 2857370759 | 2857367948 | Bacteria | 6965560 |
| 475 | 2869169071 | 2869162929 | Bacteria | 6399702 |
| 476 | 2869236536 | 2869234852 | Bacteria | 6654993 |
| 477 | 2869248996 | 2869242130 | Bacteria | 6609239 |
| 478 | 2869253871 | 2869249662 | Bacteria | 6868783 |
| 479 | 2869260285 | 2869256925 | Bacteria | 6981691 |
| 480 | 2869268399 | 2869264136 | Bacteria | 6880765 |
| 481 | 2869284944 | 2869278585 | Bacteria | 7077053 |
| 482 | 2869286456 | 2869285874 | Bacteria | 6901219 |
| 483 | 2871434609 | 2871429161 | Bacteria | 6547891 |
| 484 | 2871448913 | 2871444079 | Bacteria | 6423508 |
| 485 | 2871457901 | 2871451962 | Bacteria | 7336357 |
| 486 | 2871481661 | 2871481445 | Bacteria | 6700002 |
| 487 | 2871494532 | 2871488783 | Bacteria | 6929816 |
| 488 | 2871501388 | 2871495908 | Bacteria | 6935695 |
| 489 | 2874103720 | 2874102143 | Bacteria | 6342645 |
| 490 | 2874112543 | 2874109183 | Bacteria | 6517025 |
| 491 | 2874121075 | 2874116593 | Bacteria | 6674494 |
| 492 | 2874130610 | 2874123672 | Bacteria | 7238285 |
| 493 | 2874132098 | 2874131515 | Bacteria | 6820270 |
| 494 | 2874145886 | 2874139085 | Bacteria | 7021506 |
| 495 | 2874149814 | 2874146452 | Bacteria | 7533118 |
| 496 | 2874158073 | 2874155637 | Bacteria | 6724144 |
| 497 | 2874168502 | 2874162495 | Bacteria | 6174670 |
| 498 | 2874169871 | 2874168670 | Bacteria | 8062617 |
| 499 | 2876368466 | 2876363079 | Bacteria | 6544991 |
| 500 | 2876373082 | 2876369609 | Bacteria | 6807521 |
| 501 | 2876383040 | 2876377896 | Bacteria | 6565995 |
| 502 | 2876389898 | 2876386047 | Bacteria | 6698674 |
| 503 | 2876398451 | 2876392853 | Bacteria | 6660880 |
| 504 | 2876400201 | 2876399893 | Bacteria | 6927900 |
| 505 | 2876411842 | 2876406927 | Bacteria | 6191900 |
| 506 | 2876416277 | 2876413966 | Bacteria | 6831344 |
| 507 | 2876426875 | 2876420981 | Bacteria | 6687741 |
| 508 | 2878040744 | 2878035449 | Bacteria | 6555736 |
| 509 | 2878751742 | 2878745973 | Bacteria | 6867388 |
| 510 | 2878758886 | 2878753008 | Bacteria | 6922523 |
| 511 | 2878765368 | 2878760144 | Bacteria | 6823465 |
| 512 | 2878773076 | 2878767105 | Bacteria | 6898628 |
| 513 | 2878777908 | 2878774303 | Bacteria | 6108671 |
| 514 | 2878784529 | 2878781027 | Bacteria | 6834456 |
| 515 | 2878790745 | 2878788777 | Bacteria | 6567085 |
| 516 | 2881151342 | 2881147464 | Bacteria | 7779814 |
| 517 | 2881155317 | 2881155292 | Bacteria | 6461656 |
| 518 | 2881167541 | 2881161766 | Bacteria | 7127907 |
| 519 | 2881852852 | 2881845957 | Bacteria | 6611900 |
| 520 | 2881867302 | 2881861095 | Bacteria | 7128710 |
| 521 | 2882636285 | 2882632389 | Bacteria | 8154593 |
| 522 | 2882917621 | 2882912400 | Bacteria | 6801539 |
| 523 | 2885309443 | 2885305155 | Bacteria | 7348390 |
| 524 | 2885317980 | 2885312484 | Bacteria | 6415165 |
| 525 | 2885323709 | 2885318864 | Bacteria | 6729568 |
| 526 | 2885331184 | 2885326080 | Bacteria | 7134805 |
| 527 | 2885349623 | 2885342637 | Bacteria | 7011821 |
| 528 | 2885356707 | 2885350715 | Bacteria | 6787678 |
| 529 | 2888339436 | 2888337043 | Bacteria | 6629336 |
| 530 | 2888346831 | 2888343758 | Bacteria | 6611049 |
| 531 | 2888355769 | 2888350351 | Bacteria | 7372807 |
| 532 | 2889010706 | 2889010040 | Bacteria | 6749192 |
| 533 | 2889017597 | 2889016732 | Bacteria | 6700763 |
| 534 | 2889792986 | 2889790730 | Bacteria | 5689708 |
| 535 | 2889919430 | 2889914905 | Bacteria | 5702301 |
| 536 | 2897809849 | 2897803580 | Bacteria | 7000062 |
| 537 | 2903451330 | 2903448605 | Bacteria | 7357801 |
| 538 | 2903503875 | 2903492973 | Bacteria | 13473544 |
| 539 | 2903504687 | 2903492973 | Bacteria | 13473544 |
| 540 | 2903521302 | 2903513507 | Bacteria | 6344008 |
| 541 | 2903527465 | 2903521522 | Bacteria | 6525694 |
| 542 | 2903533919 | 2903528002 | Bacteria | 6586099 |
| 543 | 2903546199 | 2903540706 | Bacteria | 7062119 |
| 544 | 2904665006 | 2904659560 | Bacteria | 6685615 |
| 545 | 2906314140 | 2906308376 | Bacteria | 6841989 |
| 546 | 2906327306 | 2906321335 | Bacteria | 6579571 |
| 547 | 2906359702 | 2906354277 | Bacteria | 6991324 |
| 548 | 2906368582 | 2906363423 | Bacteria | 6856682 |
| 549 | 2906372617 | 2906370794 | Bacteria | 6881062 |
| 550 | 2906391047 | 2906386501 | Bacteria | 5977019 |
| 551 | 2906405402 | 2906401398 | Bacteria | 6693206 |
| 552 | 2906408916 | 2906408224 | Bacteria | 6162342 |
| 553 | 2906420229 | 2906414383 | Bacteria | 6580790 |
| 554 | 2922134685 | 2922130491 | Bacteria | 7173936 |
| 555 | 2922152083 | 2922151315 | Bacteria | 6902399 |
| 556 | 2922162846 | 2922158528 | Bacteria | 6573167 |
| 557 | 2922173127 | 2922172374 | Bacteria | 6167644 |
| 558 | 2922187921 | 2922185730 | Bacteria | 7113964 |
| 559 | 2924724960 | 2924718760 | Bacteria | 6331356 |
| 560 | 2924732688 | 2924726620 | Bacteria | 6271473 |
| 561 | 2924736427 | 2924733363 | Bacteria | 7574837 |
| 562 | 2924746146 | 2924741084 | Bacteria | 6661321 |
| 563 | 2924750100 | 2924748358 | Bacteria | 6154725 |
| 564 | 2924757189 | 2924754689 | Bacteria | 6774424 |
| 565 | 2924764236 | 2924762789 | Bacteria | 6561353 |
| 566 | 2924789090 | 2924784321 | Bacteria | 7416538 |
| 567 | 2937815750 | 2937813078 | Bacteria | 7783518 |
| 568 | 2937824474 | 2937822353 | Bacteria | 7290551 |
| 569 | 2937848034 | 2937843397 | Bacteria | 5256375 |
| 570 | 2937853172 | 2937848649 | Bacteria | 6983481 |
| 571 | 2937862967 | 2937861824 | Bacteria | 6660327 |
| 572 | 2937869614 | 2937868953 | Bacteria | 6639878 |
| 573 | 2937882111 | 2937877337 | Bacteria | 7246526 |
| 574 | 2937894765 | 2937891427 | Bacteria | 6357007 |
| 575 | 2937978571 | 2937972304 | Bacteria | 7532020 |
| 576 | 2937986244 | 2937980651 | Bacteria | 6517427 |
| 577 | 2938000057 | 2937994558 | Bacteria | 7036190 |
| 578 | 2938019047 | 2938014810 | Bacteria | 6700592 |
| 579 | 2958040646 | 2958034702 | Bacteria | 6989922 |
| 580 | 2958056728 | 2958041894 | Bacteria | 13082850 |
| 581 | 2958064364 | 2958064165 | Bacteria | 7158582 |
| 582 | 2958089233 | 2958084443 | Bacteria | 7312792 |
| 583 | 2958092418 | 2958092219 | Bacteria | 6861151 |
| 584 | 2958105754 | 2958100919 | Bacteria | 6800575 |
| 585 | 2958113943 | 2958108152 | Bacteria | 6681128 |
| 586 | 2958118470 | 2958115193 | Bacteria | 6923548 |
| 587 | 2958126458 | 2958122699 | Bacteria | 7280457 |
| 588 | 2958130859 | 2958130278 | Bacteria | 6897202 |
| 589 | 2958141070 | 2958137437 | Bacteria | 6050276 |
| 590 | 2958170521 | 2958165035 | Bacteria | 6906348 |
| 591 | 2958178337 | 2958172287 | Bacteria | 6716688 |
| 592 | 2958184780 | 2958179912 | Bacteria | 6874908 |
| 593 | 2961082947 | 2961077736 | Bacteria | 7079850 |
| 594 | 2961120005 | 2961114664 | Bacteria | 6680456 |
| 595 | 2961132258 | 2961127735 | Bacteria | 7196641 |
| 596 | 2961142409 | 2961136820 | Bacteria | 6775228 |
| 597 | 2961168976 | 2961163497 | Bacteria | 6901077 |
| 598 | 2961176035 | 2961170736 | Bacteria | 7072258 |
| 599 | 2961187773 | 2961183825 | Bacteria | 6688536 |
| 600 | 2963647727 | 2963644680 | Bacteria | 6530403 |
| 601 | 2965024263 | 2965018300 | Bacteria | 6883036 |
| 602 | 2965031741 | 2965025482 | Bacteria | 6532201 |
| 603 | 2965035472 | 2965032056 | Bacteria | 6887443 |
| 604 | 2965044798 | 2965040258 | Bacteria | 6855979 |
| 605 | 2965054923 | 2965047637 | Bacteria | 6623551 |
| 606 | 2965066013 | 2965062239 | Bacteria | 7412989 |
| 607 | 2965092974 | 2965089291 | Bacteria | 6866420 |
| 608 | 2965108923 | 2965102966 | Bacteria | 6800987 |
| 609 | 2965112434 | 2965110997 | Bacteria | 6693150 |
| 610 | 2965123695 | 2965119406 | Bacteria | 6956431 |
| 611 | 2968001923 | 2967996073 | Bacteria | 6787468 |
| 612 | 2968009053 | 2968003550 | Bacteria | 6929263 |
| 613 | 2968018434 | 2968016561 | Bacteria | 7022047 |
| 614 | 2968090360 | 2968083720 | Bacteria | 7351627 |
| 615 | 2968096375 | 2968091066 | Bacteria | 6052692 |
| 616 | 2968098876 | 2968097103 | Bacteria | 6107094 |
| 617 | 2968116362 | 2968110612 | Bacteria | 6814636 |
| 618 | 2968120643 | 2968117919 | Bacteria | 6536078 |
| 619 | 2968129194 | 2968128360 | Bacteria | 6270294 |
| 620 | 2968177370 | 2968171901 | Bacteria | 6894245 |
| 621 | 2970471393 | 2970469710 | Bacteria | 6969209 |
| 622 | 2970491105 | 2970489779 | Bacteria | 6517260 |
| 623 | 2970508701 | 2970503327 | Bacteria | 7099517 |
| 624 | 2970514632 | 2970510686 | Bacteria | 7006402 |
| 625 | 2970528601 | 2970524798 | Bacteria | 6840927 |
| 626 | 2970537888 | 2970532167 | Bacteria | 6553173 |
| 627 | 2970544783 | 2970540015 | Bacteria | 6977556 |
| 628 | 2970552012 | 2970547951 | Bacteria | 6931819 |
| 629 | 2970560216 | 2970554993 | Bacteria | 6814252 |
| 630 | 2970599559 | 2970593180 | Bacteria | 7073582 |
| 631 | 2970625439 | 2970619444 | Bacteria | 6986144 |
| 632 | 2970631570 | 2970627176 | Bacteria | 6680862 |
| 633 | 2977827426 | 2977821940 | Bacteria | 6906439 |
| 634 | 2977834269 | 2977828996 | Bacteria | 7007971 |
| 635 | 2977845985 | 2977843712 | Bacteria | 6753583 |
| 636 | 2977853021 | 2977851361 | Bacteria | 6694324 |
| 637 | 2977859269 | 2977858184 | Bacteria | 6215359 |
| 638 | 2977867079 | 2977864932 | Bacteria | 7534097 |
| 639 | 2977876910 | 2977872689 | Bacteria | 7270173 |
| 640 | 2977916768 | 2977915119 | Bacteria | 6829656 |
| 641 | 2977924236 | 2977922695 | Bacteria | 6956781 |
| 642 | 2977941189 | 2977935797 | Bacteria | 6252826 |
| 643 | 2977942758 | 2977942078 | Bacteria | 7570577 |
| 644 | 2977952277 | 2977950692 | Bacteria | 6893264 |
| 645 | 2977975982 | 2977971508 | Bacteria | 7472917 |
| 646 | 2977986579 | 2977986579 | Bacteria | 6581278 |
| 647 | 2979717534 | 2979710463 | Bacteria | 6785254 |
| 648 | 2979771088 | 2979764755 | Bacteria | 6610066 |
| 649 | 2979774000 | 2979772303 | Bacteria | 6618277 |
| 650 | 2979781291 | 2979779861 | Bacteria | 6219781 |
| 651 | 2979800105 | 2979793036 | Bacteria | 6808957 |
| 652 | 2979811651 | 2979808191 | Bacteria | 7179355 |
| 653 | 2987638327 | 2987636660 | Bacteria | 8088555 |
| 654 | 2987645786 | 2987645492 | Bacteria | 6117018 |
| 655 | 2987654650 | 2987652177 | Bacteria | 6969023 |
| 656 | 2987665007 | 2987659509 | Bacteria | 6966464 |
| 657 | 2987669231 | 2987666974 | Bacteria | 6509233 |
| 658 | 2987679099 | 2987673487 | Bacteria | 6884027 |
| 659 | 2996314067 | 2996310559 | Bacteria | 6357320 |
| 660 | 2996345080 | 2996341866 | Bacteria | 6643098 |
| 661 | 2996350181 | 2996348954 | Bacteria | 7239054 |
| 662 | 2996391435 | 2996386984 | Bacteria | 6978667 |
| 663 | 3000140647 | 3000135777 | Bacteria | 6891109 |
| 664 | 3004168916 | 3004167301 | Bacteria | 8330599 |
| 665 | 3004194064 | 3004188549 | Bacteria | 6952365 |
| 666 | 3004200752 | 3004195979 | Bacteria | 6776956 |
| 667 | 3004205429 | 3004203850 | Bacteria | 7307914 |
| 668 | 3004215971 | 3004211236 | Bacteria | 7417683 |
| 669 | 3004223721 | 3004218560 | Bacteria | 7421728 |
| 670 | 3004233400 | 3004232784 | Bacteria | 6662140 |
| 671 | 3004246602 | 3004239961 | Bacteria | 6892290 |
| 672 | 3004254696 | 3004248173 | Bacteria | 6563236 |
| 673 | 3004274956 | 3004268573 | Bacteria | 7043476 |
| 674 | 3004276880 | 3004275668 | Bacteria | 7114440 |
| 675 | 3004289402 | 3004289098 | Bacteria | 6135450 |
| 676 | 3004334341 | 3004334049 | Bacteria | 8449246 |
| 677 | 637074585 | 637000159 | Bacteria | 7596297 |
| 678 | 649872983 | 649633066 | Bacteria | 6690028 |
| 679 | 8002060863 | 8002060224 | Bacteria | 4026565 |
| 680 | 8002289033 | 8002285264 | Bacteria | 6717907 |
| 681 | 8004303632 | 8004300914 | Bacteria | 6132239 |
| 682 | 8004319932 | 8004312739 | Bacteria | 7444653 |
| 683 | 8004366767 | 8004361976 | Bacteria | 6858373 |
| 684 | 8004380407 | 8004374579 | Bacteria | 6898112 |
| 685 | 8004393630 | 8004387939 | Bacteria | 7049250 |
| 686 | 8004397583 | 8004395343 | Bacteria | 6620908 |
| 687 | 8004450190 | 8004445564 | Bacteria | 6322258 |
| 688 | 8004634840 | 8004633249 | Bacteria | 6723080 |
| 689 | 8004640809 | 8004640170 | Bacteria | 6723001 |
| 690 | 8004709372 | 8004703790 | Bacteria | 8006957 |
| 691 | 8004720398 | 8004714634 | Bacteria | 6776161 |
| 692 | 8045864566 | 8045864390 | Bacteria | 5043873 |
| 693 | 8054006165 | 8054002106 | Bacteria | 7987183 |
| 694 | 8055620784 | 8055617313 | Bacteria | 7548464 |
| 695 | Ga0099795_10003693 | |||
| 696 | JGI25157J39369_1000162 | |||
| 697 | JGI25151J46595_10000028 | |||
| 698 | JGI25165J46597_1000015 | |||
| 699 | JGI25153J46596_10005347 | |||
| 700 | Ga0006562J51391_1095403 | |||
| 701 | Ga0055542_1006895 | |||
| 702 | Ga0055526_1002197 | |||
| 703 | Ga0055524_1000043 | |||
| 704 | Ga0065704_10124532 | |||
| 705 | Ga0070660_100041313 | |||
| 706 | Ga0070689_100002613 | |||
| 707 | Ga0070668_100229496 | |||
| 708 | Ga0070675_100011441 | |||
| 709 | Ga0070671_100001377 | |||
| 710 | Ga0070671_100071319 | |||
| 711 | Ga0070674_100116550 | |||
| 712 | Ga0070674_100315937 | |||
| 713 | Ga0070673_100197564 | |||
| 714 | Ga0070688_100018427 | |||
| 715 | Ga0070713_100178828 | |||
| 716 | Ga0070711_100074921 | |||
| 717 | Ga0070711_100186765 | |||
| 718 | Ga0070663_100214236 | |||
| 719 | Ga0070678_100080802 | |||
| 720 | Ga0070685_10112120 | |||
| 721 | Ga0070706_100186686 | |||
| 722 | Ga0070684_100183518 | |||
| 723 | Ga0070695_100088389 | |||
| 724 | Ga0070695_100089520 | |||
| 725 | Ga0070665_100045782 | |||
| 726 | Ga0070704_100038439 | |||
| 727 | Ga0070664_100235277 | |||
| 728 | Ga0068864_100283549 | |||
| 729 | Ga0068864_100374659 | |||
| 730 | Ga0068866_10061848 | |||
| 731 | Ga0068858_100128290 | |||
| 732 | Ga0081455_10147547 | |||
| 733 | Ga0081538_10039583 | |||
| 734 | Ga0081540_1020887 | |||
| 735 | Ga0081540_1053141 | |||
| 736 | Ga0081539_10001816 | |||
| 737 | Ga0070717_10112965 | |||
| 738 | Ga0075364_10035198 | |||
| 739 | Ga0075364_10114310 | |||
| 740 | Ga0070712_100002623 | |||
| 741 | Ga0075362_10121066 | |||
| 742 | Ga0075367_10044346 | |||
| 743 | Ga0075367_10120858 | |||
| 744 | Ga0075366_10004499 | |||
| 745 | Ga0075366_10129446 | |||
| 746 | Ga0075370_10152514 | |||
| 747 | Ga0068871_100294101 | |||
| 748 | Ga0075428_100532190 | |||
| 749 | Ga0075430_100192507 | |||
| 750 | Ga0075431_100053456 | |||
| 751 | Ga0075434_100057841 | |||
| 752 | Ga0068865_100174691 | |||
| 753 | Ga0099794_10034856 | |||
| 754 | Ga0105240_10057146 | |||
| 755 | Ga0105240_10065706 | |||
| 756 | Ga0111539_10590288 | |||
| 757 | Ga0105245_10119623 | |||
| 758 | Ga0105245_10609815 | |||
| 759 | Ga0105243_10528676 | |||
| 760 | Ga0105243_10742619 | |||
| 761 | Ga0105242_10313214 | |||
| 762 | Ga0105242_10398851 | |||
| 763 | Ga0105248_10090892 | |||
| 764 | Ga0105248_10442205 | |||
| 765 | Ga0105237_10022241 | |||
| 766 | Ga0105238_10171554 | |||
| 767 | Ga0105249_10258175 | |||
| 768 | Ga0099796_10000720 | |||
| 769 | Ga0105239_10040032 | |||
| 770 | Ga0105239_10180761 | |||
| 771 | Ga0105239_10340651 | |||
| 772 | Ga0157369_10133990 | |||
| 773 | Ga0157369_10173584 | |||
| 774 | Ga0157374_10358158 | |||
| 775 | Ga0163163_10170227 | |||
| 776 | Ga0157380_10241886 | |||
| 777 | Ga0182008_10079048 | |||
| 778 | Ga0157377_10203137 | |||
| 779 | Ga0157379_10217570 | |||
| 780 | Ga0182005_1055851 | |||
| 781 | Ga0163161_10082262 | |||
| 782 | Ga0163161_10479548 | |||
| 783 | Ga0209026_1000025 | |||
| 784 | Ga0209148_1000181 | |||
| 785 | Ga0209759_1000121 | |||
| 786 | Ga0209233_1000010 | |||
| 787 | Ga0209455_1000127 | |||
| 788 | Ga0209673_1023151 | |||
| 789 | Ga0209675_1005525 | |||
| 790 | Ga0209025_1000008 | |||
| 791 | Ga0209025_1013512 | |||
| 792 | Ga0209025_1021195 | |||
| 793 | Ga0209025_1043540 | |||
| 794 | Ga0209564_1000049 | |||
| 795 | Ga0209758_1000157 | |||
| 796 | Ga0209256_1000014 | |||
| 797 | Ga0209256_1000208 | |||
| 798 | Ga0207688_10071173 | |||
| 799 | Ga0207647_10115910 | |||
| 800 | Ga0207647_10116865 | |||
| 801 | Ga0207645_10095000 | |||
| 802 | Ga0207695_10041970 | |||
| 803 | Ga0207671_10075860 | |||
| 804 | Ga0207671_10118132 | |||
| 805 | Ga0207671_10240204 | |||
| 806 | Ga0207693_10004439 | |||
| 807 | Ga0207693_10019058 | |||
| 808 | Ga0207663_10038181 | |||
| 809 | Ga0207662_10030632 | |||
| 810 | Ga0207646_10384304 | |||
| 811 | Ga0207694_10003031 | |||
| 812 | Ga0207694_10077076 | |||
| 813 | Ga0207650_10005080 | |||
| 814 | Ga0207659_10097136 | |||
| 815 | Ga0207659_10109876 | |||
| 816 | Ga0207687_10272736 | |||
| 817 | Ga0207700_10131789 | |||
| 818 | Ga0207664_10294751 | |||
| 819 | Ga0207644_10127507 | |||
| 820 | Ga0207644_10160855 | |||
| 821 | Ga0207706_10259902 | |||
| 822 | Ga0207686_10038079 | |||
| 823 | Ga0207670_10008170 | |||
| 824 | Ga0207669_10004970 | |||
| 825 | Ga0207669_10034099 | |||
| 826 | Ga0207704_10082262 | |||
| 827 | Ga0207704_10169201 | |||
| 828 | Ga0207691_10228389 | |||
| 829 | Ga0207711_10014688 | |||
| 830 | Ga0207679_10358542 | |||
| 831 | Ga0207667_10173153 | |||
| 832 | Ga0207651_10103847 | |||
| 833 | Ga0207712_10245766 | |||
| 834 | Ga0207668_10035829 | |||
| 835 | Ga0207668_10039677 | |||
| 836 | Ga0207658_10115734 | |||
| 837 | Ga0207639_10017843 | |||
| 838 | Ga0207639_10247853 | |||
| 839 | Ga0207678_10116489 | |||
| 840 | Ga0207676_10115261 | |||
| 841 | Ga0207676_10411386 | |||
| 842 | Ga0207674_10375905 | |||
| 843 | Ga0207698_10115186 | |||
| 844 | Ga0268266_10013179 | |||
| 845 | Ga0268265_10324800 | |||
| 846 | Ga0265324_10065526 | |||
| 847 | Ga0265328_10000024 | |||
| 848 | Ga0265328_10010474 | |||
| 849 | Ga0265331_10000057 | |||
| 850 | Ga0265331_10005289 | |||
| 851 | Ga0265331_10035645 | |||
| 852 | Ga0265316_10001084 | |||
| 853 | Ga0265316_10308573 | |||
| 854 | Ga0307408_100056538 | |||
| 855 | Ga0307413_10024979 | |||
| 856 | Ga0307413_10128793 | |||
| 857 | Ga0307413_10187803 | |||
| 858 | Ga0307407_10160721 | |||
| 859 | Ga0307412_10061684 | |||
| 860 | Ga0307412_10117150 | |||
| 861 | Ga0307409_100056021 | |||
| 862 | Ga0307414_10297196 | |||
| 863 | Ga0307414_10389571 | |||
| 864 | Ga0307411_10010324 | |||
| 865 | Ga0307411_10024266 | |||
| 866 | Ga0307411_10179941 | |||
| 867 | Ga0373952_0024559 | |||
| 868 | Ga0373923_0085855 | |||
| 869 | Ga0373936_0045242 | |||
| 870 | Ga0373941_0033007 | |||
| 871 | Ga0373943_0008399 | |||
| 872 | Ga0373943_0083065 | |||
| 873 | Ga0373946_0008989 | |||
| 874 | Ga0373946_0010287 | |||
| 875 | Ga0373931_0013804 | |||
| 876 | Ga0373931_0014574 | |||
| 877 | Ga0373927_0063088 | |||
| 878 | Ga0373927_0293240 | |||
| 879 | Ga0373947_0038833 | |||
| 880 | Ga0373947_0186211 | |||
| 881 | Ga0373937_0184544 | |||
| 882 | Ga0373925_0038149 | |||
| 883 | Ga0373925_0101323 | |||
| 884 | Ga0395899_0000117 | |||
| 885 | Ga0395899_0102614 | |||
| 886 | Ga0395900_0000020 | |||
| 887 | Ga0395900_0175426 | |||
| 888 | Ga0395900_0179218 | |||
| 889 | Ga0395900_0199313 | |||
| 890 | Ga0395898_0000259 | |||
| 891 | Ga0395898_0053937 | |||
| 892 | Ga0395905_0000019 | |||
| 893 | Ga0395905_0072266 | |||
| 894 | Ga0395905_0161421 | |||
| 895 | Ga0436364_0671347 | |||
| 896 | Ga0395901_0000016 | |||
| 897 | Ga0395901_0446470 | |||
| 898 | Ga0395901_0453421 | |||
| 899 | Ga0237819_05382 | |||
| 900 | Ga0400485_01213 | |||
| 901 | Ga0400485_14356 | |||
| 902 | Ga0439453_0002089 | |||
| 903 | Ga0439443_017491 | |||
| 904 | Ga0439445_0091742 | |||
| 905 | Ga0439460_0087737 | |||
| 906 | Ga0466972_0023488 | |||
| 907 | Ga0453684_0057382 | |||
| 908 | Ga0451576_0005525 | |||
| 909 | Ga0495603_0020062 | |||
| 910 | Ga0495629_0034266 | |||
| 911 | Ga0495638_0107827 | |||
| 912 | Ga0495582_0059138 | |||
| 913 | Ga0495664_0215408 | |||
| 914 | Ga0495584_0008419 | |||
| 915 | Ga0495584_0049293 | |||
| 916 | Ga0495594_0120728 | |||
| 917 | Ga0495607_0116881 | |||
| 918 | Ga0495608_0186535 | |||
| 919 | Ga0495610_0087716 | |||
| 920 | Ga0495620_0046800 | |||
| 921 | Ga0495630_0054561 | |||
| 922 | Ga0495630_0085962 | |||
| 923 | Ga0495631_0050806 | |||
| 924 | Ga0495643_0020118 | |||
| 925 | Ga0495648_0105538 | |||
| 926 | Ga0495663_0002197 | |||
| 927 | Ga0495665_0030425 | |||
| 928 | Ga0495640_0022925 | |||
| 929 | Ga0495621_0002331 | |||
| 930 | Ga0495621_0003721 | |||
| 931 | Ga0495633_0014426 | |||
| 932 | Ga0495633_0034162 | |||
| 933 | Ga0495667_0077754 | |||
| 934 | Ga0495656_0016649 | |||
| 935 | Ga0495668_0052725 | |||
| 936 | Ga0495668_0088386 | |||
| 937 | Ga0495611_0068240 | |||
| 938 | Ga0495625_0085486 | |||
| 939 | Ga0495661_0068879 | |||
| 940 | Ga0495658_0026938 | |||
| 941 | Ga0495613_0046371 | |||
| 942 | Ga0495670_0163156 | |||
| 943 | Ga0495674_0196555 | |||
| 944 | Ga0495676_0011515 | |||
| 945 | Ga0495685_085051 | |||
| 946 | Ga0495602_0238774 | |||
| 947 | Ga0496100_0014191 | |||
| 948 | Ga0496101_0048651 | |||
| 949 | Ga0496101_0129728 | |||
| 950 | Ga0496102_0116409 | |||
| 951 | Ga0496102_0152188 | |||
| 952 | Ga0496102_0367056 | |||
| 953 | Ga0496103_0104962 | |||
| 954 | Ga0496104_0000102 | |||
| 955 | Ga0496104_0000423 | |||
| 956 | Ga0496104_0020816 | |||
| 957 | Ga0496104_0046437 | |||
| 958 | Ga0496104_0317346 | |||
| 959 | Ga0496104_0391117 | |||
| 960 | Ga0496105_0000066 | |||
| 961 | Ga0496105_0001835 | |||
| 962 | Ga0496105_0108522 | |||
| 963 | Ga0496105_0132603 | |||
| 964 | Ga0496105_0337002 | |||
| 965 | Ga0496106_0050975 | |||
| 966 | Ga0496107_0068985 | |||
| 967 | Ga0496108_0002705 | |||
| 968 | Ga0496108_0061965 | |||
| 969 | Ga0496108_0244408 | |||
| 970 | Ga0496108_0301529 | |||
| 971 | Ga0496108_0382596 | |||
| 972 | Ga0496109_0180177 | |||
| 973 | Ga0496110_0197859 | |||
| 974 | Ga0496111_0080859 | |||
| 975 | Ga0496112_0005264 | |||
| 976 | Ga0496112_0035122 | |||
| 977 | Ga0496112_0303676 | |||
| 978 | Ga0496113_0001007 | |||
| 979 | Ga0496114_0014379 | |||
| 980 | Ga0496114_0413075 | |||
| 981 | Ga0496114_0619939 | |||
| 982 | Ga0496115_0067482 | |||
| 983 | Ga0496115_0259130 | |||
| 984 | Ga0496117_0021321 | |||
| 985 | Ga0496119_0001143 | |||
| 986 | Ga0496119_0003713 | |||
| 987 | Ga0496119_0067282 | |||
| 988 | Ga0496119_0121381 | |||
| 989 | Ga0496119_0186792 | |||
| 990 | Ga0496120_0003090 | |||
| 991 | Ga0496122_0027052 | |||
| 992 | Ga0496122_0049808 | |||
| 993 | Ga0496123_0034050 | |||
| 994 | Ga0496125_0072808 | |||
| 995 | Ga0496125_0089930 | |||
| 996 | Ga0496125_0100096 | |||
| 997 | Ga0496125_0220860 | |||
| 998 | Ga0496126_0026799 | |||
| 999 | Ga0496126_0458432 | |||
| 1000 | Ga0501031_0000036 | |||
| 1001 | Ga0501031_0054189 | |||
| 1002 | Ga0501032_0000100 | |||
| 1003 | Ga0501032_0011516 | |||
| 1004 | Ga0501032_0074003 | |||
| 1005 | Ga0501032_0095150 | |||
| 1006 | Ga0501033_0000088 | |||
| 1007 | Ga0501033_0004092 | |||
| 1008 | Ga0501033_0048857 | |||
| 1009 | Ga0501033_0073998 | |||
| 1010 | Ga0501033_0082301 | |||
| 1011 | Ga0501033_0200268 | |||
| 1012 | Ga0501034_0000397 | |||
| 1013 | Ga0501034_0015682 | |||
| 1014 | Ga0501034_0031927 | |||
| 1015 | Ga0501034_0090548 | |||
| 1016 | Ga0501034_0096491 | |||
| 1017 | Ga0501034_0380060 | |||
| 1018 | Ga0501036_0000056 | |||
| 1019 | Ga0501037_0000119 | |||
| 1020 | Ga0501037_0217425 | |||
| 1021 | Ga0501038_0000098 | |||
| 1022 | Ga0501038_0002573 | |||
| 1023 | Ga0501038_0043625 | |||
| 1024 | Ga0501038_0126624 | |||
| 1025 | Ga0501038_0149128 | |||
| 1026 | Ga0501038_0195743 | |||
| 1027 | Ga0501038_0290395 | |||
| 1028 | Ga0501039_0000013 | |||
| 1029 | Ga0501040_0002600 | |||
| 1030 | Ga0501040_0215248 | |||
| 1031 | Ga0501042_0066132 | |||
| 1032 | Ga0501043_0001500 | |||
| 1033 | Ga0501043_0031208 | |||
| 1034 | Ga0501046_0100763 | |||
| 1035 | Ga0501046_0103842 | |||
| 1036 | Ga0501046_0146730 | |||
| 1037 | Ga0501047_0002744 | |||
| 1038 | Ga0501047_0003462 | |||
| 1039 | Ga0501047_0004753 | |||
| 1040 | Ga0501047_0024659 | |||
| 1041 | Ga0501047_0045336 | |||
| 1042 | Ga0501047_0086264 | |||
| 1043 | Ga0501047_0092503 | |||
| 1044 | Ga0501047_0109525 | |||
| 1045 | Ga0501067_0194922 | |||
| 1046 | Ga0501068_0108732 | |||
| 1047 | Ga0501069_0001649 | |||
| 1048 | Ga0501069_0148272 | |||
| 1049 | Ga0501069_0204526 | |||
| 1050 | Ga0501070_0000264 | |||
| 1051 | Ga0501070_0009622 | |||
| 1052 | Ga0501070_0129205 | |||
| 1053 | Ga0501071_0150774 | |||
| 1054 | Ga0501071_0279934 | |||
| 1055 | Ga0501073_0005786 | |||
| 1056 | Ga0501073_0008362 | |||
| 1057 | Ga0501073_0054540 | |||
| 1058 | Ga0501073_0119080 | |||
| 1059 | Ga0501074_0007044 | |||
| 1060 | Ga0501077_0132850 | |||
| 1061 | Ga0501079_0144672 | |||
| 1062 | Ga0501080_0003495 | |||
| 1063 | Ga0501080_0020492 | |||
| 1064 | Ga0501083_0015637 | |||
| 1065 | Ga0501083_0267825 | |||
| 1066 | Ga0501035_0000053 | |||
| 1067 | Ga0501035_0002015 | |||
| 1068 | Ga0501035_0028224 | |||
| 1069 | Ga0501035_0062122 | |||
| 1070 | Ga0501044_0000214 | |||
| 1071 | Ga0501044_0006017 | |||
| 1072 | Ga0501044_0007800 | |||
| 1073 | Ga0501044_0019399 | |||
| 1074 | Ga0501044_0024315 | |||
| 1075 | Ga0501044_0043550 | |||
| 1076 | Ga0501044_0046044 | |||
| 1077 | Ga0501044_0414194 | |||
| 1078 | Ga0501045_0022424 | |||
| 1079 | nmdc:mga0k408_131792_c1 | |||
| 1080 | nmdc:mga0k408_35826_c1 | |||
| 1081 | nmdc:mga06z11_2786_c1 | |||
| 1082 | nmdc:mga06z11_52857_c1 | |||
| 1083 | nmdc:mga06z11_7272_c2 | |||
| 1084 | nmdc:mga04h51_17773_c1 | |||
| 1085 | nmdc:mga07m45_258438_c1 | |||
| 1086 | nmdc:mga05p37_525036_c1 | |||
| 1087 | nmdc:mga05p37_55434_c1 | |||
| 1088 | nmdc:mga09592_375808_c1 | |||
| 1089 | nmdc:mga0qj67_175833_c1 | |||
| 1090 | nmdc:mga06r32_147014_c1 | |||
| 1091 | nmdc:mga06r32_159143_c1 | |||
| 1092 | nmdc:mga06r32_52964_c1 | |||
| 1093 | nmdc:mga06r32_88046_c1 | |||
| 1094 | nmdc:mga08y16_495154_c1 | |||
| 1095 | nmdc:mga0rr50_483271_c1 | |||
| 1096 | nmdc:mga0sz30_69808_c1 | |||
| 1097 | Ga0495601_0043319 | |||
| 1098 | Ga0495601_0068742 | |||
| 1099 | Ga0495601_0094647 | |||
| 1100 | Ga0495601_0160265 | |||
| 1101 | Ga0495612_0016030 | |||
| 1102 | Ga0495595_0046308 | |||
| 1103 | Ga0495619_0105283 | |||
| 1104 | Ga0495619_0155742 | |||
| 1105 | Ga0495619_0222260 | |||
| 1106 | Ga0495619_0300133 | |||
| 1107 | Ga0500555_030967 | |||
| 1108 | Ga0500562_005865 | |||
| 1109 | Ga0500658_0080189 | |||
| 1110 | Ga0500616_0029947 | |||
| 1111 | Ga0500627_0097490 | |||
| 1112 | Ga0501084_0157708 | |||
| 1113 | Ga0530510_0072258 | |||
| 1114 | 2509113146 | |||
| 1115 | 2509143295 | |||
| 1116 | 2509367810 | |||
| 1117 | 2509396319 | |||
| 1118 | 2512032649 | |||
| 1119 | 2512931485 | |||
| 1120 | 2512959316 | |||
| 1121 | 2513590239 | |||
| 1122 | 2513612735 | |||
| 1123 | 2514033637 | |||
| 1124 | 2514420891 | |||
| 1125 | 2514589259 | |||
| 1126 | 2523106566 | |||
| 1127 | 2588517321 | |||
| 1128 | 2597813218 | |||
| 1129 | 2599104898 | |||
| 1130 | 2599936741 | |||
| 1131 | 2643840023 | |||
| 1132 | 2643984410 | |||
| 1133 | 2644129374 | |||
| 1134 | 2644153267 | |||
| 1135 | 2644734943 | |||
| 1136 | 2688598457 | |||
| 1137 | 2694631081 | |||
| 1138 | 2694636421 | |||
| 1139 | 2723575389 | |||
| 1140 | 2753359780 | |||
| 1141 | 2756675455 | |||
| 1142 | 2757572326 | |||
| 1143 | 2758642041 | |||
| 1144 | 2792749252 | |||
| 1145 | 2837654519 | |||
| 1146 | 2837679156 | |||
| 1147 | 2841760849 | |||
| 1148 | 2841912853 | |||
| 1149 | 2841918600 | |||
| 1150 | 2844007412 | |||
| 1151 | 2844013715 | |||
| 1152 | 2844106506 | |||
| 1153 | 2846954381 | |||
| 1154 | 2847675622 | |||
| 1155 | 2847692266 | |||
| 1156 | 2848859361 | |||
| 1157 | 2848861583 | |||
| 1158 | 2851246862 | |||
| 1159 | 2856319509 | |||
| 1160 | 2856327465 | |||
| 1161 | 2856334577 | |||
| 1162 | 2856340878 | |||
| 1163 | 2856344944 | |||
| 1164 | 2856355618 | |||
| 1165 | 2856361936 | |||
| 1166 | 2856369470 | |||
| 1167 | 2857351143 | |||
| 1168 | 2857370759 | |||
| 1169 | 2869169071 | |||
| 1170 | 2869236536 | |||
| 1171 | 2869248996 | |||
| 1172 | 2869253871 | |||
| 1173 | 2869260285 | |||
| 1174 | 2869268399 | |||
| 1175 | 2869284944 | |||
| 1176 | 2869286456 | |||
| 1177 | 2871434609 | |||
| 1178 | 2871448913 | |||
| 1179 | 2871457901 | |||
| 1180 | 2871481661 | |||
| 1181 | 2871494532 | |||
| 1182 | 2871501388 | |||
| 1183 | 2874103720 | |||
| 1184 | 2874112543 | |||
| 1185 | 2874121075 | |||
| 1186 | 2874130610 | |||
| 1187 | 2874132098 | |||
| 1188 | 2874145886 | |||
| 1189 | 2874149814 | |||
| 1190 | 2874158073 | |||
| 1191 | 2874168502 | |||
| 1192 | 2874169871 | |||
| 1193 | 2876368466 | |||
| 1194 | 2876373082 | |||
| 1195 | 2876383040 | |||
| 1196 | 2876389898 | |||
| 1197 | 2876398451 | |||
| 1198 | 2876400201 | |||
| 1199 | 2876411842 | |||
| 1200 | 2876416277 | |||
| 1201 | 2876426875 | |||
| 1202 | 2878040744 | |||
| 1203 | 2878751742 | |||
| 1204 | 2878758886 | |||
| 1205 | 2878765368 | |||
| 1206 | 2878773076 | |||
| 1207 | 2878777908 | |||
| 1208 | 2878784529 | |||
| 1209 | 2878790745 | |||
| 1210 | 2881151342 | |||
| 1211 | 2881155317 | |||
| 1212 | 2881167541 | |||
| 1213 | 2881852852 | |||
| 1214 | 2881867302 | |||
| 1215 | 2882636285 | |||
| 1216 | 2882917621 | |||
| 1217 | 2885309443 | |||
| 1218 | 2885317980 | |||
| 1219 | 2885323709 | |||
| 1220 | 2885331184 | |||
| 1221 | 2885349623 | |||
| 1222 | 2885356707 | |||
| 1223 | 2888339436 | |||
| 1224 | 2888346831 | |||
| 1225 | 2888355769 | |||
| 1226 | 2889010706 | |||
| 1227 | 2889017597 | |||
| 1228 | 2889792986 | |||
| 1229 | 2889919430 | |||
| 1230 | 2897809849 | |||
| 1231 | 2903451330 | |||
| 1232 | 2903503875 | |||
| 1233 | 2903504687 | |||
| 1234 | 2903521302 | |||
| 1235 | 2903527465 | |||
| 1236 | 2903533919 | |||
| 1237 | 2903546199 | |||
| 1238 | 2904665006 | |||
| 1239 | 2906314140 | |||
| 1240 | 2906327306 | |||
| 1241 | 2906359702 | |||
| 1242 | 2906368582 | |||
| 1243 | 2906372617 | |||
| 1244 | 2906391047 | |||
| 1245 | 2906405402 | |||
| 1246 | 2906408916 | |||
| 1247 | 2906420229 | |||
| 1248 | 2922134685 | |||
| 1249 | 2922152083 | |||
| 1250 | 2922162846 | |||
| 1251 | 2922173127 | |||
| 1252 | 2922187921 | |||
| 1253 | 2924724960 | |||
| 1254 | 2924732688 | |||
| 1255 | 2924736427 | |||
| 1256 | 2924746146 | |||
| 1257 | 2924750100 | |||
| 1258 | 2924757189 | |||
| 1259 | 2924764236 | |||
| 1260 | 2924789090 | |||
| 1261 | 2937815750 | |||
| 1262 | 2937824474 | |||
| 1263 | 2937848034 | |||
| 1264 | 2937853172 | |||
| 1265 | 2937862967 | |||
| 1266 | 2937869614 | |||
| 1267 | 2937882111 | |||
| 1268 | 2937894765 | |||
| 1269 | 2937978571 | |||
| 1270 | 2937986244 | |||
| 1271 | 2938000057 | |||
| 1272 | 2938019047 | |||
| 1273 | 2958040646 | |||
| 1274 | 2958056728 | |||
| 1275 | 2958064364 | |||
| 1276 | 2958089233 | |||
| 1277 | 2958092418 | |||
| 1278 | 2958105754 | |||
| 1279 | 2958113943 | |||
| 1280 | 2958118470 | |||
| 1281 | 2958126458 | |||
| 1282 | 2958130859 | |||
| 1283 | 2958141070 | |||
| 1284 | 2958170521 | |||
| 1285 | 2958178337 | |||
| 1286 | 2958184780 | |||
| 1287 | 2961082947 | |||
| 1288 | 2961120005 | |||
| 1289 | 2961132258 | |||
| 1290 | 2961142409 | |||
| 1291 | 2961168976 | |||
| 1292 | 2961176035 | |||
| 1293 | 2961187773 | |||
| 1294 | 2963647727 | |||
| 1295 | 2965024263 | |||
| 1296 | 2965031741 | |||
| 1297 | 2965035472 | |||
| 1298 | 2965044798 | |||
| 1299 | 2965054923 | |||
| 1300 | 2965066013 | |||
| 1301 | 2965092974 | |||
| 1302 | 2965108923 | |||
| 1303 | 2965112434 | |||
| 1304 | 2965123695 | |||
| 1305 | 2968001923 | |||
| 1306 | 2968009053 | |||
| 1307 | 2968018434 | |||
| 1308 | 2968090360 | |||
| 1309 | 2968096375 | |||
| 1310 | 2968098876 | |||
| 1311 | 2968116362 | |||
| 1312 | 2968120643 | |||
| 1313 | 2968129194 | |||
| 1314 | 2968177370 | |||
| 1315 | 2970471393 | |||
| 1316 | 2970491105 | |||
| 1317 | 2970508701 | |||
| 1318 | 2970514632 | |||
| 1319 | 2970528601 | |||
| 1320 | 2970537888 | |||
| 1321 | 2970544783 | |||
| 1322 | 2970552012 | |||
| 1323 | 2970560216 | |||
| 1324 | 2970599559 | |||
| 1325 | 2970625439 | |||
| 1326 | 2970631570 | |||
| 1327 | 2977827426 | |||
| 1328 | 2977834269 | |||
| 1329 | 2977845985 | |||
| 1330 | 2977853021 | |||
| 1331 | 2977859269 | |||
| 1332 | 2977867079 | |||
| 1333 | 2977876910 | |||
| 1334 | 2977916768 | |||
| 1335 | 2977924236 | |||
| 1336 | 2977941189 | |||
| 1337 | 2977942758 | |||
| 1338 | 2977952277 | |||
| 1339 | 2977975982 | |||
| 1340 | 2977986579 | |||
| 1341 | 2979717534 | |||
| 1342 | 2979771088 | |||
| 1343 | 2979774000 | |||
| 1344 | 2979781291 | |||
| 1345 | 2979800105 | |||
| 1346 | 2979811651 | |||
| 1347 | 2987638327 | |||
| 1348 | 2987645786 | |||
| 1349 | 2987654650 | |||
| 1350 | 2987665007 | |||
| 1351 | 2987669231 | |||
| 1352 | 2987679099 | |||
| 1353 | 2996314067 | |||
| 1354 | 2996345080 | |||
| 1355 | 2996350181 | |||
| 1356 | 2996391435 | |||
| 1357 | 3000140647 | |||
| 1358 | 3004168916 | |||
| 1359 | 3004194064 | |||
| 1360 | 3004200752 | |||
| 1361 | 3004205429 | |||
| 1362 | 3004215971 | |||
| 1363 | 3004223721 | |||
| 1364 | 3004233400 | |||
| 1365 | 3004246602 | |||
| 1366 | 3004254696 | |||
| 1367 | 3004274956 | |||
| 1368 | 3004276880 | |||
| 1369 | 3004289402 | |||
| 1370 | 3004334341 | |||
| 1371 | 637074585 | |||
| 1372 | 649872983 | |||
| 1373 | 8002060863 | |||
| 1374 | 8002289033 | |||
| 1375 | 8004303632 | |||
| 1376 | 8004319932 | |||
| 1377 | 8004366767 | |||
| 1378 | 8004380407 | |||
| 1379 | 8004393630 | |||
| 1380 | 8004397583 | |||
| 1381 | 8004450190 | |||
| 1382 | 8004634840 | |||
| 1383 | 8004640809 | |||
| 1384 | 8004709372 | |||
| 1385 | 8004720398 | |||
| 1386 | 8045864566 | |||
| 1387 | 8054006165 | |||
| 1388 | 8055620784 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b5t-assembly1.cif.gz_C | escherichia coli methylenetetrahydrofolate reductase | 0.9582 | 16 | 293 |
| 2fmo-assembly1.cif.gz_B-1 | ala177val mutant of e. coli methylenetetrahydrofolate reductase | 0.9548 | 11 | 293 |
| 1zrq-assembly1.cif.gz_C | escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 6.0 | 0.9543 | 16 | 293 |
| 2fmo-assembly1.cif.gz_A | ala177val mutant of e. coli methylenetetrahydrofolate reductase | 0.951 | 16 | 293 |
| 1zpt-assembly1.cif.gz_C | escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 | 0.9504 | 16 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q75HE6_1_304_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9496 | 16 | 292 | 3.20.20.220 |
| af_A0A1D6GER4_1_215_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9337 | 87 | 290 | 3.20.20.220 |
| 1v93A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9263 | 10 | 293 | 3.20.20.220 |
| af_Q5AEI0_1_296_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9229 | 15 | 293 | 3.20.20.220 |
| af_A4IC95_4_307_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9134 | 12 | 293 | 3.20.20.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659UAU7-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9997 | 90 | 185 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A659UAU7-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9894 | 90 | 185 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A3D5UU54-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9762 | 78 | 190 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A2J4RD57-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9733 | 133 | 293 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A520J7B8-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9732 | 165 | 293 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |