F475732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 335 | 668 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300027866|Ga0209813_10048756|Ga0209813_100487562 |
| Length | 303 |
| Sequence | MFLAFLILLLGSVATLAPSGSGCDPADLRAKERPVSVRIASSLMAFPRVGFFATCLVDLFRPSVGFAAVKLLEDAGCEVEVPPQQTCCGQPGFNSGDRGDAKKIAKGVIATFDGFDYVVVPSGSCGGMIKTHYPELFEKGSPERAKADALAAKTFELVSFLADVLKVADVKASFPATATYHDSCSGLRELGVKEQPRRLLRSVSGLKLVELVDAEVCCGFGGTFCVKYPEISNTMLTKKVKRIAATGADTLIAGDLGCLMNMAGKLQRRGSRVAIRHVAEVLAGMTDDPAIGETRLTRARDGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 4 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 5 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 6 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 7 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 8 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 9 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 10 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 11 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 12 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 13 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 14 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 15 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 16 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 17 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 18 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 19 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 20 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 21 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 22 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 23 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 24 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 25 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 26 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 172 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 209 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 216 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 217 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 284 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 285 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 330 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.11 |
| Metatranscriptomes | 0.14 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.16 |
| Nodule | 0.86 |
| Rhizoplane | 7.06 |
| Rhizosphere | 81.41 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 8.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055542_1017295 | 3300003762 | Bacteria | 1118 |
| 2 | Ga0055529_1006290 | 3300003763 | Bacteria | 1668 |
| 3 | Ga0070658_10308596 | 3300005327 | Bacteria | 1350 |
| 4 | Ga0070683_100139107 | 3300005329 | Bacteria | 2300 |
| 5 | Ga0070690_100222285 | 3300005330 | Bacteria | 1324 |
| 6 | Ga0070666_10253688 | 3300005335 | Bacteria | 1246 |
| 7 | Ga0070680_100048084 | 3300005336 | Bacteria | 3476 |
| 8 | Ga0070680_100195337 | 3300005336 | Bacteria | 1706 |
| 9 | Ga0070680_100339324 | 3300005336 | Bacteria | 1277 |
| 10 | Ga0070682_100269165 | 3300005337 | Bacteria | 1237 |
| 11 | Ga0068868_100302908 | 3300005338 | Bacteria | 1358 |
| 12 | Ga0070660_100483317 | 3300005339 | Bacteria | 1029 |
| 13 | Ga0070668_100262522 | 3300005347 | Bacteria | 1436 |
| 14 | Ga0070675_100312348 | 3300005354 | Bacteria | 1387 |
| 15 | Ga0070675_100640950 | 3300005354 | Bacteria | 965 |
| 16 | Ga0070671_100100947 | 3300005355 | Bacteria | 2421 |
| 17 | Ga0070674_100108898 | 3300005356 | Bacteria | 2031 |
| 18 | Ga0070674_100375926 | 3300005356 | Bacteria | 1154 |
| 19 | Ga0070674_100415668 | 3300005356 | Bacteria | 1102 |
| 20 | Ga0070659_100140947 | 3300005366 | Bacteria | 1963 |
| 21 | Ga0070667_100206670 | 3300005367 | Bacteria | 1744 |
| 22 | Ga0070709_10045824 | 3300005434 | Bacteria | 2716 |
| 23 | Ga0070709_10062338 | 3300005434 | Bacteria | 2377 |
| 24 | Ga0070714_100034276 | 3300005435 | Bacteria | 4251 |
| 25 | Ga0070714_100182644 | 3300005435 | Bacteria | 1909 |
| 26 | Ga0070714_100263261 | 3300005435 | Bacteria | 1597 |
| 27 | Ga0070714_100336525 | 3300005435 | Bacteria | 1415 |
| 28 | Ga0070714_100418143 | 3300005435 | Bacteria | 1270 |
| 29 | Ga0070713_100066455 | 3300005436 | Bacteria | 3032 |
| 30 | Ga0070713_100091015 | 3300005436 | Bacteria | 2623 |
| 31 | Ga0070713_100194464 | 3300005436 | Bacteria | 1829 |
| 32 | Ga0070713_100195418 | 3300005436 | Bacteria | 1825 |
| 33 | Ga0070713_100372584 | 3300005436 | Bacteria | 1329 |
| 34 | Ga0070713_100417991 | 3300005436 | Bacteria | 1255 |
| 35 | Ga0070710_10034000 | 3300005437 | Bacteria | 2771 |
| 36 | Ga0070710_10062224 | 3300005437 | Bacteria | 2128 |
| 37 | Ga0070710_10206854 | 3300005437 | Bacteria | 1242 |
| 38 | Ga0070711_100090963 | 3300005439 | Bacteria | 2199 |
| 39 | Ga0070700_100132610 | 3300005441 | Bacteria | 1683 |
| 40 | Ga0070694_100429723 | 3300005444 | Bacteria | 1039 |
| 41 | Ga0070694_100461641 | 3300005444 | Bacteria | 1004 |
| 42 | Ga0070678_100045225 | 3300005456 | Bacteria | 3148 |
| 43 | Ga0070678_100070705 | 3300005456 | Bacteria | 2610 |
| 44 | Ga0070681_10000030 | 3300005458 | Bacteria | 102898 |
| 45 | Ga0070681_10000290 | 3300005458 | Bacteria | 40569 |
| 46 | Ga0070681_10119067 | 3300005458 | Bacteria | 2577 |
| 47 | Ga0070681_10343277 | 3300005458 | Bacteria | 1403 |
| 48 | Ga0068867_100134777 | 3300005459 | Bacteria | 1923 |
| 49 | Ga0070706_100239606 | 3300005467 | Bacteria | 1694 |
| 50 | Ga0070706_100281022 | 3300005467 | Bacteria | 1553 |
| 51 | Ga0070699_100112640 | 3300005518 | Bacteria | 2390 |
| 52 | Ga0070699_100816213 | 3300005518 | Bacteria | 854 |
| 53 | Ga0070679_100000949 | 3300005530 | Bacteria | 25179 |
| 54 | Ga0070679_100004492 | 3300005530 | Bacteria | 12891 |
| 55 | Ga0070684_100031254 | 3300005535 | Bacteria | 4531 |
| 56 | Ga0070684_100139060 | 3300005535 | Bacteria | 2195 |
| 57 | Ga0070697_100127841 | 3300005536 | Bacteria | 2129 |
| 58 | Ga0070697_100395805 | 3300005536 | Bacteria | 1198 |
| 59 | Ga0068853_100405427 | 3300005539 | Bacteria | 1277 |
| 60 | Ga0070695_100108497 | 3300005545 | Bacteria | 1880 |
| 61 | Ga0070695_100187440 | 3300005545 | Bacteria | 1470 |
| 62 | Ga0070696_100113534 | 3300005546 | Bacteria | 1953 |
| 63 | Ga0070696_100219832 | 3300005546 | Bacteria | 1425 |
| 64 | Ga0070665_100017169 | 3300005548 | Bacteria | 7262 |
| 65 | Ga0070665_100064747 | 3300005548 | Bacteria | 3666 |
| 66 | Ga0068855_100000080 | 3300005563 | Bacteria | 115920 |
| 67 | Ga0068855_100165826 | 3300005563 | Bacteria | 2504 |
| 68 | Ga0068857_100209552 | 3300005577 | Bacteria | 1778 |
| 69 | Ga0068856_100008810 | 3300005614 | Bacteria | 9819 |
| 70 | Ga0068856_100074699 | 3300005614 | Bacteria | 3357 |
| 71 | Ga0068856_100397712 | 3300005614 | Bacteria | 1398 |
| 72 | Ga0068856_100543826 | 3300005614 | Bacteria | 1182 |
| 73 | Ga0068852_100070479 | 3300005616 | Bacteria | 3067 |
| 74 | Ga0068852_100098394 | 3300005616 | Bacteria | 2634 |
| 75 | Ga0068859_100640636 | 3300005617 | Bacteria | 1155 |
| 76 | Ga0068858_100069416 | 3300005842 | Bacteria | 3267 |
| 77 | Ga0068860_100440442 | 3300005843 | Bacteria | 1294 |
| 78 | Ga0068862_100014189 | 3300005844 | Bacteria | 6606 |
| 79 | Ga0081455_10003778 | 3300005937 | Bacteria | 17289 |
| 80 | Ga0081538_10010446 | 3300005981 | Bacteria | 7612 |
| 81 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 82 | Ga0081539_10007126 | 3300005985 | Bacteria | 10325 |
| 83 | Ga0070717_10006757 | 3300006028 | Bacteria | 8464 |
| 84 | Ga0070717_10025871 | 3300006028 | Bacteria | 4676 |
| 85 | Ga0070717_10081853 | 3300006028 | Bacteria | 2711 |
| 86 | Ga0070717_10119287 | 3300006028 | Bacteria | 2258 |
| 87 | Ga0075368_10009923 | 3300006042 | Bacteria | 3434 |
| 88 | Ga0070716_100142616 | 3300006173 | Bacteria | 1530 |
| 89 | Ga0070716_100160836 | 3300006173 | Bacteria | 1455 |
| 90 | Ga0070712_100009526 | 3300006175 | Bacteria | 6125 |
| 91 | Ga0070712_100054421 | 3300006175 | Bacteria | 2798 |
| 92 | Ga0070712_100272217 | 3300006175 | Bacteria | 1361 |
| 93 | Ga0075367_10113627 | 3300006178 | Bacteria | 1664 |
| 94 | Ga0075366_10152669 | 3300006195 | Bacteria | 1399 |
| 95 | Ga0068871_100092675 | 3300006358 | Bacteria | 2520 |
| 96 | Ga0075428_100410051 | 3300006844 | Bacteria | 1452 |
| 97 | Ga0075428_100512541 | 3300006844 | Bacteria | 1283 |
| 98 | Ga0075431_100122844 | 3300006847 | Bacteria | 2679 |
| 99 | Ga0075434_100219561 | 3300006871 | Bacteria | 1921 |
| 100 | Ga0075436_100018711 | 3300006914 | Bacteria | 4742 |
| 101 | Ga0097620_100640558 | 3300006931 | Bacteria | 1155 |
| 102 | Ga0105240_10000575 | 3300009093 | Bacteria | 68057 |
| 103 | Ga0105240_10016714 | 3300009093 | Bacteria | 9924 |
| 104 | Ga0105240_10140015 | 3300009093 | Bacteria | 2893 |
| 105 | Ga0105240_10308317 | 3300009093 | Bacteria | 1808 |
| 106 | Ga0105240_10463591 | 3300009093 | Bacteria | 1415 |
| 107 | Ga0105245_10139496 | 3300009098 | Bacteria | 2281 |
| 108 | Ga0105245_10234921 | 3300009098 | Bacteria | 1775 |
| 109 | Ga0105245_10636795 | 3300009098 | Bacteria | 1095 |
| 110 | Ga0105243_10029034 | 3300009148 | Bacteria | 4251 |
| 111 | Ga0105243_10590104 | 3300009148 | Bacteria | 1068 |
| 112 | Ga0105242_10087691 | 3300009176 | Bacteria | 2613 |
| 113 | Ga0105242_10528125 | 3300009176 | Bacteria | 1127 |
| 114 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 115 | Ga0105248_10051710 | 3300009177 | Bacteria | 4610 |
| 116 | Ga0105248_10133028 | 3300009177 | Bacteria | 2806 |
| 117 | Ga0105248_10140574 | 3300009177 | Bacteria | 2723 |
| 118 | Ga0105237_10052414 | 3300009545 | Bacteria | 4096 |
| 119 | Ga0105237_10142718 | 3300009545 | Bacteria | 2389 |
| 120 | Ga0105238_10005915 | 3300009551 | Bacteria | 12122 |
| 121 | Ga0105238_10065786 | 3300009551 | Bacteria | 3626 |
| 122 | Ga0105238_10159756 | 3300009551 | Bacteria | 2229 |
| 123 | Ga0105249_10005913 | 3300009553 | Bacteria | 10596 |
| 124 | Ga0105249_10877629 | 3300009553 | Bacteria | 963 |
| 125 | Ga0105239_10009459 | 3300010375 | Bacteria | 10982 |
| 126 | Ga0105239_10026796 | 3300010375 | Bacteria | 6344 |
| 127 | Ga0105239_10042034 | 3300010375 | Bacteria | 5008 |
| 128 | Ga0105246_10364994 | 3300011119 | Bacteria | 1188 |
| 129 | Ga0157370_10002708 | 3300013104 | Bacteria | 21192 |
| 130 | Ga0157370_10016281 | 3300013104 | Bacteria | 7534 |
| 131 | Ga0157369_10014185 | 3300013105 | Bacteria | 9003 |
| 132 | Ga0157369_10031164 | 3300013105 | Bacteria | 5875 |
| 133 | Ga0157369_10185899 | 3300013105 | Bacteria | 2185 |
| 134 | Ga0157378_10217289 | 3300013297 | Bacteria | 1816 |
| 135 | Ga0157378_10233806 | 3300013297 | Bacteria | 1753 |
| 136 | Ga0163162_10693609 | 3300013306 | Bacteria | 1140 |
| 137 | Ga0157372_10298327 | 3300013307 | Bacteria | 1874 |
| 138 | Ga0157372_10505389 | 3300013307 | Bacteria | 1409 |
| 139 | Ga0157375_10081147 | 3300013308 | Bacteria | 3283 |
| 140 | Ga0157375_10107814 | 3300013308 | Bacteria | 2879 |
| 141 | Ga0163163_10045518 | 3300014325 | Bacteria | 4307 |
| 142 | Ga0163163_10333408 | 3300014325 | Bacteria | 1572 |
| 143 | Ga0163163_10610693 | 3300014325 | Bacteria | 1154 |
| 144 | Ga0157380_10213444 | 3300014326 | Bacteria | 1721 |
| 145 | Ga0182008_10011974 | 3300014497 | Bacteria | 4594 |
| 146 | Ga0157376_10090386 | 3300014969 | Bacteria | 2650 |
| 147 | Ga0157376_10225925 | 3300014969 | Bacteria | 1736 |
| 148 | Ga0163161_10009039 | 3300017792 | Bacteria | 6891 |
| 149 | Ga0206353_11177956 | 3300020082 | Bacteria | 1054 |
| 150 | Ga0213874_10068018 | 3300021377 | Bacteria | 1130 |
| 151 | Ga0213876_10005904 | 3300021384 | Bacteria | 6693 |
| 152 | Ga0213876_10017423 | 3300021384 | Bacteria | 3793 |
| 153 | Ga0213876_10063700 | 3300021384 | Bacteria | 1947 |
| 154 | Ga0213876_10105293 | 3300021384 | Bacteria | 1497 |
| 155 | Ga0213876_10192721 | 3300021384 | Bacteria | 1084 |
| 156 | Ga0213875_10001649 | 3300021388 | Bacteria | 14071 |
| 157 | Ga0213875_10002605 | 3300021388 | Bacteria | 10707 |
| 158 | Ga0213875_10003096 | 3300021388 | Bacteria | 9608 |
| 159 | Ga0213875_10006915 | 3300021388 | Bacteria | 5908 |
| 160 | Ga0213875_10045609 | 3300021388 | Bacteria | 2058 |
| 161 | Ga0213875_10080605 | 3300021388 | Bacteria | 1519 |
| 162 | Ga0209148_1000366 | 3300025254 | Bacteria | 55841 |
| 163 | Ga0209455_1000738 | 3300025272 | Bacteria | 18739 |
| 164 | Ga0209675_1000878 | 3300025291 | Bacteria | 19358 |
| 165 | Ga0207426_1012877 | 3300025302 | Bacteria | 3123 |
| 166 | Ga0207692_10145427 | 3300025898 | Bacteria | 1352 |
| 167 | Ga0207688_10099313 | 3300025901 | Bacteria | 1679 |
| 168 | Ga0207688_10157615 | 3300025901 | Bacteria | 1344 |
| 169 | Ga0207699_10022975 | 3300025906 | Bacteria | 3388 |
| 170 | Ga0207699_10061906 | 3300025906 | Bacteria | 2254 |
| 171 | Ga0207699_10172630 | 3300025906 | Bacteria | 1447 |
| 172 | Ga0207705_10307919 | 3300025909 | Bacteria | 1216 |
| 173 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 174 | Ga0207707_10005682 | 3300025912 | Bacteria | 10914 |
| 175 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 176 | Ga0207695_10019677 | 3300025913 | Bacteria | 7763 |
| 177 | Ga0207695_10029022 | 3300025913 | Bacteria | 6121 |
| 178 | Ga0207671_10044036 | 3300025914 | Bacteria | 3300 |
| 179 | Ga0207693_10004952 | 3300025915 | Bacteria | 11190 |
| 180 | Ga0207693_10008584 | 3300025915 | Bacteria | 8364 |
| 181 | Ga0207693_10011991 | 3300025915 | Bacteria | 7007 |
| 182 | Ga0207693_10202544 | 3300025915 | Bacteria | 1561 |
| 183 | Ga0207693_10260295 | 3300025915 | Bacteria | 1361 |
| 184 | Ga0207693_10288956 | 3300025915 | Bacteria | 1285 |
| 185 | Ga0207663_10083762 | 3300025916 | Bacteria | 2096 |
| 186 | Ga0207663_10355244 | 3300025916 | Bacteria | 1110 |
| 187 | Ga0207660_10000652 | 3300025917 | Bacteria | 23389 |
| 188 | Ga0207660_10201020 | 3300025917 | Bacteria | 1556 |
| 189 | Ga0207660_10357529 | 3300025917 | Bacteria | 1171 |
| 190 | Ga0207652_10000311 | 3300025921 | Bacteria | 50145 |
| 191 | Ga0207652_10010915 | 3300025921 | Bacteria | 7321 |
| 192 | Ga0207646_10016802 | 3300025922 | Bacteria | 6862 |
| 193 | Ga0207646_10104113 | 3300025922 | Bacteria | 2545 |
| 194 | Ga0207681_10026942 | 3300025923 | Bacteria | 3712 |
| 195 | Ga0207681_10253209 | 3300025923 | Bacteria | 1376 |
| 196 | Ga0207694_10000055 | 3300025924 | Bacteria | 151308 |
| 197 | Ga0207659_10384700 | 3300025926 | Bacteria | 1171 |
| 198 | Ga0207687_10349928 | 3300025927 | Bacteria | 1203 |
| 199 | Ga0207700_10019735 | 3300025928 | Bacteria | 4559 |
| 200 | Ga0207700_10115044 | 3300025928 | Bacteria | 2171 |
| 201 | Ga0207700_10152002 | 3300025928 | Bacteria | 1914 |
| 202 | Ga0207700_10192416 | 3300025928 | Bacteria | 1715 |
| 203 | Ga0207700_10477644 | 3300025928 | Bacteria | 1101 |
| 204 | Ga0207664_10073519 | 3300025929 | Bacteria | 2758 |
| 205 | Ga0207664_10104201 | 3300025929 | Bacteria | 2348 |
| 206 | Ga0207664_10232992 | 3300025929 | Bacteria | 1601 |
| 207 | Ga0207664_10309010 | 3300025929 | Bacteria | 1393 |
| 208 | Ga0207664_10357858 | 3300025929 | Bacteria | 1293 |
| 209 | Ga0207664_10437747 | 3300025929 | Bacteria | 1166 |
| 210 | Ga0207644_10056066 | 3300025931 | Bacteria | 2843 |
| 211 | Ga0207690_10104307 | 3300025932 | Bacteria | 2031 |
| 212 | Ga0207706_10065284 | 3300025933 | Bacteria | 3205 |
| 213 | Ga0207706_10194512 | 3300025933 | Bacteria | 1779 |
| 214 | Ga0207686_10085407 | 3300025934 | Bacteria | 2070 |
| 215 | Ga0207665_10029799 | 3300025939 | Bacteria | 3606 |
| 216 | Ga0207665_10191350 | 3300025939 | Bacteria | 1487 |
| 217 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 218 | Ga0207711_10094294 | 3300025941 | Bacteria | 2637 |
| 219 | Ga0207689_10321350 | 3300025942 | Bacteria | 1284 |
| 220 | Ga0207661_10303870 | 3300025944 | Bacteria | 1431 |
| 221 | Ga0207661_10336739 | 3300025944 | Bacteria | 1359 |
| 222 | Ga0207679_10111008 | 3300025945 | Bacteria | 2164 |
| 223 | Ga0207679_10483186 | 3300025945 | Bacteria | 1103 |
| 224 | Ga0207667_10000068 | 3300025949 | Bacteria | 180716 |
| 225 | Ga0207651_10360294 | 3300025960 | Bacteria | 1227 |
| 226 | Ga0207668_10151257 | 3300025972 | Bacteria | 1797 |
| 227 | Ga0207668_10292161 | 3300025972 | Bacteria | 1341 |
| 228 | Ga0207703_10060350 | 3300026035 | Bacteria | 3101 |
| 229 | Ga0207703_10342326 | 3300026035 | Bacteria | 1375 |
| 230 | Ga0207639_10057654 | 3300026041 | Bacteria | 2983 |
| 231 | Ga0207702_10012415 | 3300026078 | Bacteria | 7092 |
| 232 | Ga0207702_10040096 | 3300026078 | Bacteria | 3925 |
| 233 | Ga0207702_10600565 | 3300026078 | Bacteria | 1080 |
| 234 | Ga0207674_10128706 | 3300026116 | Bacteria | 2496 |
| 235 | Ga0207674_10208602 | 3300026116 | Bacteria | 1903 |
| 236 | Ga0207675_100008717 | 3300026118 | Bacteria | 9531 |
| 237 | Ga0207675_100404189 | 3300026118 | Bacteria | 1346 |
| 238 | Ga0207683_10041007 | 3300026121 | Bacteria | 4041 |
| 239 | Ga0207683_10045974 | 3300026121 | Bacteria | 3818 |
| 240 | Ga0207698_10033786 | 3300026142 | Bacteria | 3721 |
| 241 | Ga0207698_10582974 | 3300026142 | Bacteria | 1100 |
| 242 | Ga0209179_1026118 | 3300027512 | Bacteria | 1170 |
| 243 | Ga0209813_10048756 | 3300027866 | Bacteria | 1316 |
| 244 | Ga0207428_10000651 | 3300027907 | Bacteria | 40728 |
| 245 | Ga0268266_10003807 | 3300028379 | Bacteria | 14755 |
| 246 | Ga0268266_10151567 | 3300028379 | Bacteria | 2090 |
| 247 | Ga0268266_10162519 | 3300028379 | Bacteria | 2021 |
| 248 | Ga0268265_10095407 | 3300028380 | Bacteria | 2388 |
| 249 | Ga0268264_10156289 | 3300028381 | Bacteria | 2050 |
| 250 | Ga0268264_10681849 | 3300028381 | Bacteria | 1019 |
| 251 | Ga0265330_10025039 | 3300031235 | Bacteria | 2706 |
| 252 | Ga0265332_10000508 | 3300031238 | Bacteria | 26654 |
| 253 | Ga0265328_10004683 | 3300031239 | Bacteria | 5915 |
| 254 | Ga0265325_10036069 | 3300031241 | Bacteria | 2622 |
| 255 | Ga0265340_10009467 | 3300031247 | Bacteria | 5227 |
| 256 | Ga0265340_10011425 | 3300031247 | Bacteria | 4716 |
| 257 | Ga0265339_10013810 | 3300031249 | Bacteria | 4887 |
| 258 | Ga0265339_10016458 | 3300031249 | Bacteria | 4406 |
| 259 | Ga0265339_10112626 | 3300031249 | Bacteria | 1406 |
| 260 | Ga0265331_10006826 | 3300031250 | Bacteria | 6685 |
| 261 | Ga0265316_10029170 | 3300031344 | Bacteria | 4541 |
| 262 | Ga0265316_10052522 | 3300031344 | Bacteria | 3197 |
| 263 | Ga0265316_10095422 | 3300031344 | Bacteria | 2265 |
| 264 | Ga0307408_100029367 | 3300031548 | Bacteria | 3809 |
| 265 | Ga0307408_100045235 | 3300031548 | Bacteria | 3143 |
| 266 | Ga0265313_10011988 | 3300031595 | Bacteria | 5342 |
| 267 | Ga0307508_10030386 | 3300031616 | Bacteria | 4883 |
| 268 | Ga0307514_10005043 | 3300031649 | Bacteria | 11944 |
| 269 | Ga0265314_10038245 | 3300031711 | Bacteria | 3469 |
| 270 | Ga0265342_10000573 | 3300031712 | Bacteria | 38852 |
| 271 | Ga0316576_10165397 | 3300031727 | Bacteria | 1669 |
| 272 | Ga0316578_10062595 | 3300031728 | Bacteria | 2194 |
| 273 | Ga0307406_10467875 | 3300031901 | Bacteria | 1015 |
| 274 | Ga0307412_10336332 | 3300031911 | Bacteria | 1207 |
| 275 | Ga0307409_100319803 | 3300031995 | Bacteria | 1452 |
| 276 | Ga0307416_100805156 | 3300032002 | Bacteria | 1035 |
| 277 | Ga0307414_10092133 | 3300032004 | Bacteria | 2255 |
| 278 | Ga0307411_10057047 | 3300032005 | Bacteria | 2577 |
| 279 | Ga0307415_100032315 | 3300032126 | Bacteria | 3383 |
| 280 | Ga0307510_10059307 | 3300033180 | Bacteria | 3954 |
| 281 | Ga0373926_0095548 | 3300035083 | Bacteria | 1108 |
| 282 | Ga0373944_0118880 | 3300035089 | Bacteria | 909 |
| 283 | Ga0373923_0035928 | 3300035111 | Bacteria | 2020 |
| 284 | Ga0373923_0162325 | 3300035111 | Bacteria | 1020 |
| 285 | Ga0373936_0009944 | 3300035113 | Bacteria | 3589 |
| 286 | Ga0373936_0025050 | 3300035113 | Bacteria | 2331 |
| 287 | Ga0373945_0002616 | 3300035116 | Bacteria | 5640 |
| 288 | Ga0373945_0059098 | 3300035116 | Bacteria | 1427 |
| 289 | Ga0373953_0000371 | 3300035117 | Bacteria | 12135 |
| 290 | Ga0373953_0075386 | 3300035117 | Bacteria | 1396 |
| 291 | Ga0373954_0007576 | 3300035118 | Bacteria | 4752 |
| 292 | Ga0373956_0124269 | 3300035119 | Bacteria | 1206 |
| 293 | Ga0373957_0011436 | 3300035120 | Bacteria | 2963 |
| 294 | Ga0373943_0004245 | 3300035170 | Bacteria | 6499 |
| 295 | Ga0373943_0027098 | 3300035170 | Bacteria | 2690 |
| 296 | Ga0373946_0001712 | 3300035171 | Bacteria | 7649 |
| 297 | Ga0373955_0000114 | 3300035172 | Bacteria | 32465 |
| 298 | Ga0373955_0097961 | 3300035172 | Bacteria | 1680 |
| 299 | Ga0373955_0339587 | 3300035172 | Bacteria | 909 |
| 300 | Ga0373924_0000320 | 3300035410 | Bacteria | 14822 |
| 301 | Ga0373924_0048908 | 3300035410 | Bacteria | 1748 |
| 302 | Ga0373931_0057234 | 3300035691 | Bacteria | 2090 |
| 303 | Ga0373935_0000395 | 3300035692 | Bacteria | 22565 |
| 304 | Ga0373935_0214092 | 3300035692 | Bacteria | 1336 |
| 305 | Ga0373935_0275705 | 3300035692 | Bacteria | 1183 |
| 306 | Ga0373935_0443529 | 3300035692 | Bacteria | 937 |
| 307 | Ga0373935_0503450 | 3300035692 | Bacteria | 879 |
| 308 | Ga0373927_0003872 | 3300035695 | Bacteria | 10610 |
| 309 | Ga0373927_0075067 | 3300035695 | Bacteria | 2189 |
| 310 | Ga0373927_0075637 | 3300035695 | Bacteria | 2181 |
| 311 | Ga0373933_0142157 | 3300035724 | Bacteria | 1516 |
| 312 | Ga0373933_0259471 | 3300035724 | Bacteria | 1120 |
| 313 | Ga0373947_0000980 | 3300035725 | Bacteria | 17423 |
| 314 | Ga0373947_0019078 | 3300035725 | Bacteria | 3952 |
| 315 | Ga0373947_0024667 | 3300035725 | Bacteria | 3505 |
| 316 | Ga0373947_0104858 | 3300035725 | Bacteria | 1781 |
| 317 | Ga0373937_0000079 | 3300036401 | Bacteria | 88626 |
| 318 | Ga0373937_0010551 | 3300036401 | Bacteria | 8069 |
| 319 | Ga0373937_0091941 | 3300036401 | Bacteria | 2812 |
| 320 | Ga0373937_0192510 | 3300036401 | Bacteria | 1916 |
| 321 | Ga0373937_0318456 | 3300036401 | Bacteria | 1471 |
| 322 | Ga0373937_0319624 | 3300036401 | Bacteria | 1469 |
| 323 | Ga0316582_0061052 | 3300036647 | Unclassified | 2418 |
| 324 | Ga0316584_0053180 | 3300036712 | Bacteria | 3030 |
| 325 | Ga0373925_0000064 | 3300037068 | Bacteria | 114743 |
| 326 | Ga0373925_0005920 | 3300037068 | Bacteria | 9065 |
| 327 | Ga0373925_0061537 | 3300037068 | Bacteria | 2820 |
| 328 | Ga0373925_0140813 | 3300037068 | Bacteria | 1887 |
| 329 | Ga0373925_0199315 | 3300037068 | Bacteria | 1591 |
| 330 | Ga0373925_0303232 | 3300037068 | Bacteria | 1290 |
| 331 | Ga0373925_0418983 | 3300037068 | Bacteria | 1094 |
| 332 | Ga0395899_0014326 | 3300037312 | Bacteria | 6052 |
| 333 | Ga0395900_0150390 | 3300037418 | Bacteria | 2378 |
| 334 | Ga0395898_0066631 | 3300037466 | Bacteria | 3487 |
| 335 | Ga0395905_0092306 | 3300037471 | Bacteria | 2839 |
| 336 | Ga0436364_0128168 | 3300037853 | Bacteria | 71580 |
| 337 | Ga0436364_0146609 | 3300037853 | Bacteria | 16108 |
| 338 | Ga0436364_0157955 | 3300037853 | Bacteria | 52897 |
| 339 | Ga0436364_0320085 | 3300037853 | Bacteria | 1556 |
| 340 | Ga0436364_0559442 | 3300037853 | Bacteria | 5196 |
| 341 | Ga0436364_0645563 | 3300037853 | Bacteria | 2289 |
| 342 | Ga0436364_0729534 | 3300037853 | Bacteria | 5028 |
| 343 | Ga0436364_0790279 | 3300037853 | Bacteria | 2933 |
| 344 | Ga0436364_0961939 | 3300037853 | Bacteria | 5785 |
| 345 | Ga0436364_1027283 | 3300037853 | Bacteria | 8278 |
| 346 | Ga0436364_1243048 | 3300037853 | Bacteria | 1912 |
| 347 | Ga0400486_16095 | 3300038742 | Bacteria | 2371 |
| 348 | Ga0400483_292171 | 3300039062 | Bacteria | 65188 |
| 349 | Ga0436365_0557618 | 3300039437 | Bacteria | 3163 |
| 350 | Ga0436365_0612905 | 3300039437 | Bacteria | 3040 |
| 351 | Ga0436365_0848884 | 3300039437 | Bacteria | 2621 |
| 352 | Ga0436365_1034188 | 3300039437 | Bacteria | 34077 |
| 353 | Ga0436365_1301518 | 3300039437 | Bacteria | 44224 |
| 354 | Ga0436365_1738174 | 3300039437 | Bacteria | 3583 |
| 355 | Ga0436360_0119299 | 3300039438 | Bacteria | 4999 |
| 356 | Ga0436360_0233885 | 3300039438 | Bacteria | 2103 |
| 357 | Ga0436360_0347755 | 3300039438 | Bacteria | 3733 |
| 358 | Ga0436360_0354685 | 3300039438 | Bacteria | 5313 |
| 359 | Ga0436360_0365560 | 3300039438 | Bacteria | 1324 |
| 360 | Ga0436360_0788354 | 3300039438 | Bacteria | 1876 |
| 361 | Ga0436360_1208531 | 3300039438 | Bacteria | 857 |
| 362 | Ga0436361_0124664 | 3300039447 | Bacteria | 5541 |
| 363 | Ga0436361_0205740 | 3300039447 | Bacteria | 6489 |
| 364 | Ga0436361_0397425 | 3300039447 | Bacteria | 1005 |
| 365 | Ga0436361_0727677 | 3300039447 | Bacteria | 2612 |
| 366 | Ga0436361_0982947 | 3300039447 | Bacteria | 966 |
| 367 | Ga0436361_1143633 | 3300039447 | Bacteria | 987 |
| 368 | Ga0436363_0134158 | 3300039450 | Bacteria | 1708 |
| 369 | Ga0436363_0269445 | 3300039450 | Bacteria | 2633 |
| 370 | Ga0436363_0413557 | 3300039450 | Bacteria | 10195 |
| 371 | Ga0436363_0423875 | 3300039450 | Bacteria | 3445 |
| 372 | Ga0436363_0934104 | 3300039450 | Bacteria | 2070 |
| 373 | Ga0436363_1600896 | 3300039450 | Bacteria | 1087 |
| 374 | Ga0436362_0015457 | 3300039453 | Bacteria | 2013 |
| 375 | Ga0436362_0304993 | 3300039453 | Bacteria | 1108 |
| 376 | Ga0436362_0305268 | 3300039453 | Bacteria | 3246 |
| 377 | Ga0436362_0345293 | 3300039453 | Bacteria | 970 |
| 378 | Ga0436362_0439386 | 3300039453 | Bacteria | 1248 |
| 379 | Ga0439466_0109720 | 3300041411 | Bacteria | 856 |
| 380 | Ga0451793_0004549 | 3300041452 | Bacteria | 943 |
| 381 | Ga0439435_0014469 | 3300042436 | Bacteria | 1949 |
| 382 | Ga0451577_0225515 | 3300042876 | Bacteria | 1694 |
| 383 | Ga0466969_0144838 | 3300044656 | Bacteria | 1097 |
| 384 | Ga0466972_0132807 | 3300044658 | Bacteria | 1172 |
| 385 | Ga0466961_0088171 | 3300044693 | Bacteria | 1960 |
| 386 | Ga0466963_0018767 | 3300044694 | Bacteria | 4329 |
| 387 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 388 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 389 | Ga0466957_0148345 | 3300044842 | Bacteria | 1515 |
| 390 | Ga0466959_0055041 | 3300045049 | Bacteria | 2905 |
| 391 | Ga0451576_0003329 | 3300045051 | Bacteria | 22260 |
| 392 | Ga0451576_0076846 | 3300045051 | Bacteria | 3475 |
| 393 | Ga0451576_0951006 | 3300045051 | Bacteria | 901 |
| 394 | Ga0466967_0253280 | 3300045976 | Bacteria | 1682 |
| 395 | Ga0466967_0293717 | 3300045976 | Bacteria | 1562 |
| 396 | Ga0466967_1143672 | 3300045976 | Bacteria | 776 |
| 397 | Ga0495592_0000762 | 3300046454 | Bacteria | 22399 |
| 398 | Ga0495592_0003819 | 3300046454 | Bacteria | 10889 |
| 399 | Ga0495592_0157846 | 3300046454 | Bacteria | 1563 |
| 400 | Ga0495629_0006340 | 3300046459 | Bacteria | 8774 |
| 401 | Ga0495629_0263377 | 3300046459 | Bacteria | 1185 |
| 402 | Ga0495651_0004555 | 3300046462 | Bacteria | 10594 |
| 403 | Ga0495651_0007570 | 3300046462 | Bacteria | 8307 |
| 404 | Ga0495651_0083307 | 3300046462 | Bacteria | 2412 |
| 405 | Ga0495651_0118058 | 3300046462 | Bacteria | 1952 |
| 406 | Ga0495653_0000086 | 3300046463 | Bacteria | 76161 |
| 407 | Ga0495580_0083741 | 3300046472 | Bacteria | 2222 |
| 408 | Ga0495639_0021384 | 3300046475 | Bacteria | 2832 |
| 409 | Ga0495662_0003051 | 3300046476 | Bacteria | 8445 |
| 410 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 411 | Ga0495664_0001415 | 3300046477 | Bacteria | 12716 |
| 412 | Ga0495664_0024578 | 3300046477 | Bacteria | 3503 |
| 413 | Ga0495664_0284276 | 3300046477 | Bacteria | 999 |
| 414 | Ga0495594_0370127 | 3300046499 | Bacteria | 816 |
| 415 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 416 | Ga0495618_0000018 | 3300046514 | Bacteria | 139407 |
| 417 | Ga0495618_0200070 | 3300046514 | Bacteria | 1265 |
| 418 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 419 | Ga0495628_0020351 | 3300046516 | Bacteria | 5476 |
| 420 | Ga0495628_0026845 | 3300046516 | Bacteria | 4688 |
| 421 | Ga0495630_0001287 | 3300046517 | Bacteria | 17287 |
| 422 | Ga0495630_0059744 | 3300046517 | Bacteria | 2861 |
| 423 | Ga0495632_0002735 | 3300046519 | Bacteria | 13101 |
| 424 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 425 | Ga0495652_0198891 | 3300046529 | Bacteria | 1522 |
| 426 | Ga0495652_0391349 | 3300046529 | Bacteria | 986 |
| 427 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 428 | Ga0495640_0011000 | 3300046533 | Bacteria | 6970 |
| 429 | Ga0495640_0222119 | 3300046533 | Bacteria | 1191 |
| 430 | Ga0495586_0038973 | 3300046535 | Bacteria | 2554 |
| 431 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 432 | Ga0495587_0075114 | 3300046536 | Bacteria | 1962 |
| 433 | Ga0495587_0078571 | 3300046536 | Unclassified | 1914 |
| 434 | Ga0495645_0000009 | 3300046543 | Bacteria | 239632 |
| 435 | Ga0495645_0011855 | 3300046543 | Bacteria | 6141 |
| 436 | Ga0495645_0015122 | 3300046543 | Bacteria | 5486 |
| 437 | Ga0495667_0000004 | 3300046559 | Bacteria | 295297 |
| 438 | Ga0495667_0017708 | 3300046559 | Bacteria | 4813 |
| 439 | Ga0495667_0138238 | 3300046559 | Bacteria | 1570 |
| 440 | Ga0495634_0000014 | 3300046642 | Bacteria | 128091 |
| 441 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 442 | Ga0495635_0350442 | 3300046663 | Bacteria | 985 |
| 443 | Ga0495657_0001040 | 3300046675 | Bacteria | 24263 |
| 444 | Ga0495657_0034708 | 3300046675 | Bacteria | 3501 |
| 445 | Ga0495657_0243384 | 3300046675 | Bacteria | 1085 |
| 446 | Ga0495599_0000036 | 3300046678 | Bacteria | 102707 |
| 447 | Ga0495599_0011772 | 3300046678 | Bacteria | 5377 |
| 448 | Ga0495599_0102892 | 3300046678 | Bacteria | 1780 |
| 449 | Ga0495599_0274085 | 3300046678 | Bacteria | 1023 |
| 450 | Ga0495623_0017188 | 3300046679 | Bacteria | 4672 |
| 451 | Ga0495646_0000019 | 3300046680 | Bacteria | 119527 |
| 452 | Ga0495646_0016881 | 3300046680 | Bacteria | 4636 |
| 453 | Ga0495646_0112019 | 3300046680 | Bacteria | 1553 |
| 454 | Ga0495658_0037839 | 3300046683 | Bacteria | 2669 |
| 455 | Ga0495658_0296235 | 3300046683 | Bacteria | 1023 |
| 456 | Ga0495658_0340298 | 3300046683 | Bacteria | 953 |
| 457 | Ga0495613_0005980 | 3300046689 | Bacteria | 9108 |
| 458 | Ga0495613_0221248 | 3300046689 | Bacteria | 1329 |
| 459 | Ga0495624_0266938 | 3300046690 | Bacteria | 1034 |
| 460 | Ga0495670_0000007 | 3300046691 | Bacteria | 247088 |
| 461 | Ga0495600_0000123 | 3300046809 | Bacteria | 43494 |
| 462 | Ga0495600_0103027 | 3300046809 | Bacteria | 1860 |
| 463 | Ga0495600_0159159 | 3300046809 | Bacteria | 1460 |
| 464 | Ga0495581_0005814 | 3300047315 | Bacteria | 7153 |
| 465 | Ga0495581_0125096 | 3300047315 | Bacteria | 1497 |
| 466 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 467 | Ga0495604_0022414 | 3300047317 | Bacteria | 5043 |
| 468 | Ga0495674_0000016 | 3300047319 | Bacteria | 216763 |
| 469 | Ga0495674_0034614 | 3300047319 | Bacteria | 4566 |
| 470 | Ga0495674_0039910 | 3300047319 | Bacteria | 4203 |
| 471 | Ga0495674_0317601 | 3300047319 | Bacteria | 1270 |
| 472 | Ga0495680_0000349 | 3300047322 | Bacteria | 51602 |
| 473 | Ga0495680_0032781 | 3300047322 | Bacteria | 4213 |
| 474 | Ga0495680_0080994 | 3300047322 | Bacteria | 2452 |
| 475 | Ga0495680_0284162 | 3300047322 | Bacteria | 1165 |
| 476 | Ga0495675_0001070 | 3300047444 | Bacteria | 16605 |
| 477 | Ga0495675_0015943 | 3300047444 | Bacteria | 4752 |
| 478 | Ga0495675_0045395 | 3300047444 | Bacteria | 2798 |
| 479 | Ga0495675_0185264 | 3300047444 | Bacteria | 1273 |
| 480 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 481 | Ga0495684_0101097 | 3300047471 | Bacteria | 2180 |
| 482 | Ga0495684_0151713 | 3300047471 | Bacteria | 1732 |
| 483 | Ga0495684_0180011 | 3300047471 | Bacteria | 1567 |
| 484 | Ga0495686_0029987 | 3300047472 | Bacteria | 3535 |
| 485 | Ga0495593_0008176 | 3300047673 | Bacteria | 6086 |
| 486 | Ga0495602_0000066 | 3300048088 | Bacteria | 102731 |
| 487 | Ga0495602_0000513 | 3300048088 | Bacteria | 36136 |
| 488 | Ga0495602_0031496 | 3300048088 | Bacteria | 5014 |
| 489 | Ga0495602_0152495 | 3300048088 | Bacteria | 1814 |
| 490 | Ga0495602_0155083 | 3300048088 | Bacteria | 1794 |
| 491 | Ga0496100_0309889 | 3300048903 | Bacteria | 1183 |
| 492 | Ga0496101_0016142 | 3300048904 | Bacteria | 5042 |
| 493 | Ga0496102_0101841 | 3300048905 | Bacteria | 2669 |
| 494 | Ga0496102_0136771 | 3300048905 | Bacteria | 2296 |
| 495 | Ga0496102_0482055 | 3300048905 | Bacteria | 1162 |
| 496 | Ga0496104_0002439 | 3300048907 | Bacteria | 16017 |
| 497 | Ga0496104_0006378 | 3300048907 | Bacteria | 10372 |
| 498 | Ga0496104_0027620 | 3300048907 | Bacteria | 5253 |
| 499 | Ga0496104_0062211 | 3300048907 | Bacteria | 3539 |
| 500 | Ga0496104_0313168 | 3300048907 | Bacteria | 1482 |
| 501 | Ga0496105_0000433 | 3300048908 | Bacteria | 27434 |
| 502 | Ga0496105_0002518 | 3300048908 | Bacteria | 13288 |
| 503 | Ga0496105_0002986 | 3300048908 | Bacteria | 12433 |
| 504 | Ga0496105_0004363 | 3300048908 | Bacteria | 10649 |
| 505 | Ga0496106_0160894 | 3300048909 | Bacteria | 1775 |
| 506 | Ga0496106_0191675 | 3300048909 | Bacteria | 1625 |
| 507 | Ga0496107_0231792 | 3300048910 | Bacteria | 1374 |
| 508 | Ga0496108_0000416 | 3300048911 | Bacteria | 34834 |
| 509 | Ga0496108_0073933 | 3300048911 | Bacteria | 2877 |
| 510 | Ga0496108_0124885 | 3300048911 | Bacteria | 2209 |
| 511 | Ga0496109_0001317 | 3300048912 | Bacteria | 20486 |
| 512 | Ga0496109_0846257 | 3300048912 | Bacteria | 853 |
| 513 | Ga0496110_0009228 | 3300048913 | Bacteria | 7973 |
| 514 | Ga0496110_0031833 | 3300048913 | Bacteria | 4553 |
| 515 | Ga0496110_0060328 | 3300048913 | Bacteria | 3344 |
| 516 | Ga0496110_0110511 | 3300048913 | Bacteria | 2470 |
| 517 | Ga0496110_0185844 | 3300048913 | Bacteria | 1887 |
| 518 | Ga0496110_0218292 | 3300048913 | Bacteria | 1734 |
| 519 | Ga0496110_0482089 | 3300048913 | Bacteria | 1130 |
| 520 | Ga0496111_0003408 | 3300048914 | Bacteria | 9839 |
| 521 | Ga0496111_0040603 | 3300048914 | Bacteria | 3338 |
| 522 | Ga0496111_0302866 | 3300048914 | Bacteria | 1185 |
| 523 | Ga0496112_0010780 | 3300048915 | Bacteria | 8313 |
| 524 | Ga0496112_0033019 | 3300048915 | Bacteria | 5026 |
| 525 | Ga0496112_0041717 | 3300048915 | Bacteria | 4490 |
| 526 | Ga0496112_0310757 | 3300048915 | Bacteria | 1521 |
| 527 | Ga0496113_0004716 | 3300048916 | Bacteria | 8413 |
| 528 | Ga0496113_0024469 | 3300048916 | Bacteria | 4292 |
| 529 | Ga0496113_0094188 | 3300048916 | Bacteria | 2313 |
| 530 | Ga0496114_0198863 | 3300048917 | Bacteria | 1755 |
| 531 | Ga0496114_0206925 | 3300048917 | Bacteria | 1720 |
| 532 | Ga0496114_0501104 | 3300048917 | Bacteria | 1074 |
| 533 | Ga0496115_0024070 | 3300048918 | Bacteria | 4731 |
| 534 | Ga0496115_0038610 | 3300048918 | Bacteria | 3789 |
| 535 | Ga0496115_0070353 | 3300048918 | Bacteria | 2836 |
| 536 | Ga0496115_0083010 | 3300048918 | Bacteria | 2611 |
| 537 | Ga0496115_0344654 | 3300048918 | Bacteria | 1216 |
| 538 | Ga0496119_0077132 | 3300048922 | Bacteria | 1931 |
| 539 | Ga0496120_0074565 | 3300048923 | Bacteria | 1853 |
| 540 | Ga0496120_0153876 | 3300048923 | Bacteria | 1153 |
| 541 | Ga0496121_0054182 | 3300048924 | Bacteria | 3354 |
| 542 | Ga0496126_0182507 | 3300048929 | Bacteria | 1782 |
| 543 | Ga0495682_0000882 | 3300049460 | Bacteria | 18611 |
| 544 | Ga0501031_0024159 | 3300049568 | Bacteria | 3962 |
| 545 | Ga0501031_0347154 | 3300049568 | Bacteria | 961 |
| 546 | Ga0501032_0000546 | 3300049569 | Bacteria | 30501 |
| 547 | Ga0501033_0000076 | 3300049570 | Bacteria | 93921 |
| 548 | Ga0501033_0029643 | 3300049570 | Bacteria | 4112 |
| 549 | Ga0501033_0147763 | 3300049570 | Bacteria | 1697 |
| 550 | Ga0501034_0001507 | 3300049571 | Bacteria | 30558 |
| 551 | Ga0501034_0002934 | 3300049571 | Bacteria | 19768 |
| 552 | Ga0501034_0013853 | 3300049571 | Bacteria | 8300 |
| 553 | Ga0501034_0078128 | 3300049571 | Bacteria | 3314 |
| 554 | Ga0501034_0196629 | 3300049571 | Bacteria | 1976 |
| 555 | Ga0501034_0221980 | 3300049571 | Bacteria | 1842 |
| 556 | Ga0501036_0001029 | 3300049572 | Bacteria | 21072 |
| 557 | Ga0501036_0018683 | 3300049572 | Bacteria | 5813 |
| 558 | Ga0501036_0038467 | 3300049572 | Bacteria | 4049 |
| 559 | Ga0501037_0000838 | 3300049573 | Bacteria | 22953 |
| 560 | Ga0501037_0040606 | 3300049573 | Bacteria | 3424 |
| 561 | Ga0501038_0004571 | 3300049574 | Bacteria | 12877 |
| 562 | Ga0501038_0459049 | 3300049574 | Bacteria | 979 |
| 563 | Ga0501039_0002888 | 3300049575 | Bacteria | 12860 |
| 564 | Ga0501039_0012377 | 3300049575 | Bacteria | 6511 |
| 565 | Ga0501039_0064179 | 3300049575 | Bacteria | 2846 |
| 566 | Ga0501039_0430032 | 3300049575 | Bacteria | 1037 |
| 567 | Ga0501040_0006992 | 3300049576 | Bacteria | 7311 |
| 568 | Ga0501040_0031938 | 3300049576 | Bacteria | 3561 |
| 569 | Ga0501040_0217472 | 3300049576 | Bacteria | 1359 |
| 570 | Ga0501041_0001547 | 3300049577 | Bacteria | 12791 |
| 571 | Ga0501041_0004937 | 3300049577 | Bacteria | 7754 |
| 572 | Ga0501042_0002531 | 3300049578 | Bacteria | 11248 |
| 573 | Ga0501042_0007204 | 3300049578 | Bacteria | 7278 |
| 574 | Ga0501042_0455203 | 3300049578 | Bacteria | 928 |
| 575 | Ga0501043_0000043 | 3300049579 | Bacteria | 115410 |
| 576 | Ga0501043_0007635 | 3300049579 | Bacteria | 8569 |
| 577 | Ga0501046_0012654 | 3300049580 | Bacteria | 7175 |
| 578 | Ga0501046_0044343 | 3300049580 | Bacteria | 3537 |
| 579 | Ga0501047_0003830 | 3300049581 | Bacteria | 14145 |
| 580 | Ga0501047_0016124 | 3300049581 | Bacteria | 7127 |
| 581 | Ga0501047_0058006 | 3300049581 | Bacteria | 3741 |
| 582 | Ga0501047_0201981 | 3300049581 | Bacteria | 1849 |
| 583 | Ga0501048_0000809 | 3300049582 | Bacteria | 22980 |
| 584 | Ga0501048_0030397 | 3300049582 | Bacteria | 3908 |
| 585 | Ga0501068_0028636 | 3300049584 | Bacteria | 3296 |
| 586 | Ga0501068_0066663 | 3300049584 | Bacteria | 2193 |
| 587 | Ga0501068_0096669 | 3300049584 | Bacteria | 1827 |
| 588 | Ga0501070_0042766 | 3300049586 | Bacteria | 3773 |
| 589 | Ga0501070_0160071 | 3300049586 | Bacteria | 1856 |
| 590 | Ga0501070_0213540 | 3300049586 | Bacteria | 1583 |
| 591 | Ga0501070_0294990 | 3300049586 | Bacteria | 1321 |
| 592 | Ga0501071_0016801 | 3300049587 | Bacteria | 5034 |
| 593 | Ga0501071_0033969 | 3300049587 | Bacteria | 3627 |
| 594 | Ga0501071_0448272 | 3300049587 | Bacteria | 988 |
| 595 | Ga0501072_0000611 | 3300049588 | Bacteria | 25731 |
| 596 | Ga0501072_0001322 | 3300049588 | Bacteria | 18579 |
| 597 | Ga0501072_0012372 | 3300049588 | Bacteria | 6521 |
| 598 | Ga0501072_0368861 | 3300049588 | Bacteria | 1140 |
| 599 | Ga0501072_0385704 | 3300049588 | Bacteria | 1112 |
| 600 | Ga0501073_0028874 | 3300049589 | Bacteria | 3963 |
| 601 | Ga0501073_0190818 | 3300049589 | Bacteria | 1418 |
| 602 | Ga0501074_0053055 | 3300049590 | Bacteria | 2926 |
| 603 | Ga0501075_0005902 | 3300049591 | Bacteria | 8376 |
| 604 | Ga0501075_0224390 | 3300049591 | Bacteria | 1433 |
| 605 | Ga0501075_0359342 | 3300049591 | Bacteria | 1110 |
| 606 | Ga0501076_0002518 | 3300049592 | Bacteria | 12609 |
| 607 | Ga0501076_0007284 | 3300049592 | Bacteria | 8050 |
| 608 | Ga0501076_0517451 | 3300049592 | Bacteria | 984 |
| 609 | Ga0501077_0012097 | 3300049593 | Bacteria | 5403 |
| 610 | Ga0501077_0021059 | 3300049593 | Bacteria | 4125 |
| 611 | Ga0501079_0000593 | 3300049741 | Bacteria | 23982 |
| 612 | Ga0501079_0014911 | 3300049741 | Bacteria | 5923 |
| 613 | Ga0501080_0019510 | 3300049742 | Bacteria | 6280 |
| 614 | Ga0501080_0056161 | 3300049742 | Bacteria | 3667 |
| 615 | Ga0501080_0232174 | 3300049742 | Bacteria | 1686 |
| 616 | Ga0501080_0478525 | 3300049742 | Bacteria | 1114 |
| 617 | Ga0501081_0025160 | 3300049743 | Bacteria | 4002 |
| 618 | Ga0501035_0000958 | 3300049822 | Bacteria | 30505 |
| 619 | Ga0501035_0082586 | 3300049822 | Bacteria | 2835 |
| 620 | Ga0501035_0582887 | 3300049822 | Bacteria | 913 |
| 621 | Ga0501044_0010596 | 3300049823 | Bacteria | 10000 |
| 622 | Ga0501044_0062620 | 3300049823 | Bacteria | 3802 |
| 623 | Ga0501044_0078020 | 3300049823 | Bacteria | 3357 |
| 624 | Ga0501044_0100956 | 3300049823 | Bacteria | 2903 |
| 625 | Ga0501044_0166694 | 3300049823 | Bacteria | 2177 |
| 626 | Ga0501044_0214379 | 3300049823 | Bacteria | 1878 |
| 627 | Ga0501045_0000080 | 3300049824 | Bacteria | 45916 |
| 628 | Ga0501045_0047109 | 3300049824 | Bacteria | 3140 |
| 629 | Ga0501045_0440284 | 3300049824 | Bacteria | 969 |
| 630 | nmdc:mga0k408_54687_c1 | 3300050493 | Bacteria | 2313 |
| 631 | nmdc:mga0qj67_41868_c1 | 3300050509 | Bacteria | 3604 |
| 632 | nmdc:mga08y16_299903_c1 | 3300050511 | Bacteria | 1656 |
| 633 | nmdc:mga08y16_42_c1 | 3300050511 | Bacteria | 128353 |
| 634 | nmdc:mga0n895_534258_c1 | 3300050512 | Bacteria | 1179 |
| 635 | nmdc:mga0rr50_72354_c1 | 3300050513 | Bacteria | 2632 |
| 636 | nmdc:mga08x19_30359_c1 | 3300050514 | Bacteria | 3395 |
| 637 | nmdc:mga08x19_67475_c1 | 3300050514 | Bacteria | 2326 |
| 638 | nmdc:mga0sz30_109579_c1 | 3300050516 | Bacteria | 1209 |
| 639 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 640 | Ga0495601_0007865 | 3300053077 | Bacteria | 6277 |
| 641 | Ga0495601_0099516 | 3300053077 | Bacteria | 1877 |
| 642 | Ga0495601_0208886 | 3300053077 | Bacteria | 1275 |
| 643 | Ga0495612_0000003 | 3300053078 | Bacteria | 303629 |
| 644 | Ga0495612_0000204 | 3300053078 | Bacteria | 25372 |
| 645 | Ga0495612_0052857 | 3300053078 | Bacteria | 1672 |
| 646 | Ga0495612_0055227 | 3300053078 | Bacteria | 1637 |
| 647 | Ga0495595_0000400 | 3300053084 | Bacteria | 16467 |
| 648 | Ga0495595_0006488 | 3300053084 | Bacteria | 4774 |
| 649 | Ga0495595_0180951 | 3300053084 | Bacteria | 1045 |
| 650 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 651 | Ga0495619_0004720 | 3300053085 | Bacteria | 8676 |
| 652 | Ga0495619_0074730 | 3300053085 | Bacteria | 2273 |
| 653 | Ga0495619_0182362 | 3300053085 | Bacteria | 1452 |
| 654 | Ga0495619_0249565 | 3300053085 | Bacteria | 1230 |
| 655 | Ga0500651_0317220 | 3300053093 | Bacteria | 891 |
| 656 | Ga0500568_0006856 | 3300053139 | Bacteria | 5670 |
| 657 | Ga0500619_017197 | 3300053154 | Bacteria | 2007 |
| 658 | Ga0501084_0008447 | 3300054114 | Bacteria | 8512 |
| 659 | Ga0501084_0043895 | 3300054114 | Bacteria | 3741 |
| 660 | Ga0590071_010402 | 3300059421 | Bacteria | 2179 |
| 661 | Ga0501082_0001982 | 3300060353 | Bacteria | 18013 |
| 662 | Ga0501082_0044501 | 3300060353 | Bacteria | 3829 |
| 663 | Ga0501082_0096032 | 3300060353 | Bacteria | 2562 |
| 664 | Ga0501082_0568704 | 3300060353 | Bacteria | 992 |
| 665 | Ga0530510_0006133 | 3300061734 | Bacteria | 8346 |
| 666 | Ga0530510_0011857 | 3300061734 | Bacteria | 6116 |
| 667 | Ga0530510_0146643 | 3300061734 | Bacteria | 1741 |
| 668 | Ga0530510_0236115 | 3300061734 | Bacteria | 1361 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025913 | Ga0207695_10019677 | Ga0207695_100196775 | 214 |
| 2 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001775 | 214 |
| 3 | 3300025933 | Ga0207706_10194512 | Ga0207706_101945122 | 218 |
| 4 | 3300053093 | Ga0500651_0317220 | Ga0500651_0317220_18_689 | 223 |
| 5 | 3300005436 | Ga0070713_100066455 | Ga0070713_1000664552 | 227 |
| 6 | 3300006028 | Ga0070717_10119287 | Ga0070717_101192872 | 227 |
| 7 | 3300049581 | Ga0501047_0201981 | Ga0501047_0201981_181_879 | 232 |
| 8 | 3300053154 | Ga0500619_017197 | Ga0500619_017197_514_1212 | 232 |
| 9 | 3300006178 | Ga0075367_10113627 | Ga0075367_101136272 | 237 |
| 10 | 3300049586 | Ga0501070_0042766 | Ga0501070_0042766_363_1079 | 238 |
| 11 | 3300005339 | Ga0070660_100483317 | Ga0070660_1004833171 | 240 |
| 12 | 3300005458 | Ga0070681_10000030 | Ga0070681_100000302 | 240 |
| 13 | 3300005530 | Ga0070679_100004492 | Ga0070679_10000449211 | 240 |
| 14 | 3300005563 | Ga0068855_100000080 | Ga0068855_10000008056 | 240 |
| 15 | 3300005616 | Ga0068852_100070479 | Ga0068852_1000704793 | 240 |
| 16 | 3300005616 | Ga0068852_100098394 | Ga0068852_1000983942 | 240 |
| 17 | 3300009093 | Ga0105240_10000575 | Ga0105240_100005757 | 240 |
| 18 | 3300009093 | Ga0105240_10016714 | Ga0105240_100167147 | 240 |
| 19 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011096 | 240 |
| 20 | 3300009177 | Ga0105248_10140574 | Ga0105248_101405742 | 240 |
| 21 | 3300009551 | Ga0105238_10005915 | Ga0105238_100059155 | 240 |
| 22 | 3300010375 | Ga0105239_10009459 | Ga0105239_100094592 | 240 |
| 23 | 3300010375 | Ga0105239_10042034 | Ga0105239_100420342 | 240 |
| 24 | 3300013105 | Ga0157369_10014185 | Ga0157369_100141856 | 240 |
| 25 | 3300013307 | Ga0157372_10298327 | Ga0157372_102983272 | 240 |
| 26 | 3300025912 | Ga0207707_10000001 | Ga0207707_100000011051 | 240 |
| 27 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012781 | 240 |
| 28 | 3300025916 | Ga0207663_10355244 | Ga0207663_103552442 | 240 |
| 29 | 3300025917 | Ga0207660_10000652 | Ga0207660_1000065215 | 240 |
| 30 | 3300025921 | Ga0207652_10000311 | Ga0207652_1000031118 | 240 |
| 31 | 3300025924 | Ga0207694_10000055 | Ga0207694_1000005544 | 240 |
| 32 | 3300025949 | Ga0207667_10000068 | Ga0207667_10000068105 | 240 |
| 33 | 3300026041 | Ga0207639_10057654 | Ga0207639_100576542 | 240 |
| 34 | 3300026142 | Ga0207698_10033786 | Ga0207698_100337864 | 240 |
| 35 | 3300026142 | Ga0207698_10582974 | Ga0207698_105829742 | 240 |
| 36 | 3300031239 | Ga0265328_10004683 | Ga0265328_100046832 | 240 |
| 37 | 3300031249 | Ga0265339_10016458 | Ga0265339_100164583 | 240 |
| 38 | 3300031344 | Ga0265316_10052522 | Ga0265316_100525223 | 240 |
| 39 | 3300031711 | Ga0265314_10038245 | Ga0265314_100382454 | 240 |
| 40 | 3300048918 | Ga0496115_0344654 | Ga0496115_0344654_113_835 | 240 |
| 41 | 3300049460 | Ga0495682_0000882 | Ga0495682_0000882_6205_6927 | 240 |
| 42 | 3300049742 | Ga0501080_0019510 | Ga0501080_0019510_2884_3606 | 240 |
| 43 | 3300046691 | Ga0495670_0000007 | Ga0495670_0000007_244420_245157 | 243 |
| 44 | 3300039438 | Ga0436360_0119299 | Ga0436360_0119299_1603_2367 | 244 |
| 45 | 3300039453 | Ga0436362_0345293 | Ga0436362_0345293_217_957 | 244 |
| 46 | 3300031249 | Ga0265339_10112626 | Ga0265339_101126262 | 245 |
| 47 | 3300045976 | Ga0466967_1143672 | Ga0466967_1143672_14_757 | 245 |
| 48 | 3300046477 | Ga0495664_0024578 | Ga0495664_0024578_406_1143 | 245 |
| 49 | 3300046536 | Ga0495587_0078571 | Ga0495587_0078571_977_1714 | 245 |
| 50 | 3300046543 | Ga0495645_0011855 | Ga0495645_0011855_3005_3742 | 245 |
| 51 | 3300046678 | Ga0495599_0102892 | Ga0495599_0102892_837_1574 | 245 |
| 52 | 3300047444 | Ga0495675_0045395 | Ga0495675_0045395_848_1585 | 245 |
| 53 | 3300048929 | Ga0496126_0182507 | Ga0496126_0182507_593_1342 | 245 |
| 54 | 3300049571 | Ga0501034_0221980 | Ga0501034_0221980_380_1117 | 245 |
| 55 | 3300049581 | Ga0501047_0003830 | Ga0501047_0003830_7642_8379 | 245 |
| 56 | 3300049588 | Ga0501072_0012372 | Ga0501072_0012372_5146_5883 | 245 |
| 57 | 3300049589 | Ga0501073_0028874 | Ga0501073_0028874_285_1022 | 245 |
| 58 | 3300054114 | Ga0501084_0043895 | Ga0501084_0043895_2752_3489 | 245 |
| 59 | iso_pu_bacteria | 2919709256 | 2919710371 | 245 |
| 60 | 3300048088 | Ga0495602_0031496 | Ga0495602_0031496_965_1711 | 246 |
| 61 | iso_pu_bacteria | 2522572158 | 2523103468 | 246 |
| 62 | 3300011119 | Ga0105246_10364994 | Ga0105246_103649942 | 247 |
| 63 | 3300013306 | Ga0163162_10693609 | Ga0163162_106936092 | 247 |
| 64 | 3300014497 | Ga0182008_10011974 | Ga0182008_100119745 | 247 |
| 65 | 3300049570 | Ga0501033_0147763 | Ga0501033_0147763_400_1155 | 247 |
| 66 | 3300049823 | Ga0501044_0100956 | Ga0501044_0100956_1292_2047 | 247 |
| 67 | 3300014325 | Ga0163163_10610693 | Ga0163163_106106932 | 248 |
| 68 | 3300039437 | Ga0436365_0557618 | Ga0436365_0557618_1567_2343 | 248 |
| 69 | 3300042436 | Ga0439435_0014469 | Ga0439435_0014469_845_1618 | 248 |
| 70 | iso_pu_bacteria | 2883291878 | 2883297114 | 248 |
| 71 | 3300005434 | Ga0070709_10062338 | Ga0070709_100623382 | 249 |
| 72 | 3300005436 | Ga0070713_100195418 | Ga0070713_1001954182 | 249 |
| 73 | 3300005436 | Ga0070713_100372584 | Ga0070713_1003725841 | 249 |
| 74 | 3300005437 | Ga0070710_10206854 | Ga0070710_102068542 | 249 |
| 75 | 3300005439 | Ga0070711_100090963 | Ga0070711_1000909632 | 249 |
| 76 | 3300005467 | Ga0070706_100239606 | Ga0070706_1002396062 | 249 |
| 77 | 3300005536 | Ga0070697_100127841 | Ga0070697_1001278412 | 249 |
| 78 | 3300006028 | Ga0070717_10006757 | Ga0070717_100067574 | 249 |
| 79 | 3300006175 | Ga0070712_100009526 | Ga0070712_1000095265 | 249 |
| 80 | 3300006175 | Ga0070712_100054421 | Ga0070712_1000544213 | 249 |
| 81 | 3300009553 | Ga0105249_10005913 | Ga0105249_1000591312 | 249 |
| 82 | 3300017792 | Ga0163161_10009039 | Ga0163161_100090392 | 249 |
| 83 | 3300021388 | Ga0213875_10001649 | Ga0213875_1000164913 | 249 |
| 84 | 3300025901 | Ga0207688_10099313 | Ga0207688_100993132 | 249 |
| 85 | 3300025906 | Ga0207699_10172630 | Ga0207699_101726302 | 249 |
| 86 | 3300025915 | Ga0207693_10004952 | Ga0207693_100049522 | 249 |
| 87 | 3300025915 | Ga0207693_10008584 | Ga0207693_100085842 | 249 |
| 88 | 3300025916 | Ga0207663_10083762 | Ga0207663_100837622 | 249 |
| 89 | 3300025928 | Ga0207700_10477644 | Ga0207700_104776442 | 249 |
| 90 | 3300036647 | Ga0316582_0061052 | Ga0316582_0061052_1481_2236 | 249 |
| 91 | 3300037853 | Ga0436364_0157955 | Ga0436364_0157955_41554_42312 | 249 |
| 92 | 3300037853 | Ga0436364_0729534 | Ga0436364_0729534_1653_2489 | 249 |
| 93 | 3300039062 | Ga0400483_292171 | Ga0400483_292171_14376_15152 | 249 |
| 94 | 3300039438 | Ga0436360_0347755 | Ga0436360_0347755_2640_3392 | 249 |
| 95 | 3300039450 | Ga0436363_0269445 | Ga0436363_0269445_1225_1977 | 249 |
| 96 | 3300048913 | Ga0496110_0031833 | Ga0496110_0031833_1991_2746 | 249 |
| 97 | 3300048924 | Ga0496121_0054182 | Ga0496121_0054182_1187_1942 | 249 |
| 98 | iso_pu_bacteria | 2599185354 | 2600203248 | 249 |
| 99 | iso_pu_bacteria | 2713897090 | 2715500049 | 249 |
| 100 | iso_pu_bacteria | 2830075706 | 2830077987 | 249 |
| 101 | iso_pu_bacteria | 2834578030 | 2834578677 | 249 |
| 102 | iso_pu_bacteria | 2855020534 | 2855022119 | 249 |
| 103 | 3300044658 | Ga0466972_0132807 | Ga0466972_0132807_34_789 | 250 |
| 104 | 3300050516 | nmdc:mga0sz30_109579_c1 | nmdc:mga0sz30_109579_c1_214_969 | 250 |
| 105 | iso_pu_bacteria | 2751185897 | 2753766774 | 250 |
| 106 | iso_pu_bacteria | 2917554339 | 2917555886 | 250 |
| 107 | 3300005614 | Ga0068856_100397712 | Ga0068856_1003977122 | 251 |
| 108 | 3300046519 | Ga0495632_0002735 | Ga0495632_0002735_7108_7869 | 251 |
| 109 | 3300048907 | Ga0496104_0002439 | Ga0496104_0002439_6570_7364 | 251 |
| 110 | 3300048907 | Ga0496104_0313168 | Ga0496104_0313168_336_1130 | 251 |
| 111 | 3300048908 | Ga0496105_0000433 | Ga0496105_0000433_23074_23853 | 251 |
| 112 | 3300048908 | Ga0496105_0004363 | Ga0496105_0004363_8885_9679 | 251 |
| 113 | 3300048911 | Ga0496108_0124885 | Ga0496108_0124885_1288_2082 | 251 |
| 114 | 3300048912 | Ga0496109_0846257 | Ga0496109_0846257_75_839 | 251 |
| 115 | 3300048913 | Ga0496110_0009228 | Ga0496110_0009228_1326_2120 | 251 |
| 116 | 3300048915 | Ga0496112_0033019 | Ga0496112_0033019_383_1177 | 251 |
| 117 | 3300048916 | Ga0496113_0094188 | Ga0496113_0094188_1121_1915 | 251 |
| 118 | 3300048917 | Ga0496114_0501104 | Ga0496114_0501104_230_1024 | 251 |
| 119 | 3300048918 | Ga0496115_0070353 | Ga0496115_0070353_653_1447 | 251 |
| 120 | 3300048918 | Ga0496115_0083010 | Ga0496115_0083010_489_1268 | 251 |
| 121 | iso_pu_bacteria | 2523231067 | 2523467985 | 251 |
| 122 | iso_pu_bacteria | 2738543031 | 2739350014 | 251 |
| 123 | iso_pu_bacteria | 2842333319 | 2842340794 | 251 |
| 124 | 3300005367 | Ga0070667_100206670 | Ga0070667_1002066702 | 252 |
| 125 | 3300005435 | Ga0070714_100336525 | Ga0070714_1003365251 | 252 |
| 126 | 3300005441 | Ga0070700_100132610 | Ga0070700_1001326102 | 252 |
| 127 | 3300005444 | Ga0070694_100461641 | Ga0070694_1004616411 | 252 |
| 128 | 3300005467 | Ga0070706_100281022 | Ga0070706_1002810222 | 252 |
| 129 | 3300005518 | Ga0070699_100816213 | Ga0070699_1008162131 | 252 |
| 130 | 3300005535 | Ga0070684_100031254 | Ga0070684_1000312544 | 252 |
| 131 | 3300005539 | Ga0068853_100405427 | Ga0068853_1004054271 | 252 |
| 132 | 3300005546 | Ga0070696_100219832 | Ga0070696_1002198322 | 252 |
| 133 | 3300005563 | Ga0068855_100165826 | Ga0068855_1001658263 | 252 |
| 134 | 3300006173 | Ga0070716_100160836 | Ga0070716_1001608362 | 252 |
| 135 | 3300006358 | Ga0068871_100092675 | Ga0068871_1000926752 | 252 |
| 136 | 3300009098 | Ga0105245_10139496 | Ga0105245_101394962 | 252 |
| 137 | 3300009176 | Ga0105242_10087691 | Ga0105242_100876913 | 252 |
| 138 | 3300009177 | Ga0105248_10051710 | Ga0105248_100517103 | 252 |
| 139 | 3300009551 | Ga0105238_10065786 | Ga0105238_100657861 | 252 |
| 140 | 3300009551 | Ga0105238_10159756 | Ga0105238_101597562 | 252 |
| 141 | 3300013105 | Ga0157369_10185899 | Ga0157369_101858992 | 252 |
| 142 | 3300013307 | Ga0157372_10505389 | Ga0157372_105053892 | 252 |
| 143 | 3300020082 | Ga0206353_11177956 | Ga0206353_111779561 | 252 |
| 144 | 3300021384 | Ga0213876_10105293 | Ga0213876_101052932 | 252 |
| 145 | 3300025915 | Ga0207693_10202544 | Ga0207693_102025442 | 252 |
| 146 | 3300025922 | Ga0207646_10016802 | Ga0207646_100168022 | 252 |
| 147 | 3300025928 | Ga0207700_10192416 | Ga0207700_101924162 | 252 |
| 148 | 3300025934 | Ga0207686_10085407 | Ga0207686_100854071 | 252 |
| 149 | 3300025941 | Ga0207711_10094294 | Ga0207711_100942942 | 252 |
| 150 | 3300025942 | Ga0207689_10321350 | Ga0207689_103213502 | 252 |
| 151 | 3300025945 | Ga0207679_10111008 | Ga0207679_101110082 | 252 |
| 152 | 3300026035 | Ga0207703_10342326 | Ga0207703_103423262 | 252 |
| 153 | 3300026078 | Ga0207702_10040096 | Ga0207702_100400962 | 252 |
| 154 | 3300026116 | Ga0207674_10128706 | Ga0207674_101287062 | 252 |
| 155 | 3300031727 | Ga0316576_10165397 | Ga0316576_101653972 | 252 |
| 156 | 3300031728 | Ga0316578_10062595 | Ga0316578_100625952 | 252 |
| 157 | 3300035113 | Ga0373936_0025050 | Ga0373936_0025050_1473_2255 | 252 |
| 158 | 3300035116 | Ga0373945_0002616 | Ga0373945_0002616_432_1214 | 252 |
| 159 | 3300035117 | Ga0373953_0000371 | Ga0373953_0000371_8237_9019 | 252 |
| 160 | 3300035118 | Ga0373954_0007576 | Ga0373954_0007576_1558_2340 | 252 |
| 161 | 3300035170 | Ga0373943_0004245 | Ga0373943_0004245_4998_5780 | 252 |
| 162 | 3300035171 | Ga0373946_0001712 | Ga0373946_0001712_5254_6036 | 252 |
| 163 | 3300035172 | Ga0373955_0000114 | Ga0373955_0000114_17499_18281 | 252 |
| 164 | 3300035172 | Ga0373955_0339587 | Ga0373955_0339587_94_858 | 252 |
| 165 | 3300035410 | Ga0373924_0000320 | Ga0373924_0000320_8767_9549 | 252 |
| 166 | 3300035692 | Ga0373935_0000395 | Ga0373935_0000395_7582_8364 | 252 |
| 167 | 3300035695 | Ga0373927_0003872 | Ga0373927_0003872_2355_3137 | 252 |
| 168 | 3300035725 | Ga0373947_0000980 | Ga0373947_0000980_11363_12145 | 252 |
| 169 | 3300035725 | Ga0373947_0104858 | Ga0373947_0104858_887_1762 | 252 |
| 170 | 3300036401 | Ga0373937_0000079 | Ga0373937_0000079_23565_24347 | 252 |
| 171 | 3300036712 | Ga0316584_0053180 | Ga0316584_0053180_1136_1897 | 252 |
| 172 | 3300037068 | Ga0373925_0000064 | Ga0373925_0000064_7423_8205 | 252 |
| 173 | 3300037068 | Ga0373925_0061537 | Ga0373925_0061537_1017_1907 | 252 |
| 174 | 3300041452 | Ga0451793_0004549 | Ga0451793_0004549_110_877 | 252 |
| 175 | 3300044694 | Ga0466963_0018767 | Ga0466963_0018767_2178_2954 | 252 |
| 176 | 3300044842 | Ga0466957_0148345 | Ga0466957_0148345_479_1255 | 252 |
| 177 | 3300045976 | Ga0466967_0253280 | Ga0466967_0253280_257_1033 | 252 |
| 178 | 3300046454 | Ga0495592_0000762 | Ga0495592_0000762_14194_14976 | 252 |
| 179 | 3300046459 | Ga0495629_0006340 | Ga0495629_0006340_7126_7908 | 252 |
| 180 | 3300046462 | Ga0495651_0004555 | Ga0495651_0004555_2454_3236 | 252 |
| 181 | 3300046462 | Ga0495651_0083307 | Ga0495651_0083307_43_822 | 252 |
| 182 | 3300046463 | Ga0495653_0000086 | Ga0495653_0000086_67987_68769 | 252 |
| 183 | 3300046475 | Ga0495639_0021384 | Ga0495639_0021384_1610_2392 | 252 |
| 184 | 3300046476 | Ga0495662_0003051 | Ga0495662_0003051_1745_2527 | 252 |
| 185 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_294330_295112 | 252 |
| 186 | 3300046511 | Ga0495608_0000011 | Ga0495608_0000011_240334_241116 | 252 |
| 187 | 3300046514 | Ga0495618_0000018 | Ga0495618_0000018_124423_125205 | 252 |
| 188 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_783731_784513 | 252 |
| 189 | 3300046517 | Ga0495630_0001287 | Ga0495630_0001287_9212_9994 | 252 |
| 190 | 3300046517 | Ga0495630_0059744 | Ga0495630_0059744_1823_2698 | 252 |
| 191 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_51803_52585 | 252 |
| 192 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_238544_239326 | 252 |
| 193 | 3300046533 | Ga0495640_0011000 | Ga0495640_0011000_4771_5646 | 252 |
| 194 | 3300046535 | Ga0495586_0038973 | Ga0495586_0038973_310_1092 | 252 |
| 195 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_311000_311782 | 252 |
| 196 | 3300046543 | Ga0495645_0000009 | Ga0495645_0000009_170902_171684 | 252 |
| 197 | 3300046559 | Ga0495667_0000004 | Ga0495667_0000004_210647_211429 | 252 |
| 198 | 3300046642 | Ga0495634_0000014 | Ga0495634_0000014_125382_126164 | 252 |
| 199 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_296811_297593 | 252 |
| 200 | 3300046675 | Ga0495657_0001040 | Ga0495657_0001040_5956_6738 | 252 |
| 201 | 3300046675 | Ga0495657_0243384 | Ga0495657_0243384_279_1058 | 252 |
| 202 | 3300046678 | Ga0495599_0000036 | Ga0495599_0000036_94518_95300 | 252 |
| 203 | 3300046680 | Ga0495646_0000019 | Ga0495646_0000019_111280_112062 | 252 |
| 204 | 3300046683 | Ga0495658_0037839 | Ga0495658_0037839_1551_2333 | 252 |
| 205 | 3300046689 | Ga0495613_0005980 | Ga0495613_0005980_1747_2529 | 252 |
| 206 | 3300046809 | Ga0495600_0000123 | Ga0495600_0000123_1447_2229 | 252 |
| 207 | 3300046809 | Ga0495600_0103027 | Ga0495600_0103027_646_1425 | 252 |
| 208 | 3300047315 | Ga0495581_0005814 | Ga0495581_0005814_5307_6089 | 252 |
| 209 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_208252_209034 | 252 |
| 210 | 3300047319 | Ga0495674_0000016 | Ga0495674_0000016_132241_133023 | 252 |
| 211 | 3300047319 | Ga0495674_0034614 | Ga0495674_0034614_79_954 | 252 |
| 212 | 3300047322 | Ga0495680_0000349 | Ga0495680_0000349_43407_44189 | 252 |
| 213 | 3300047444 | Ga0495675_0001070 | Ga0495675_0001070_7557_8339 | 252 |
| 214 | 3300047444 | Ga0495675_0185264 | Ga0495675_0185264_410_1189 | 252 |
| 215 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_208310_209092 | 252 |
| 216 | 3300047471 | Ga0495684_0180011 | Ga0495684_0180011_682_1461 | 252 |
| 217 | 3300047673 | Ga0495593_0008176 | Ga0495593_0008176_3857_4639 | 252 |
| 218 | 3300048088 | Ga0495602_0000066 | Ga0495602_0000066_94511_95293 | 252 |
| 219 | 3300048905 | Ga0496102_0136771 | Ga0496102_0136771_607_1371 | 252 |
| 220 | 3300048909 | Ga0496106_0160894 | Ga0496106_0160894_410_1174 | 252 |
| 221 | 3300048910 | Ga0496107_0231792 | Ga0496107_0231792_303_1067 | 252 |
| 222 | 3300048913 | Ga0496110_0110511 | Ga0496110_0110511_843_1607 | 252 |
| 223 | 3300048914 | Ga0496111_0302866 | Ga0496111_0302866_329_1093 | 252 |
| 224 | 3300049591 | Ga0501075_0359342 | Ga0501075_0359342_182_946 | 252 |
| 225 | 3300049742 | Ga0501080_0478525 | Ga0501080_0478525_52_828 | 252 |
| 226 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_247810_248592 | 252 |
| 227 | 3300053077 | Ga0495601_0099516 | Ga0495601_0099516_339_1118 | 252 |
| 228 | 3300053078 | Ga0495612_0000003 | Ga0495612_0000003_94513_95295 | 252 |
| 229 | 3300053078 | Ga0495612_0052857 | Ga0495612_0052857_657_1436 | 252 |
| 230 | 3300053084 | Ga0495595_0000400 | Ga0495595_0000400_8022_8804 | 252 |
| 231 | 3300053084 | Ga0495595_0006488 | Ga0495595_0006488_2836_3615 | 252 |
| 232 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_247841_248623 | 252 |
| 233 | 3300053085 | Ga0495619_0004720 | Ga0495619_0004720_928_1707 | 252 |
| 234 | iso_pu_bacteria | 2597490356 | 2599102816 | 252 |
| 235 | iso_pu_bacteria | 2846952575 | 2846952690 | 252 |
| 236 | 3300005330 | Ga0070690_100222285 | Ga0070690_1002222852 | 253 |
| 237 | 3300005335 | Ga0070666_10253688 | Ga0070666_102536882 | 253 |
| 238 | 3300005337 | Ga0070682_100269165 | Ga0070682_1002691652 | 253 |
| 239 | 3300005347 | Ga0070668_100262522 | Ga0070668_1002625222 | 253 |
| 240 | 3300005355 | Ga0070671_100100947 | Ga0070671_1001009472 | 253 |
| 241 | 3300005434 | Ga0070709_10045824 | Ga0070709_100458242 | 253 |
| 242 | 3300005435 | Ga0070714_100034276 | Ga0070714_1000342765 | 253 |
| 243 | 3300005435 | Ga0070714_100182644 | Ga0070714_1001826442 | 253 |
| 244 | 3300005435 | Ga0070714_100263261 | Ga0070714_1002632612 | 253 |
| 245 | 3300005435 | Ga0070714_100418143 | Ga0070714_1004181432 | 253 |
| 246 | 3300005436 | Ga0070713_100091015 | Ga0070713_1000910152 | 253 |
| 247 | 3300005436 | Ga0070713_100194464 | Ga0070713_1001944642 | 253 |
| 248 | 3300005437 | Ga0070710_10034000 | Ga0070710_100340004 | 253 |
| 249 | 3300005437 | Ga0070710_10062224 | Ga0070710_100622242 | 253 |
| 250 | 3300005456 | Ga0070678_100070705 | Ga0070678_1000707052 | 253 |
| 251 | 3300005518 | Ga0070699_100112640 | Ga0070699_1001126402 | 253 |
| 252 | 3300005548 | Ga0070665_100017169 | Ga0070665_1000171697 | 253 |
| 253 | 3300005614 | Ga0068856_100008810 | Ga0068856_1000088103 | 253 |
| 254 | 3300005614 | Ga0068856_100543826 | Ga0068856_1005438261 | 253 |
| 255 | 3300006028 | Ga0070717_10025871 | Ga0070717_100258712 | 253 |
| 256 | 3300006028 | Ga0070717_10081853 | Ga0070717_100818532 | 253 |
| 257 | 3300006042 | Ga0075368_10009923 | Ga0075368_100099231 | 253 |
| 258 | 3300006173 | Ga0070716_100142616 | Ga0070716_1001426162 | 253 |
| 259 | 3300006195 | Ga0075366_10152669 | Ga0075366_101526692 | 253 |
| 260 | 3300006914 | Ga0075436_100018711 | Ga0075436_1000187113 | 253 |
| 261 | 3300009176 | Ga0105242_10528125 | Ga0105242_105281252 | 253 |
| 262 | 3300013297 | Ga0157378_10217289 | Ga0157378_102172892 | 253 |
| 263 | 3300013308 | Ga0157375_10107814 | Ga0157375_101078141 | 253 |
| 264 | 3300014969 | Ga0157376_10225925 | Ga0157376_102259252 | 253 |
| 265 | 3300025291 | Ga0209675_1000878 | Ga0209675_10008788 | 253 |
| 266 | 3300025898 | Ga0207692_10145427 | Ga0207692_101454272 | 253 |
| 267 | 3300025906 | Ga0207699_10022975 | Ga0207699_100229752 | 253 |
| 268 | 3300025906 | Ga0207699_10061906 | Ga0207699_100619062 | 253 |
| 269 | 3300025915 | Ga0207693_10011991 | Ga0207693_100119913 | 253 |
| 270 | 3300025922 | Ga0207646_10104113 | Ga0207646_101041132 | 253 |
| 271 | 3300025927 | Ga0207687_10349928 | Ga0207687_103499282 | 253 |
| 272 | 3300025928 | Ga0207700_10019735 | Ga0207700_100197353 | 253 |
| 273 | 3300025928 | Ga0207700_10115044 | Ga0207700_101150442 | 253 |
| 274 | 3300025928 | Ga0207700_10152002 | Ga0207700_101520022 | 253 |
| 275 | 3300025929 | Ga0207664_10073519 | Ga0207664_100735193 | 253 |
| 276 | 3300025929 | Ga0207664_10104201 | Ga0207664_101042012 | 253 |
| 277 | 3300025929 | Ga0207664_10232992 | Ga0207664_102329922 | 253 |
| 278 | 3300025929 | Ga0207664_10357858 | Ga0207664_103578582 | 253 |
| 279 | 3300025939 | Ga0207665_10029799 | Ga0207665_100297991 | 253 |
| 280 | 3300025939 | Ga0207665_10191350 | Ga0207665_101913502 | 253 |
| 281 | 3300025945 | Ga0207679_10483186 | Ga0207679_104831861 | 253 |
| 282 | 3300025972 | Ga0207668_10292161 | Ga0207668_102921612 | 253 |
| 283 | 3300026078 | Ga0207702_10012415 | Ga0207702_100124158 | 253 |
| 284 | 3300026078 | Ga0207702_10600565 | Ga0207702_106005651 | 253 |
| 285 | 3300026121 | Ga0207683_10041007 | Ga0207683_100410073 | 253 |
| 286 | 3300027512 | Ga0209179_1026118 | Ga0209179_10261181 | 253 |
| 287 | 3300028379 | Ga0268266_10151567 | Ga0268266_101515672 | 253 |
| 288 | 3300028381 | Ga0268264_10681849 | Ga0268264_106818491 | 253 |
| 289 | 3300031238 | Ga0265332_10000508 | Ga0265332_100005085 | 253 |
| 290 | 3300031247 | Ga0265340_10009467 | Ga0265340_100094672 | 253 |
| 291 | 3300031249 | Ga0265339_10013810 | Ga0265339_100138104 | 253 |
| 292 | 3300031250 | Ga0265331_10006826 | Ga0265331_100068264 | 253 |
| 293 | 3300031344 | Ga0265316_10029170 | Ga0265316_100291703 | 253 |
| 294 | 3300031548 | Ga0307408_100045235 | Ga0307408_1000452353 | 253 |
| 295 | 3300031712 | Ga0265342_10000573 | Ga0265342_1000057310 | 253 |
| 296 | 3300032005 | Ga0307411_10057047 | Ga0307411_100570472 | 253 |
| 297 | 3300035089 | Ga0373944_0118880 | Ga0373944_0118880_32_796 | 253 |
| 298 | 3300035111 | Ga0373923_0035928 | Ga0373923_0035928_764_1531 | 253 |
| 299 | 3300035113 | Ga0373936_0009944 | Ga0373936_0009944_371_1138 | 253 |
| 300 | 3300035116 | Ga0373945_0059098 | Ga0373945_0059098_345_1109 | 253 |
| 301 | 3300035117 | Ga0373953_0075386 | Ga0373953_0075386_98_865 | 253 |
| 302 | 3300035119 | Ga0373956_0124269 | Ga0373956_0124269_32_799 | 253 |
| 303 | 3300035120 | Ga0373957_0011436 | Ga0373957_0011436_1464_2231 | 253 |
| 304 | 3300035170 | Ga0373943_0027098 | Ga0373943_0027098_1313_2077 | 253 |
| 305 | 3300035410 | Ga0373924_0048908 | Ga0373924_0048908_478_1245 | 253 |
| 306 | 3300035692 | Ga0373935_0214092 | Ga0373935_0214092_293_1075 | 253 |
| 307 | 3300035692 | Ga0373935_0503450 | Ga0373935_0503450_99_863 | 253 |
| 308 | 3300035695 | Ga0373927_0075067 | Ga0373927_0075067_178_954 | 253 |
| 309 | 3300035695 | Ga0373927_0075637 | Ga0373927_0075637_646_1410 | 253 |
| 310 | 3300036401 | Ga0373937_0192510 | Ga0373937_0192510_1087_1854 | 253 |
| 311 | 3300036401 | Ga0373937_0318456 | Ga0373937_0318456_674_1441 | 253 |
| 312 | 3300037068 | Ga0373925_0140813 | Ga0373925_0140813_91_855 | 253 |
| 313 | 3300037068 | Ga0373925_0303232 | Ga0373925_0303232_156_932 | 253 |
| 314 | 3300037853 | Ga0436364_0790279 | Ga0436364_0790279_1739_2512 | 253 |
| 315 | 3300039437 | Ga0436365_1301518 | Ga0436365_1301518_30429_31196 | 253 |
| 316 | 3300039438 | Ga0436360_1208531 | Ga0436360_1208531_12_788 | 253 |
| 317 | 3300039447 | Ga0436361_1143633 | Ga0436361_1143633_50_850 | 253 |
| 318 | 3300039450 | Ga0436363_0413557 | Ga0436363_0413557_725_1492 | 253 |
| 319 | 3300041411 | Ga0439466_0109720 | Ga0439466_0109720_50_814 | 253 |
| 320 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_637220_637981 | 253 |
| 321 | 3300046454 | Ga0495592_0157846 | Ga0495592_0157846_393_1160 | 253 |
| 322 | 3300046472 | Ga0495580_0083741 | Ga0495580_0083741_636_1400 | 253 |
| 323 | 3300046477 | Ga0495664_0001415 | Ga0495664_0001415_9300_10067 | 253 |
| 324 | 3300046499 | Ga0495594_0370127 | Ga0495594_0370127_24_791 | 253 |
| 325 | 3300046516 | Ga0495628_0020351 | Ga0495628_0020351_3700_4467 | 253 |
| 326 | 3300046529 | Ga0495652_0198891 | Ga0495652_0198891_548_1315 | 253 |
| 327 | 3300046536 | Ga0495587_0075114 | Ga0495587_0075114_857_1624 | 253 |
| 328 | 3300046543 | Ga0495645_0015122 | Ga0495645_0015122_37_804 | 253 |
| 329 | 3300046559 | Ga0495667_0138238 | Ga0495667_0138238_674_1441 | 253 |
| 330 | 3300046675 | Ga0495657_0034708 | Ga0495657_0034708_2278_3045 | 253 |
| 331 | 3300046678 | Ga0495599_0011772 | Ga0495599_0011772_2323_3090 | 253 |
| 332 | 3300046678 | Ga0495599_0274085 | Ga0495599_0274085_57_851 | 253 |
| 333 | 3300046679 | Ga0495623_0017188 | Ga0495623_0017188_3159_3926 | 253 |
| 334 | 3300046680 | Ga0495646_0016881 | Ga0495646_0016881_2005_2772 | 253 |
| 335 | 3300046683 | Ga0495658_0296235 | Ga0495658_0296235_120_896 | 253 |
| 336 | 3300046809 | Ga0495600_0159159 | Ga0495600_0159159_662_1429 | 253 |
| 337 | 3300047315 | Ga0495581_0125096 | Ga0495581_0125096_582_1358 | 253 |
| 338 | 3300047317 | Ga0495604_0022414 | Ga0495604_0022414_323_1090 | 253 |
| 339 | 3300047319 | Ga0495674_0039910 | Ga0495674_0039910_2678_3445 | 253 |
| 340 | 3300047322 | Ga0495680_0284162 | Ga0495680_0284162_190_957 | 253 |
| 341 | 3300047444 | Ga0495675_0015943 | Ga0495675_0015943_1901_2668 | 253 |
| 342 | 3300047472 | Ga0495686_0029987 | Ga0495686_0029987_277_1050 | 253 |
| 343 | 3300048088 | Ga0495602_0000513 | Ga0495602_0000513_34633_35400 | 253 |
| 344 | 3300048088 | Ga0495602_0155083 | Ga0495602_0155083_425_1192 | 253 |
| 345 | 3300048903 | Ga0496100_0309889 | Ga0496100_0309889_148_924 | 253 |
| 346 | 3300048905 | Ga0496102_0101841 | Ga0496102_0101841_118_894 | 253 |
| 347 | 3300048907 | Ga0496104_0027620 | Ga0496104_0027620_4251_5027 | 253 |
| 348 | 3300048908 | Ga0496105_0002518 | Ga0496105_0002518_10792_11568 | 253 |
| 349 | 3300048911 | Ga0496108_0000416 | Ga0496108_0000416_15414_16190 | 253 |
| 350 | 3300048912 | Ga0496109_0001317 | Ga0496109_0001317_8829_9605 | 253 |
| 351 | 3300048913 | Ga0496110_0060328 | Ga0496110_0060328_431_1207 | 253 |
| 352 | 3300048913 | Ga0496110_0218292 | Ga0496110_0218292_428_1204 | 253 |
| 353 | 3300048913 | Ga0496110_0482089 | Ga0496110_0482089_133_897 | 253 |
| 354 | 3300048914 | Ga0496111_0003408 | Ga0496111_0003408_4233_5009 | 253 |
| 355 | 3300048915 | Ga0496112_0010780 | Ga0496112_0010780_3584_4360 | 253 |
| 356 | 3300048915 | Ga0496112_0041717 | Ga0496112_0041717_1730_2494 | 253 |
| 357 | 3300048915 | Ga0496112_0310757 | Ga0496112_0310757_407_1183 | 253 |
| 358 | 3300048916 | Ga0496113_0004716 | Ga0496113_0004716_523_1299 | 253 |
| 359 | 3300048916 | Ga0496113_0024469 | Ga0496113_0024469_2188_2952 | 253 |
| 360 | 3300048917 | Ga0496114_0198863 | Ga0496114_0198863_960_1736 | 253 |
| 361 | 3300048918 | Ga0496115_0038610 | Ga0496115_0038610_877_1653 | 253 |
| 362 | 3300049568 | Ga0501031_0347154 | Ga0501031_0347154_172_936 | 253 |
| 363 | 3300049823 | Ga0501044_0214379 | Ga0501044_0214379_163_954 | 253 |
| 364 | 3300050493 | nmdc:mga0k408_54687_c1 | nmdc:mga0k408_54687_c1_163_927 | 253 |
| 365 | 3300050512 | nmdc:mga0n895_534258_c1 | nmdc:mga0n895_534258_c1_319_1083 | 253 |
| 366 | 3300050513 | nmdc:mga0rr50_72354_c1 | nmdc:mga0rr50_72354_c1_386_1150 | 253 |
| 367 | 3300050514 | nmdc:mga08x19_30359_c1 | nmdc:mga08x19_30359_c1_701_1465 | 253 |
| 368 | 3300053077 | Ga0495601_0208886 | Ga0495601_0208886_328_1122 | 253 |
| 369 | 3300053078 | Ga0495612_0000204 | Ga0495612_0000204_23371_24138 | 253 |
| 370 | 3300053084 | Ga0495595_0180951 | Ga0495595_0180951_89_883 | 253 |
| 371 | 3300053085 | Ga0495619_0074730 | Ga0495619_0074730_1309_2103 | 253 |
| 372 | 3300053085 | Ga0495619_0249565 | Ga0495619_0249565_56_841 | 253 |
| 373 | iso_pu_bacteria | 2883354860 | 2883359896 | 253 |
| 374 | iso_pu_bacteria | 2894232714 | 2894237373 | 253 |
| 375 | 3300005329 | Ga0070683_100139107 | Ga0070683_1001391073 | 254 |
| 376 | 3300005336 | Ga0070680_100048084 | Ga0070680_1000480842 | 254 |
| 377 | 3300005336 | Ga0070680_100339324 | Ga0070680_1003393242 | 254 |
| 378 | 3300005338 | Ga0068868_100302908 | Ga0068868_1003029082 | 254 |
| 379 | 3300005354 | Ga0070675_100640950 | Ga0070675_1006409501 | 254 |
| 380 | 3300005356 | Ga0070674_100415668 | Ga0070674_1004156681 | 254 |
| 381 | 3300005366 | Ga0070659_100140947 | Ga0070659_1001409472 | 254 |
| 382 | 3300005436 | Ga0070713_100417991 | Ga0070713_1004179912 | 254 |
| 383 | 3300005456 | Ga0070678_100045225 | Ga0070678_1000452253 | 254 |
| 384 | 3300005458 | Ga0070681_10000290 | Ga0070681_1000029026 | 254 |
| 385 | 3300005458 | Ga0070681_10119067 | Ga0070681_101190673 | 254 |
| 386 | 3300005458 | Ga0070681_10343277 | Ga0070681_103432772 | 254 |
| 387 | 3300005530 | Ga0070679_100000949 | Ga0070679_10000094921 | 254 |
| 388 | 3300005535 | Ga0070684_100139060 | Ga0070684_1001390602 | 254 |
| 389 | 3300005536 | Ga0070697_100395805 | Ga0070697_1003958051 | 254 |
| 390 | 3300005548 | Ga0070665_100064747 | Ga0070665_1000647472 | 254 |
| 391 | 3300005577 | Ga0068857_100209552 | Ga0068857_1002095522 | 254 |
| 392 | 3300005614 | Ga0068856_100074699 | Ga0068856_1000746993 | 254 |
| 393 | 3300005617 | Ga0068859_100640636 | Ga0068859_1006406361 | 254 |
| 394 | 3300005843 | Ga0068860_100440442 | Ga0068860_1004404422 | 254 |
| 395 | 3300005981 | Ga0081538_10010446 | Ga0081538_100104462 | 254 |
| 396 | 3300005985 | Ga0081539_10007126 | Ga0081539_100071265 | 254 |
| 397 | 3300006175 | Ga0070712_100272217 | Ga0070712_1002722172 | 254 |
| 398 | 3300006871 | Ga0075434_100219561 | Ga0075434_1002195611 | 254 |
| 399 | 3300006931 | Ga0097620_100640558 | Ga0097620_1006405581 | 254 |
| 400 | 3300009093 | Ga0105240_10140015 | Ga0105240_101400153 | 254 |
| 401 | 3300009553 | Ga0105249_10877629 | Ga0105249_108776292 | 254 |
| 402 | 3300013104 | Ga0157370_10002708 | Ga0157370_1000270817 | 254 |
| 403 | 3300013105 | Ga0157369_10031164 | Ga0157369_100311644 | 254 |
| 404 | 3300021388 | Ga0213875_10002605 | Ga0213875_100026052 | 254 |
| 405 | 3300021388 | Ga0213875_10003096 | Ga0213875_100030965 | 254 |
| 406 | 3300021388 | Ga0213875_10080605 | Ga0213875_100806052 | 254 |
| 407 | 3300025912 | Ga0207707_10005682 | Ga0207707_1000568212 | 254 |
| 408 | 3300025913 | Ga0207695_10029022 | Ga0207695_100290226 | 254 |
| 409 | 3300025915 | Ga0207693_10260295 | Ga0207693_102602952 | 254 |
| 410 | 3300025915 | Ga0207693_10288956 | Ga0207693_102889562 | 254 |
| 411 | 3300025917 | Ga0207660_10201020 | Ga0207660_102010202 | 254 |
| 412 | 3300025917 | Ga0207660_10357529 | Ga0207660_103575291 | 254 |
| 413 | 3300025921 | Ga0207652_10010915 | Ga0207652_100109157 | 254 |
| 414 | 3300025929 | Ga0207664_10437747 | Ga0207664_104377472 | 254 |
| 415 | 3300025931 | Ga0207644_10056066 | Ga0207644_100560662 | 254 |
| 416 | 3300025932 | Ga0207690_10104307 | Ga0207690_101043071 | 254 |
| 417 | 3300025944 | Ga0207661_10303870 | Ga0207661_103038702 | 254 |
| 418 | 3300025960 | Ga0207651_10360294 | Ga0207651_103602941 | 254 |
| 419 | 3300026116 | Ga0207674_10208602 | Ga0207674_102086022 | 254 |
| 420 | 3300026121 | Ga0207683_10045974 | Ga0207683_100459743 | 254 |
| 421 | 3300028379 | Ga0268266_10003807 | Ga0268266_1000380712 | 254 |
| 422 | 3300028379 | Ga0268266_10162519 | Ga0268266_101625192 | 254 |
| 423 | 3300028381 | Ga0268264_10156289 | Ga0268264_101562892 | 254 |
| 424 | 3300031548 | Ga0307408_100029367 | Ga0307408_1000293673 | 254 |
| 425 | 3300031649 | Ga0307514_10005043 | Ga0307514_100050438 | 254 |
| 426 | 3300031901 | Ga0307406_10467875 | Ga0307406_104678751 | 254 |
| 427 | 3300035083 | Ga0373926_0095548 | Ga0373926_0095548_218_988 | 254 |
| 428 | 3300035111 | Ga0373923_0162325 | Ga0373923_0162325_113_898 | 254 |
| 429 | 3300035172 | Ga0373955_0097961 | Ga0373955_0097961_124_906 | 254 |
| 430 | 3300035691 | Ga0373931_0057234 | Ga0373931_0057234_301_1095 | 254 |
| 431 | 3300035692 | Ga0373935_0275705 | Ga0373935_0275705_363_1157 | 254 |
| 432 | 3300035724 | Ga0373933_0142157 | Ga0373933_0142157_670_1464 | 254 |
| 433 | 3300035724 | Ga0373933_0259471 | Ga0373933_0259471_89_859 | 254 |
| 434 | 3300035725 | Ga0373947_0019078 | Ga0373947_0019078_2806_3576 | 254 |
| 435 | 3300035725 | Ga0373947_0024667 | Ga0373947_0024667_1163_1945 | 254 |
| 436 | 3300036401 | Ga0373937_0010551 | Ga0373937_0010551_5721_6503 | 254 |
| 437 | 3300036401 | Ga0373937_0091941 | Ga0373937_0091941_491_1261 | 254 |
| 438 | 3300036401 | Ga0373937_0319624 | Ga0373937_0319624_441_1211 | 254 |
| 439 | 3300037068 | Ga0373925_0005920 | Ga0373925_0005920_6329_7099 | 254 |
| 440 | 3300037068 | Ga0373925_0418983 | Ga0373925_0418983_134_910 | 254 |
| 441 | 3300037312 | Ga0395899_0014326 | Ga0395899_0014326_4701_5501 | 254 |
| 442 | 3300037418 | Ga0395900_0150390 | Ga0395900_0150390_552_1352 | 254 |
| 443 | 3300037466 | Ga0395898_0066631 | Ga0395898_0066631_2115_2915 | 254 |
| 444 | 3300037853 | Ga0436364_0128168 | Ga0436364_0128168_22188_22982 | 254 |
| 445 | 3300037853 | Ga0436364_0146609 | Ga0436364_0146609_10479_11246 | 254 |
| 446 | 3300037853 | Ga0436364_0320085 | Ga0436364_0320085_316_1086 | 254 |
| 447 | 3300037853 | Ga0436364_1027283 | Ga0436364_1027283_6839_7609 | 254 |
| 448 | 3300038742 | Ga0400486_16095 | Ga0400486_16095_539_1306 | 254 |
| 449 | 3300039437 | Ga0436365_1738174 | Ga0436365_1738174_416_1186 | 254 |
| 450 | 3300039438 | Ga0436360_0788354 | Ga0436360_0788354_889_1656 | 254 |
| 451 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_613956_614723 | 254 |
| 452 | 3300045051 | Ga0451576_0003329 | Ga0451576_0003329_19280_20053 | 254 |
| 453 | 3300045051 | Ga0451576_0076846 | Ga0451576_0076846_2596_3411 | 254 |
| 454 | 3300045051 | Ga0451576_0951006 | Ga0451576_0951006_49_831 | 254 |
| 455 | 3300045976 | Ga0466967_0293717 | Ga0466967_0293717_666_1451 | 254 |
| 456 | 3300046454 | Ga0495592_0003819 | Ga0495592_0003819_1831_2613 | 254 |
| 457 | 3300046459 | Ga0495629_0263377 | Ga0495629_0263377_97_882 | 254 |
| 458 | 3300046462 | Ga0495651_0007570 | Ga0495651_0007570_1566_2348 | 254 |
| 459 | 3300046477 | Ga0495664_0284276 | Ga0495664_0284276_117_899 | 254 |
| 460 | 3300046514 | Ga0495618_0200070 | Ga0495618_0200070_196_981 | 254 |
| 461 | 3300046516 | Ga0495628_0026845 | Ga0495628_0026845_2124_2906 | 254 |
| 462 | 3300046529 | Ga0495652_0391349 | Ga0495652_0391349_164_946 | 254 |
| 463 | 3300046533 | Ga0495640_0222119 | Ga0495640_0222119_330_1100 | 254 |
| 464 | 3300046559 | Ga0495667_0017708 | Ga0495667_0017708_1299_2084 | 254 |
| 465 | 3300046663 | Ga0495635_0350442 | Ga0495635_0350442_157_927 | 254 |
| 466 | 3300046680 | Ga0495646_0112019 | Ga0495646_0112019_363_1148 | 254 |
| 467 | 3300046683 | Ga0495658_0340298 | Ga0495658_0340298_139_909 | 254 |
| 468 | 3300046689 | Ga0495613_0221248 | Ga0495613_0221248_321_1103 | 254 |
| 469 | 3300046690 | Ga0495624_0266938 | Ga0495624_0266938_206_976 | 254 |
| 470 | 3300047319 | Ga0495674_0317601 | Ga0495674_0317601_170_952 | 254 |
| 471 | 3300047322 | Ga0495680_0032781 | Ga0495680_0032781_569_1351 | 254 |
| 472 | 3300047322 | Ga0495680_0080994 | Ga0495680_0080994_872_1657 | 254 |
| 473 | 3300047471 | Ga0495684_0101097 | Ga0495684_0101097_729_1514 | 254 |
| 474 | 3300047471 | Ga0495684_0151713 | Ga0495684_0151713_649_1419 | 254 |
| 475 | 3300048907 | Ga0496104_0062211 | Ga0496104_0062211_2086_2916 | 254 |
| 476 | 3300048913 | Ga0496110_0185844 | Ga0496110_0185844_258_1088 | 254 |
| 477 | 3300048917 | Ga0496114_0206925 | Ga0496114_0206925_768_1598 | 254 |
| 478 | 3300048918 | Ga0496115_0024070 | Ga0496115_0024070_142_972 | 254 |
| 479 | 3300048922 | Ga0496119_0077132 | Ga0496119_0077132_973_1743 | 254 |
| 480 | 3300048923 | Ga0496120_0074565 | Ga0496120_0074565_459_1229 | 254 |
| 481 | 3300049571 | Ga0501034_0002934 | Ga0501034_0002934_8467_9240 | 254 |
| 482 | 3300049571 | Ga0501034_0013853 | Ga0501034_0013853_4392_5192 | 254 |
| 483 | 3300049586 | Ga0501070_0160071 | Ga0501070_0160071_896_1681 | 254 |
| 484 | 3300050514 | nmdc:mga08x19_67475_c1 | nmdc:mga08x19_67475_c1_1283_2068 | 254 |
| 485 | iso_pu_bacteria | 2899803654 | 2899804435 | 254 |
| 486 | 3300005844 | Ga0068862_100014189 | Ga0068862_1000141899 | 255 |
| 487 | 3300005937 | Ga0081455_10003778 | Ga0081455_1000377814 | 255 |
| 488 | 3300005985 | Ga0081539_10000072 | Ga0081539_1000007262 | 255 |
| 489 | 3300009098 | Ga0105245_10234921 | Ga0105245_102349212 | 255 |
| 490 | 3300009177 | Ga0105248_10133028 | Ga0105248_101330282 | 255 |
| 491 | 3300010375 | Ga0105239_10026796 | Ga0105239_100267963 | 255 |
| 492 | 3300013104 | Ga0157370_10016281 | Ga0157370_100162812 | 255 |
| 493 | 3300014325 | Ga0163163_10045518 | Ga0163163_100455184 | 255 |
| 494 | 3300014325 | Ga0163163_10333408 | Ga0163163_103334082 | 255 |
| 495 | 3300014326 | Ga0157380_10213444 | Ga0157380_102134442 | 255 |
| 496 | 3300021384 | Ga0213876_10063700 | Ga0213876_100637002 | 255 |
| 497 | 3300021388 | Ga0213875_10006915 | Ga0213875_100069153 | 255 |
| 498 | 3300021388 | Ga0213875_10045609 | Ga0213875_100456092 | 255 |
| 499 | 3300025302 | Ga0207426_1012877 | Ga0207426_10128772 | 255 |
| 500 | 3300025923 | Ga0207681_10026942 | Ga0207681_100269422 | 255 |
| 501 | 3300025923 | Ga0207681_10253209 | Ga0207681_102532092 | 255 |
| 502 | 3300025929 | Ga0207664_10309010 | Ga0207664_103090102 | 255 |
| 503 | 3300025944 | Ga0207661_10336739 | Ga0207661_103367392 | 255 |
| 504 | 3300026118 | Ga0207675_100008717 | Ga0207675_1000087175 | 255 |
| 505 | 3300027866 | Ga0209813_10048756 | Ga0209813_100487562 | 255 |
| 506 | 3300027907 | Ga0207428_10000651 | Ga0207428_1000065114 | 255 |
| 507 | 3300028380 | Ga0268265_10095407 | Ga0268265_100954072 | 255 |
| 508 | 3300037853 | Ga0436364_0559442 | Ga0436364_0559442_3962_4738 | 255 |
| 509 | 3300037853 | Ga0436364_0961939 | Ga0436364_0961939_3020_3814 | 255 |
| 510 | 3300039437 | Ga0436365_0612905 | Ga0436365_0612905_1566_2339 | 255 |
| 511 | 3300039438 | Ga0436360_0233885 | Ga0436360_0233885_921_1688 | 255 |
| 512 | 3300039447 | Ga0436361_0727677 | Ga0436361_0727677_221_1000 | 255 |
| 513 | 3300046462 | Ga0495651_0118058 | Ga0495651_0118058_772_1668 | 255 |
| 514 | 3300048088 | Ga0495602_0152495 | Ga0495602_0152495_485_1381 | 255 |
| 515 | 3300048905 | Ga0496102_0482055 | Ga0496102_0482055_343_1131 | 255 |
| 516 | 3300048923 | Ga0496120_0153876 | Ga0496120_0153876_28_807 | 255 |
| 517 | 3300049572 | Ga0501036_0038467 | Ga0501036_0038467_3156_3926 | 255 |
| 518 | 3300049574 | Ga0501038_0459049 | Ga0501038_0459049_195_965 | 255 |
| 519 | 3300049575 | Ga0501039_0012377 | Ga0501039_0012377_4657_5427 | 255 |
| 520 | 3300049575 | Ga0501039_0430032 | Ga0501039_0430032_125_916 | 255 |
| 521 | 3300049576 | Ga0501040_0006992 | Ga0501040_0006992_1519_2289 | 255 |
| 522 | 3300049576 | Ga0501040_0217472 | Ga0501040_0217472_126_896 | 255 |
| 523 | 3300049577 | Ga0501041_0004937 | Ga0501041_0004937_5159_5929 | 255 |
| 524 | 3300049578 | Ga0501042_0002531 | Ga0501042_0002531_5992_6762 | 255 |
| 525 | 3300049579 | Ga0501043_0007635 | Ga0501043_0007635_4997_5767 | 255 |
| 526 | 3300049580 | Ga0501046_0044343 | Ga0501046_0044343_451_1221 | 255 |
| 527 | 3300049582 | Ga0501048_0000809 | Ga0501048_0000809_1910_2680 | 255 |
| 528 | 3300049584 | Ga0501068_0066663 | Ga0501068_0066663_866_1636 | 255 |
| 529 | 3300049584 | Ga0501068_0096669 | Ga0501068_0096669_902_1672 | 255 |
| 530 | 3300049586 | Ga0501070_0213540 | Ga0501070_0213540_345_1115 | 255 |
| 531 | 3300049587 | Ga0501071_0016801 | Ga0501071_0016801_2680_3450 | 255 |
| 532 | 3300049587 | Ga0501071_0448272 | Ga0501071_0448272_49_828 | 255 |
| 533 | 3300049588 | Ga0501072_0000611 | Ga0501072_0000611_4808_5578 | 255 |
| 534 | 3300049588 | Ga0501072_0368861 | Ga0501072_0368861_53_823 | 255 |
| 535 | 3300049588 | Ga0501072_0385704 | Ga0501072_0385704_209_1003 | 255 |
| 536 | 3300049589 | Ga0501073_0190818 | Ga0501073_0190818_457_1227 | 255 |
| 537 | 3300049590 | Ga0501074_0053055 | Ga0501074_0053055_724_1494 | 255 |
| 538 | 3300049591 | Ga0501075_0005902 | Ga0501075_0005902_5605_6375 | 255 |
| 539 | 3300049592 | Ga0501076_0007284 | Ga0501076_0007284_3592_4362 | 255 |
| 540 | 3300049592 | Ga0501076_0517451 | Ga0501076_0517451_103_897 | 255 |
| 541 | 3300049593 | Ga0501077_0012097 | Ga0501077_0012097_3120_3890 | 255 |
| 542 | 3300049593 | Ga0501077_0021059 | Ga0501077_0021059_1851_2621 | 255 |
| 543 | 3300049741 | Ga0501079_0014911 | Ga0501079_0014911_2855_3625 | 255 |
| 544 | 3300049742 | Ga0501080_0232174 | Ga0501080_0232174_449_1219 | 255 |
| 545 | 3300049822 | Ga0501035_0082586 | Ga0501035_0082586_1668_2438 | 255 |
| 546 | 3300050511 | nmdc:mga08y16_42_c1 | nmdc:mga08y16_42_c1_97434_98204 | 255 |
| 547 | 3300059421 | Ga0590071_010402 | Ga0590071_010402_122_892 | 255 |
| 548 | 3300060353 | Ga0501082_0044501 | Ga0501082_0044501_1823_2596 | 255 |
| 549 | 3300061734 | Ga0530510_0011857 | Ga0530510_0011857_5121_5891 | 255 |
| 550 | 3300061734 | Ga0530510_0236115 | Ga0530510_0236115_539_1309 | 255 |
| 551 | 3300005444 | Ga0070694_100429723 | Ga0070694_1004297232 | 256 |
| 552 | 3300005459 | Ga0068867_100134777 | Ga0068867_1001347773 | 256 |
| 553 | 3300005545 | Ga0070695_100108497 | Ga0070695_1001084971 | 256 |
| 554 | 3300005546 | Ga0070696_100113534 | Ga0070696_1001135342 | 256 |
| 555 | 3300006844 | Ga0075428_100512541 | Ga0075428_1005125411 | 256 |
| 556 | 3300009098 | Ga0105245_10636795 | Ga0105245_106367951 | 256 |
| 557 | 3300009148 | Ga0105243_10029034 | Ga0105243_100290343 | 256 |
| 558 | 3300009545 | Ga0105237_10052414 | Ga0105237_100524144 | 256 |
| 559 | 3300025914 | Ga0207671_10044036 | Ga0207671_100440364 | 256 |
| 560 | 3300031616 | Ga0307508_10030386 | Ga0307508_100303864 | 256 |
| 561 | 3300031995 | Ga0307409_100319803 | Ga0307409_1003198031 | 256 |
| 562 | 3300032002 | Ga0307416_100805156 | Ga0307416_1008051561 | 256 |
| 563 | 3300032004 | Ga0307414_10092133 | Ga0307414_100921333 | 256 |
| 564 | 3300032126 | Ga0307415_100032315 | Ga0307415_1000323153 | 256 |
| 565 | 3300033180 | Ga0307510_10059307 | Ga0307510_100593072 | 256 |
| 566 | 3300037471 | Ga0395905_0092306 | Ga0395905_0092306_1977_2762 | 256 |
| 567 | 3300039438 | Ga0436360_0365560 | Ga0436360_0365560_433_1221 | 256 |
| 568 | 3300039453 | Ga0436362_0304993 | Ga0436362_0304993_140_925 | 256 |
| 569 | 3300042876 | Ga0451577_0225515 | Ga0451577_0225515_671_1462 | 256 |
| 570 | 3300049570 | Ga0501033_0029643 | Ga0501033_0029643_1856_2629 | 256 |
| 571 | 3300049573 | Ga0501037_0040606 | Ga0501037_0040606_2413_3186 | 256 |
| 572 | 3300049578 | Ga0501042_0455203 | Ga0501042_0455203_114_905 | 256 |
| 573 | 3300049822 | Ga0501035_0582887 | Ga0501035_0582887_26_799 | 256 |
| 574 | 3300049823 | Ga0501044_0078020 | Ga0501044_0078020_2177_2977 | 256 |
| 575 | 3300049824 | Ga0501045_0440284 | Ga0501045_0440284_90_884 | 256 |
| 576 | 3300060353 | Ga0501082_0568704 | Ga0501082_0568704_108_899 | 256 |
| 577 | iso_pu_bacteria | 2508501050 | 2508727247 | 256 |
| 578 | iso_pu_bacteria | 2508501114 | 2509077705 | 256 |
| 579 | iso_pu_bacteria | 2773857925 | 2774872370 | 256 |
| 580 | iso_pu_bacteria | 2775506901 | 2776261879 | 256 |
| 581 | iso_pu_bacteria | 2835312727 | 2835313908 | 256 |
| 582 | iso_pu_bacteria | 2882456835 | 2882457077 | 256 |
| 583 | 3300005327 | Ga0070658_10308596 | Ga0070658_103085962 | 257 |
| 584 | 3300005336 | Ga0070680_100195337 | Ga0070680_1001953373 | 257 |
| 585 | 3300005356 | Ga0070674_100108898 | Ga0070674_1001088982 | 257 |
| 586 | 3300006844 | Ga0075428_100410051 | Ga0075428_1004100512 | 257 |
| 587 | 3300009093 | Ga0105240_10308317 | Ga0105240_103083172 | 257 |
| 588 | 3300009545 | Ga0105237_10142718 | Ga0105237_101427182 | 257 |
| 589 | 3300025909 | Ga0207705_10307919 | Ga0207705_103079192 | 257 |
| 590 | 3300031247 | Ga0265340_10011425 | Ga0265340_100114254 | 257 |
| 591 | 3300031344 | Ga0265316_10095422 | Ga0265316_100954222 | 257 |
| 592 | 3300031595 | Ga0265313_10011988 | Ga0265313_100119885 | 257 |
| 593 | 3300031911 | Ga0307412_10336332 | Ga0307412_103363321 | 257 |
| 594 | 3300035692 | Ga0373935_0443529 | Ga0373935_0443529_107_907 | 257 |
| 595 | 3300037068 | Ga0373925_0199315 | Ga0373925_0199315_527_1309 | 257 |
| 596 | 3300037853 | Ga0436364_0645563 | Ga0436364_0645563_163_948 | 257 |
| 597 | 3300039438 | Ga0436360_0354685 | Ga0436360_0354685_4420_5205 | 257 |
| 598 | 3300039447 | Ga0436361_0124664 | Ga0436361_0124664_128_913 | 257 |
| 599 | 3300039450 | Ga0436363_0423875 | Ga0436363_0423875_2441_3226 | 257 |
| 600 | 3300039450 | Ga0436363_0934104 | Ga0436363_0934104_382_1167 | 257 |
| 601 | 3300039453 | Ga0436362_0439386 | Ga0436362_0439386_35_820 | 257 |
| 602 | 3300044656 | Ga0466969_0144838 | Ga0466969_0144838_148_933 | 257 |
| 603 | 3300044693 | Ga0466961_0088171 | Ga0466961_0088171_139_924 | 257 |
| 604 | 3300045049 | Ga0466959_0055041 | Ga0466959_0055041_1456_2241 | 257 |
| 605 | 3300048914 | Ga0496111_0040603 | Ga0496111_0040603_372_1172 | 257 |
| 606 | 3300049568 | Ga0501031_0024159 | Ga0501031_0024159_2578_3351 | 257 |
| 607 | 3300049569 | Ga0501032_0000546 | Ga0501032_0000546_5093_5866 | 257 |
| 608 | 3300049570 | Ga0501033_0000076 | Ga0501033_0000076_86055_86828 | 257 |
| 609 | 3300049571 | Ga0501034_0001507 | Ga0501034_0001507_24664_25437 | 257 |
| 610 | 3300049572 | Ga0501036_0001029 | Ga0501036_0001029_15189_15962 | 257 |
| 611 | 3300049572 | Ga0501036_0018683 | Ga0501036_0018683_3017_3805 | 257 |
| 612 | 3300049573 | Ga0501037_0000838 | Ga0501037_0000838_17130_17903 | 257 |
| 613 | 3300049574 | Ga0501038_0004571 | Ga0501038_0004571_5139_5912 | 257 |
| 614 | 3300049575 | Ga0501039_0002888 | Ga0501039_0002888_6966_7739 | 257 |
| 615 | 3300049575 | Ga0501039_0064179 | Ga0501039_0064179_2005_2793 | 257 |
| 616 | 3300049576 | Ga0501040_0031938 | Ga0501040_0031938_2312_3100 | 257 |
| 617 | 3300049577 | Ga0501041_0001547 | Ga0501041_0001547_36_824 | 257 |
| 618 | 3300049578 | Ga0501042_0007204 | Ga0501042_0007204_5528_6316 | 257 |
| 619 | 3300049579 | Ga0501043_0000043 | Ga0501043_0000043_90778_91551 | 257 |
| 620 | 3300049580 | Ga0501046_0012654 | Ga0501046_0012654_1005_1793 | 257 |
| 621 | 3300049581 | Ga0501047_0016124 | Ga0501047_0016124_1832_2686 | 257 |
| 622 | 3300049582 | Ga0501048_0030397 | Ga0501048_0030397_853_1641 | 257 |
| 623 | 3300049584 | Ga0501068_0028636 | Ga0501068_0028636_1007_1861 | 257 |
| 624 | 3300049586 | Ga0501070_0294990 | Ga0501070_0294990_414_1268 | 257 |
| 625 | 3300049588 | Ga0501072_0001322 | Ga0501072_0001322_5613_6401 | 257 |
| 626 | 3300049592 | Ga0501076_0002518 | Ga0501076_0002518_6398_7186 | 257 |
| 627 | 3300049741 | Ga0501079_0000593 | Ga0501079_0000593_9157_9945 | 257 |
| 628 | 3300049742 | Ga0501080_0056161 | Ga0501080_0056161_2838_3626 | 257 |
| 629 | 3300049743 | Ga0501081_0025160 | Ga0501081_0025160_2325_3113 | 257 |
| 630 | 3300049822 | Ga0501035_0000958 | Ga0501035_0000958_5093_5866 | 257 |
| 631 | 3300049823 | Ga0501044_0010596 | Ga0501044_0010596_4155_4928 | 257 |
| 632 | 3300049823 | Ga0501044_0062620 | Ga0501044_0062620_1586_2440 | 257 |
| 633 | 3300049824 | Ga0501045_0000080 | Ga0501045_0000080_14278_15066 | 257 |
| 634 | 3300050509 | nmdc:mga0qj67_41868_c1 | nmdc:mga0qj67_41868_c1_774_1562 | 257 |
| 635 | 3300054114 | Ga0501084_0008447 | Ga0501084_0008447_2190_2978 | 257 |
| 636 | 3300060353 | Ga0501082_0001982 | Ga0501082_0001982_15116_15904 | 257 |
| 637 | 3300061734 | Ga0530510_0006133 | Ga0530510_0006133_2301_3089 | 257 |
| 638 | iso_pu_bacteria | 2837678835 | 2837679533 | 257 |
| 639 | 3300021377 | Ga0213874_10068018 | Ga0213874_100680181 | 258 |
| 640 | 3300021384 | Ga0213876_10005904 | Ga0213876_100059043 | 258 |
| 641 | 3300021384 | Ga0213876_10017423 | Ga0213876_100174234 | 258 |
| 642 | 3300021384 | Ga0213876_10192721 | Ga0213876_101927211 | 258 |
| 643 | 3300031235 | Ga0265330_10025039 | Ga0265330_100250392 | 258 |
| 644 | 3300031241 | Ga0265325_10036069 | Ga0265325_100360692 | 258 |
| 645 | 3300037853 | Ga0436364_1243048 | Ga0436364_1243048_1040_1828 | 258 |
| 646 | 3300039437 | Ga0436365_0848884 | Ga0436365_0848884_1795_2595 | 258 |
| 647 | 3300039437 | Ga0436365_1034188 | Ga0436365_1034188_23882_24664 | 258 |
| 648 | 3300039447 | Ga0436361_0982947 | Ga0436361_0982947_20_823 | 258 |
| 649 | 3300039450 | Ga0436363_0134158 | Ga0436363_0134158_787_1659 | 258 |
| 650 | 3300039450 | Ga0436363_1600896 | Ga0436363_1600896_138_926 | 258 |
| 651 | 3300049571 | Ga0501034_0078128 | Ga0501034_0078128_1276_2079 | 258 |
| 652 | 3300049581 | Ga0501047_0058006 | Ga0501047_0058006_1235_2038 | 258 |
| 653 | 3300049823 | Ga0501044_0166694 | Ga0501044_0166694_728_1597 | 258 |
| 654 | 3300053139 | Ga0500568_0006856 | Ga0500568_0006856_3335_4117 | 258 |
| 655 | 3300005354 | Ga0070675_100312348 | Ga0070675_1003123482 | 259 |
| 656 | 3300005356 | Ga0070674_100375926 | Ga0070674_1003759261 | 259 |
| 657 | 3300005545 | Ga0070695_100187440 | Ga0070695_1001874401 | 259 |
| 658 | 3300005842 | Ga0068858_100069416 | Ga0068858_1000694163 | 259 |
| 659 | 3300006847 | Ga0075431_100122844 | Ga0075431_1001228442 | 259 |
| 660 | 3300009093 | Ga0105240_10463591 | Ga0105240_104635912 | 259 |
| 661 | 3300009148 | Ga0105243_10590104 | Ga0105243_105901041 | 259 |
| 662 | 3300013297 | Ga0157378_10233806 | Ga0157378_102338062 | 259 |
| 663 | 3300013308 | Ga0157375_10081147 | Ga0157375_100811474 | 259 |
| 664 | 3300014969 | Ga0157376_10090386 | Ga0157376_100903862 | 259 |
| 665 | 3300025901 | Ga0207688_10157615 | Ga0207688_101576151 | 259 |
| 666 | 3300025926 | Ga0207659_10384700 | Ga0207659_103847002 | 259 |
| 667 | 3300025933 | Ga0207706_10065284 | Ga0207706_100652844 | 259 |
| 668 | 3300025972 | Ga0207668_10151257 | Ga0207668_101512572 | 259 |
| 669 | 3300026035 | Ga0207703_10060350 | Ga0207703_100603503 | 259 |
| 670 | 3300026118 | Ga0207675_100404189 | Ga0207675_1004041891 | 259 |
| 671 | 3300039447 | Ga0436361_0205740 | Ga0436361_0205740_3202_4005 | 259 |
| 672 | 3300039447 | Ga0436361_0397425 | Ga0436361_0397425_68_886 | 259 |
| 673 | 3300039453 | Ga0436362_0015457 | Ga0436362_0015457_1143_1949 | 259 |
| 674 | 3300039453 | Ga0436362_0305268 | Ga0436362_0305268_1172_1990 | 259 |
| 675 | 3300048904 | Ga0496101_0016142 | Ga0496101_0016142_899_1690 | 259 |
| 676 | 3300048907 | Ga0496104_0006378 | Ga0496104_0006378_7839_8630 | 259 |
| 677 | 3300048908 | Ga0496105_0002986 | Ga0496105_0002986_9905_10696 | 259 |
| 678 | 3300048909 | Ga0496106_0191675 | Ga0496106_0191675_257_1048 | 259 |
| 679 | 3300048911 | Ga0496108_0073933 | Ga0496108_0073933_80_871 | 259 |
| 680 | 3300049587 | Ga0501071_0033969 | Ga0501071_0033969_674_1489 | 259 |
| 681 | 3300049591 | Ga0501075_0224390 | Ga0501075_0224390_513_1328 | 259 |
| 682 | 3300049824 | Ga0501045_0047109 | Ga0501045_0047109_2160_2975 | 259 |
| 683 | 3300050511 | nmdc:mga08y16_299903_c1 | nmdc:mga08y16_299903_c1_753_1544 | 259 |
| 684 | 3300060353 | Ga0501082_0096032 | Ga0501082_0096032_1585_2400 | 259 |
| 685 | 3300061734 | Ga0530510_0146643 | Ga0530510_0146643_840_1631 | 259 |
| 686 | iso_pu_bacteria | 2884298095 | 2884299179 | 259 |
| 687 | 3300003762 | Ga0055542_1017295 | Ga0055542_10172951 | 260 |
| 688 | 3300003763 | Ga0055529_1006290 | Ga0055529_10062902 | 260 |
| 689 | 3300025254 | Ga0209148_1000366 | Ga0209148_10003665 | 260 |
| 690 | 3300025272 | Ga0209455_1000738 | Ga0209455_100073820 | 260 |
| 691 | 3300049571 | Ga0501034_0196629 | Ga0501034_0196629_654_1490 | 260 |
| 692 | 3300053077 | Ga0495601_0007865 | Ga0495601_0007865_3284_4090 | 260 |
| 693 | 3300053078 | Ga0495612_0055227 | Ga0495612_0055227_206_1012 | 260 |
| 694 | 3300053085 | Ga0495619_0182362 | Ga0495619_0182362_100_906 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bkb-assembly1.cif.gz_B | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) | 0.824 | 11 | 253 |
| 5odq-assembly1.cif.gz_B | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. | 0.815 | 12 | 253 |
| 7bkb-assembly1.cif.gz_B | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) | 0.7718 | 11 | 253 |
| 5odq-assembly1.cif.gz_B | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. | 0.7608 | 12 | 253 |
| 5xr8-assembly1.cif.gz_A | crystal structure of the human cb1 in complex with agonist am841 | 0.6311 | 10 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77252_132_217_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9689 | 143 | 226 | 3.40.30.10 |
| af_P77252_3_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9441 | 14 | 92 | 3.40.30.10 |
| af_P77252_132_217_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9364 | 143 | 226 | 3.40.30.10 |
| af_P52074_302_386_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9265 | 143 | 227 | 3.40.30.10 |
| af_P52074_170_256_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9239 | 14 | 92 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T1HSQ9-F1-model_v4 | Fe-S oxidoreductase | 0.9974 | 24 | 258 |
GO:0005829
GO:0016491 |
| AF-A0A849MZJ2-F1-model_v4 | (Fe-S)-binding protein | 0.9967 | 10 | 259 |
GO:0005829
GO:0016491 |
| AF-A0A7W0XHE5-F1-model_v4 | (Fe-S)-binding protein | 0.9954 | 10 | 260 |
GO:0005829
GO:0016491 |
| AF-B6IVC3-F1-model_v4 | Cysteine-rich domain protein | 0.9948 | 9 | 258 |
GO:0005829
GO:0016491 |
| AF-J6J7J9-F1-model_v4 | Putative L-lactate dehydrogenase | 0.9936 | 10 | 258 |
GO:0005829
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar