F475732

General Info

Members Datasets Scaffolds Average Seq Length
694 335 668 257

Family's Representative Sequence

Representative Sequence 3300027866|Ga0209813_10048756|Ga0209813_100487562
Length 303
Sequence MFLAFLILLLGSVATLAPSGSGCDPADLRAKERPVSVRIASSLMAFPRVGFFATCLVDLFRPSVGFAAVKLLEDAGCEVEVPPQQTCCGQPGFNSGDRGDAKKIAKGVIATFDGFDYVVVPSGSCGGMIKTHYPELFEKGSPERAKADALAAKTFELVSFLADVLKVADVKASFPATATYHDSCSGLRELGVKEQPRRLLRSVSGLKLVELVDAEVCCGFGGTFCVKYPEISNTMLTKKVKRIAATGADTLIAGDLGCLMNMAGKLQRRGSRVAIRHVAEVLAGMTDDPAIGETRLTRARDGR

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
7 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
8 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
9 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
10 2773857925 Microvirga vignae BR3299 Isolate Unclassified
11 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
12 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
13 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
14 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
15 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
16 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
17 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
18 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
19 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
20 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
21 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
22 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
23 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
24 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
25 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
26 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
209 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0.14
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0.86
Rhizoplane 7.06
Rhizosphere 81.41
Stem 0
Stem Tuber 0.14
Unclassified 8.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1017295 3300003762 Bacteria 1118
2 Ga0055529_1006290 3300003763 Bacteria 1668
3 Ga0070658_10308596 3300005327 Bacteria 1350
4 Ga0070683_100139107 3300005329 Bacteria 2300
5 Ga0070690_100222285 3300005330 Bacteria 1324
6 Ga0070666_10253688 3300005335 Bacteria 1246
7 Ga0070680_100048084 3300005336 Bacteria 3476
8 Ga0070680_100195337 3300005336 Bacteria 1706
9 Ga0070680_100339324 3300005336 Bacteria 1277
10 Ga0070682_100269165 3300005337 Bacteria 1237
11 Ga0068868_100302908 3300005338 Bacteria 1358
12 Ga0070660_100483317 3300005339 Bacteria 1029
13 Ga0070668_100262522 3300005347 Bacteria 1436
14 Ga0070675_100312348 3300005354 Bacteria 1387
15 Ga0070675_100640950 3300005354 Bacteria 965
16 Ga0070671_100100947 3300005355 Bacteria 2421
17 Ga0070674_100108898 3300005356 Bacteria 2031
18 Ga0070674_100375926 3300005356 Bacteria 1154
19 Ga0070674_100415668 3300005356 Bacteria 1102
20 Ga0070659_100140947 3300005366 Bacteria 1963
21 Ga0070667_100206670 3300005367 Bacteria 1744
22 Ga0070709_10045824 3300005434 Bacteria 2716
23 Ga0070709_10062338 3300005434 Bacteria 2377
24 Ga0070714_100034276 3300005435 Bacteria 4251
25 Ga0070714_100182644 3300005435 Bacteria 1909
26 Ga0070714_100263261 3300005435 Bacteria 1597
27 Ga0070714_100336525 3300005435 Bacteria 1415
28 Ga0070714_100418143 3300005435 Bacteria 1270
29 Ga0070713_100066455 3300005436 Bacteria 3032
30 Ga0070713_100091015 3300005436 Bacteria 2623
31 Ga0070713_100194464 3300005436 Bacteria 1829
32 Ga0070713_100195418 3300005436 Bacteria 1825
33 Ga0070713_100372584 3300005436 Bacteria 1329
34 Ga0070713_100417991 3300005436 Bacteria 1255
35 Ga0070710_10034000 3300005437 Bacteria 2771
36 Ga0070710_10062224 3300005437 Bacteria 2128
37 Ga0070710_10206854 3300005437 Bacteria 1242
38 Ga0070711_100090963 3300005439 Bacteria 2199
39 Ga0070700_100132610 3300005441 Bacteria 1683
40 Ga0070694_100429723 3300005444 Bacteria 1039
41 Ga0070694_100461641 3300005444 Bacteria 1004
42 Ga0070678_100045225 3300005456 Bacteria 3148
43 Ga0070678_100070705 3300005456 Bacteria 2610
44 Ga0070681_10000030 3300005458 Bacteria 102898
45 Ga0070681_10000290 3300005458 Bacteria 40569
46 Ga0070681_10119067 3300005458 Bacteria 2577
47 Ga0070681_10343277 3300005458 Bacteria 1403
48 Ga0068867_100134777 3300005459 Bacteria 1923
49 Ga0070706_100239606 3300005467 Bacteria 1694
50 Ga0070706_100281022 3300005467 Bacteria 1553
51 Ga0070699_100112640 3300005518 Bacteria 2390
52 Ga0070699_100816213 3300005518 Bacteria 854
53 Ga0070679_100000949 3300005530 Bacteria 25179
54 Ga0070679_100004492 3300005530 Bacteria 12891
55 Ga0070684_100031254 3300005535 Bacteria 4531
56 Ga0070684_100139060 3300005535 Bacteria 2195
57 Ga0070697_100127841 3300005536 Bacteria 2129
58 Ga0070697_100395805 3300005536 Bacteria 1198
59 Ga0068853_100405427 3300005539 Bacteria 1277
60 Ga0070695_100108497 3300005545 Bacteria 1880
61 Ga0070695_100187440 3300005545 Bacteria 1470
62 Ga0070696_100113534 3300005546 Bacteria 1953
63 Ga0070696_100219832 3300005546 Bacteria 1425
64 Ga0070665_100017169 3300005548 Bacteria 7262
65 Ga0070665_100064747 3300005548 Bacteria 3666
66 Ga0068855_100000080 3300005563 Bacteria 115920
67 Ga0068855_100165826 3300005563 Bacteria 2504
68 Ga0068857_100209552 3300005577 Bacteria 1778
69 Ga0068856_100008810 3300005614 Bacteria 9819
70 Ga0068856_100074699 3300005614 Bacteria 3357
71 Ga0068856_100397712 3300005614 Bacteria 1398
72 Ga0068856_100543826 3300005614 Bacteria 1182
73 Ga0068852_100070479 3300005616 Bacteria 3067
74 Ga0068852_100098394 3300005616 Bacteria 2634
75 Ga0068859_100640636 3300005617 Bacteria 1155
76 Ga0068858_100069416 3300005842 Bacteria 3267
77 Ga0068860_100440442 3300005843 Bacteria 1294
78 Ga0068862_100014189 3300005844 Bacteria 6606
79 Ga0081455_10003778 3300005937 Bacteria 17289
80 Ga0081538_10010446 3300005981 Bacteria 7612
81 Ga0081539_10000072 3300005985 Bacteria 232726
82 Ga0081539_10007126 3300005985 Bacteria 10325
83 Ga0070717_10006757 3300006028 Bacteria 8464
84 Ga0070717_10025871 3300006028 Bacteria 4676
85 Ga0070717_10081853 3300006028 Bacteria 2711
86 Ga0070717_10119287 3300006028 Bacteria 2258
87 Ga0075368_10009923 3300006042 Bacteria 3434
88 Ga0070716_100142616 3300006173 Bacteria 1530
89 Ga0070716_100160836 3300006173 Bacteria 1455
90 Ga0070712_100009526 3300006175 Bacteria 6125
91 Ga0070712_100054421 3300006175 Bacteria 2798
92 Ga0070712_100272217 3300006175 Bacteria 1361
93 Ga0075367_10113627 3300006178 Bacteria 1664
94 Ga0075366_10152669 3300006195 Bacteria 1399
95 Ga0068871_100092675 3300006358 Bacteria 2520
96 Ga0075428_100410051 3300006844 Bacteria 1452
97 Ga0075428_100512541 3300006844 Bacteria 1283
98 Ga0075431_100122844 3300006847 Bacteria 2679
99 Ga0075434_100219561 3300006871 Bacteria 1921
100 Ga0075436_100018711 3300006914 Bacteria 4742
101 Ga0097620_100640558 3300006931 Bacteria 1155
102 Ga0105240_10000575 3300009093 Bacteria 68057
103 Ga0105240_10016714 3300009093 Bacteria 9924
104 Ga0105240_10140015 3300009093 Bacteria 2893
105 Ga0105240_10308317 3300009093 Bacteria 1808
106 Ga0105240_10463591 3300009093 Bacteria 1415
107 Ga0105245_10139496 3300009098 Bacteria 2281
108 Ga0105245_10234921 3300009098 Bacteria 1775
109 Ga0105245_10636795 3300009098 Bacteria 1095
110 Ga0105243_10029034 3300009148 Bacteria 4251
111 Ga0105243_10590104 3300009148 Bacteria 1068
112 Ga0105242_10087691 3300009176 Bacteria 2613
113 Ga0105242_10528125 3300009176 Bacteria 1127
114 Ga0105248_10000001 3300009177 Bacteria 1881304
115 Ga0105248_10051710 3300009177 Bacteria 4610
116 Ga0105248_10133028 3300009177 Bacteria 2806
117 Ga0105248_10140574 3300009177 Bacteria 2723
118 Ga0105237_10052414 3300009545 Bacteria 4096
119 Ga0105237_10142718 3300009545 Bacteria 2389
120 Ga0105238_10005915 3300009551 Bacteria 12122
121 Ga0105238_10065786 3300009551 Bacteria 3626
122 Ga0105238_10159756 3300009551 Bacteria 2229
123 Ga0105249_10005913 3300009553 Bacteria 10596
124 Ga0105249_10877629 3300009553 Bacteria 963
125 Ga0105239_10009459 3300010375 Bacteria 10982
126 Ga0105239_10026796 3300010375 Bacteria 6344
127 Ga0105239_10042034 3300010375 Bacteria 5008
128 Ga0105246_10364994 3300011119 Bacteria 1188
129 Ga0157370_10002708 3300013104 Bacteria 21192
130 Ga0157370_10016281 3300013104 Bacteria 7534
131 Ga0157369_10014185 3300013105 Bacteria 9003
132 Ga0157369_10031164 3300013105 Bacteria 5875
133 Ga0157369_10185899 3300013105 Bacteria 2185
134 Ga0157378_10217289 3300013297 Bacteria 1816
135 Ga0157378_10233806 3300013297 Bacteria 1753
136 Ga0163162_10693609 3300013306 Bacteria 1140
137 Ga0157372_10298327 3300013307 Bacteria 1874
138 Ga0157372_10505389 3300013307 Bacteria 1409
139 Ga0157375_10081147 3300013308 Bacteria 3283
140 Ga0157375_10107814 3300013308 Bacteria 2879
141 Ga0163163_10045518 3300014325 Bacteria 4307
142 Ga0163163_10333408 3300014325 Bacteria 1572
143 Ga0163163_10610693 3300014325 Bacteria 1154
144 Ga0157380_10213444 3300014326 Bacteria 1721
145 Ga0182008_10011974 3300014497 Bacteria 4594
146 Ga0157376_10090386 3300014969 Bacteria 2650
147 Ga0157376_10225925 3300014969 Bacteria 1736
148 Ga0163161_10009039 3300017792 Bacteria 6891
149 Ga0206353_11177956 3300020082 Bacteria 1054
150 Ga0213874_10068018 3300021377 Bacteria 1130
151 Ga0213876_10005904 3300021384 Bacteria 6693
152 Ga0213876_10017423 3300021384 Bacteria 3793
153 Ga0213876_10063700 3300021384 Bacteria 1947
154 Ga0213876_10105293 3300021384 Bacteria 1497
155 Ga0213876_10192721 3300021384 Bacteria 1084
156 Ga0213875_10001649 3300021388 Bacteria 14071
157 Ga0213875_10002605 3300021388 Bacteria 10707
158 Ga0213875_10003096 3300021388 Bacteria 9608
159 Ga0213875_10006915 3300021388 Bacteria 5908
160 Ga0213875_10045609 3300021388 Bacteria 2058
161 Ga0213875_10080605 3300021388 Bacteria 1519
162 Ga0209148_1000366 3300025254 Bacteria 55841
163 Ga0209455_1000738 3300025272 Bacteria 18739
164 Ga0209675_1000878 3300025291 Bacteria 19358
165 Ga0207426_1012877 3300025302 Bacteria 3123
166 Ga0207692_10145427 3300025898 Bacteria 1352
167 Ga0207688_10099313 3300025901 Bacteria 1679
168 Ga0207688_10157615 3300025901 Bacteria 1344
169 Ga0207699_10022975 3300025906 Bacteria 3388
170 Ga0207699_10061906 3300025906 Bacteria 2254
171 Ga0207699_10172630 3300025906 Bacteria 1447
172 Ga0207705_10307919 3300025909 Bacteria 1216
173 Ga0207707_10000001 3300025912 Bacteria 1212482
174 Ga0207707_10005682 3300025912 Bacteria 10914
175 Ga0207695_10000012 3300025913 Bacteria 840961
176 Ga0207695_10019677 3300025913 Bacteria 7763
177 Ga0207695_10029022 3300025913 Bacteria 6121
178 Ga0207671_10044036 3300025914 Bacteria 3300
179 Ga0207693_10004952 3300025915 Bacteria 11190
180 Ga0207693_10008584 3300025915 Bacteria 8364
181 Ga0207693_10011991 3300025915 Bacteria 7007
182 Ga0207693_10202544 3300025915 Bacteria 1561
183 Ga0207693_10260295 3300025915 Bacteria 1361
184 Ga0207693_10288956 3300025915 Bacteria 1285
185 Ga0207663_10083762 3300025916 Bacteria 2096
186 Ga0207663_10355244 3300025916 Bacteria 1110
187 Ga0207660_10000652 3300025917 Bacteria 23389
188 Ga0207660_10201020 3300025917 Bacteria 1556
189 Ga0207660_10357529 3300025917 Bacteria 1171
190 Ga0207652_10000311 3300025921 Bacteria 50145
191 Ga0207652_10010915 3300025921 Bacteria 7321
192 Ga0207646_10016802 3300025922 Bacteria 6862
193 Ga0207646_10104113 3300025922 Bacteria 2545
194 Ga0207681_10026942 3300025923 Bacteria 3712
195 Ga0207681_10253209 3300025923 Bacteria 1376
196 Ga0207694_10000055 3300025924 Bacteria 151308
197 Ga0207659_10384700 3300025926 Bacteria 1171
198 Ga0207687_10349928 3300025927 Bacteria 1203
199 Ga0207700_10019735 3300025928 Bacteria 4559
200 Ga0207700_10115044 3300025928 Bacteria 2171
201 Ga0207700_10152002 3300025928 Bacteria 1914
202 Ga0207700_10192416 3300025928 Bacteria 1715
203 Ga0207700_10477644 3300025928 Bacteria 1101
204 Ga0207664_10073519 3300025929 Bacteria 2758
205 Ga0207664_10104201 3300025929 Bacteria 2348
206 Ga0207664_10232992 3300025929 Bacteria 1601
207 Ga0207664_10309010 3300025929 Bacteria 1393
208 Ga0207664_10357858 3300025929 Bacteria 1293
209 Ga0207664_10437747 3300025929 Bacteria 1166
210 Ga0207644_10056066 3300025931 Bacteria 2843
211 Ga0207690_10104307 3300025932 Bacteria 2031
212 Ga0207706_10065284 3300025933 Bacteria 3205
213 Ga0207706_10194512 3300025933 Bacteria 1779
214 Ga0207686_10085407 3300025934 Bacteria 2070
215 Ga0207665_10029799 3300025939 Bacteria 3606
216 Ga0207665_10191350 3300025939 Bacteria 1487
217 Ga0207711_10000001 3300025941 Bacteria 1325674
218 Ga0207711_10094294 3300025941 Bacteria 2637
219 Ga0207689_10321350 3300025942 Bacteria 1284
220 Ga0207661_10303870 3300025944 Bacteria 1431
221 Ga0207661_10336739 3300025944 Bacteria 1359
222 Ga0207679_10111008 3300025945 Bacteria 2164
223 Ga0207679_10483186 3300025945 Bacteria 1103
224 Ga0207667_10000068 3300025949 Bacteria 180716
225 Ga0207651_10360294 3300025960 Bacteria 1227
226 Ga0207668_10151257 3300025972 Bacteria 1797
227 Ga0207668_10292161 3300025972 Bacteria 1341
228 Ga0207703_10060350 3300026035 Bacteria 3101
229 Ga0207703_10342326 3300026035 Bacteria 1375
230 Ga0207639_10057654 3300026041 Bacteria 2983
231 Ga0207702_10012415 3300026078 Bacteria 7092
232 Ga0207702_10040096 3300026078 Bacteria 3925
233 Ga0207702_10600565 3300026078 Bacteria 1080
234 Ga0207674_10128706 3300026116 Bacteria 2496
235 Ga0207674_10208602 3300026116 Bacteria 1903
236 Ga0207675_100008717 3300026118 Bacteria 9531
237 Ga0207675_100404189 3300026118 Bacteria 1346
238 Ga0207683_10041007 3300026121 Bacteria 4041
239 Ga0207683_10045974 3300026121 Bacteria 3818
240 Ga0207698_10033786 3300026142 Bacteria 3721
241 Ga0207698_10582974 3300026142 Bacteria 1100
242 Ga0209179_1026118 3300027512 Bacteria 1170
243 Ga0209813_10048756 3300027866 Bacteria 1316
244 Ga0207428_10000651 3300027907 Bacteria 40728
245 Ga0268266_10003807 3300028379 Bacteria 14755
246 Ga0268266_10151567 3300028379 Bacteria 2090
247 Ga0268266_10162519 3300028379 Bacteria 2021
248 Ga0268265_10095407 3300028380 Bacteria 2388
249 Ga0268264_10156289 3300028381 Bacteria 2050
250 Ga0268264_10681849 3300028381 Bacteria 1019
251 Ga0265330_10025039 3300031235 Bacteria 2706
252 Ga0265332_10000508 3300031238 Bacteria 26654
253 Ga0265328_10004683 3300031239 Bacteria 5915
254 Ga0265325_10036069 3300031241 Bacteria 2622
255 Ga0265340_10009467 3300031247 Bacteria 5227
256 Ga0265340_10011425 3300031247 Bacteria 4716
257 Ga0265339_10013810 3300031249 Bacteria 4887
258 Ga0265339_10016458 3300031249 Bacteria 4406
259 Ga0265339_10112626 3300031249 Bacteria 1406
260 Ga0265331_10006826 3300031250 Bacteria 6685
261 Ga0265316_10029170 3300031344 Bacteria 4541
262 Ga0265316_10052522 3300031344 Bacteria 3197
263 Ga0265316_10095422 3300031344 Bacteria 2265
264 Ga0307408_100029367 3300031548 Bacteria 3809
265 Ga0307408_100045235 3300031548 Bacteria 3143
266 Ga0265313_10011988 3300031595 Bacteria 5342
267 Ga0307508_10030386 3300031616 Bacteria 4883
268 Ga0307514_10005043 3300031649 Bacteria 11944
269 Ga0265314_10038245 3300031711 Bacteria 3469
270 Ga0265342_10000573 3300031712 Bacteria 38852
271 Ga0316576_10165397 3300031727 Bacteria 1669
272 Ga0316578_10062595 3300031728 Bacteria 2194
273 Ga0307406_10467875 3300031901 Bacteria 1015
274 Ga0307412_10336332 3300031911 Bacteria 1207
275 Ga0307409_100319803 3300031995 Bacteria 1452
276 Ga0307416_100805156 3300032002 Bacteria 1035
277 Ga0307414_10092133 3300032004 Bacteria 2255
278 Ga0307411_10057047 3300032005 Bacteria 2577
279 Ga0307415_100032315 3300032126 Bacteria 3383
280 Ga0307510_10059307 3300033180 Bacteria 3954
281 Ga0373926_0095548 3300035083 Bacteria 1108
282 Ga0373944_0118880 3300035089 Bacteria 909
283 Ga0373923_0035928 3300035111 Bacteria 2020
284 Ga0373923_0162325 3300035111 Bacteria 1020
285 Ga0373936_0009944 3300035113 Bacteria 3589
286 Ga0373936_0025050 3300035113 Bacteria 2331
287 Ga0373945_0002616 3300035116 Bacteria 5640
288 Ga0373945_0059098 3300035116 Bacteria 1427
289 Ga0373953_0000371 3300035117 Bacteria 12135
290 Ga0373953_0075386 3300035117 Bacteria 1396
291 Ga0373954_0007576 3300035118 Bacteria 4752
292 Ga0373956_0124269 3300035119 Bacteria 1206
293 Ga0373957_0011436 3300035120 Bacteria 2963
294 Ga0373943_0004245 3300035170 Bacteria 6499
295 Ga0373943_0027098 3300035170 Bacteria 2690
296 Ga0373946_0001712 3300035171 Bacteria 7649
297 Ga0373955_0000114 3300035172 Bacteria 32465
298 Ga0373955_0097961 3300035172 Bacteria 1680
299 Ga0373955_0339587 3300035172 Bacteria 909
300 Ga0373924_0000320 3300035410 Bacteria 14822
301 Ga0373924_0048908 3300035410 Bacteria 1748
302 Ga0373931_0057234 3300035691 Bacteria 2090
303 Ga0373935_0000395 3300035692 Bacteria 22565
304 Ga0373935_0214092 3300035692 Bacteria 1336
305 Ga0373935_0275705 3300035692 Bacteria 1183
306 Ga0373935_0443529 3300035692 Bacteria 937
307 Ga0373935_0503450 3300035692 Bacteria 879
308 Ga0373927_0003872 3300035695 Bacteria 10610
309 Ga0373927_0075067 3300035695 Bacteria 2189
310 Ga0373927_0075637 3300035695 Bacteria 2181
311 Ga0373933_0142157 3300035724 Bacteria 1516
312 Ga0373933_0259471 3300035724 Bacteria 1120
313 Ga0373947_0000980 3300035725 Bacteria 17423
314 Ga0373947_0019078 3300035725 Bacteria 3952
315 Ga0373947_0024667 3300035725 Bacteria 3505
316 Ga0373947_0104858 3300035725 Bacteria 1781
317 Ga0373937_0000079 3300036401 Bacteria 88626
318 Ga0373937_0010551 3300036401 Bacteria 8069
319 Ga0373937_0091941 3300036401 Bacteria 2812
320 Ga0373937_0192510 3300036401 Bacteria 1916
321 Ga0373937_0318456 3300036401 Bacteria 1471
322 Ga0373937_0319624 3300036401 Bacteria 1469
323 Ga0316582_0061052 3300036647 Unclassified 2418
324 Ga0316584_0053180 3300036712 Bacteria 3030
325 Ga0373925_0000064 3300037068 Bacteria 114743
326 Ga0373925_0005920 3300037068 Bacteria 9065
327 Ga0373925_0061537 3300037068 Bacteria 2820
328 Ga0373925_0140813 3300037068 Bacteria 1887
329 Ga0373925_0199315 3300037068 Bacteria 1591
330 Ga0373925_0303232 3300037068 Bacteria 1290
331 Ga0373925_0418983 3300037068 Bacteria 1094
332 Ga0395899_0014326 3300037312 Bacteria 6052
333 Ga0395900_0150390 3300037418 Bacteria 2378
334 Ga0395898_0066631 3300037466 Bacteria 3487
335 Ga0395905_0092306 3300037471 Bacteria 2839
336 Ga0436364_0128168 3300037853 Bacteria 71580
337 Ga0436364_0146609 3300037853 Bacteria 16108
338 Ga0436364_0157955 3300037853 Bacteria 52897
339 Ga0436364_0320085 3300037853 Bacteria 1556
340 Ga0436364_0559442 3300037853 Bacteria 5196
341 Ga0436364_0645563 3300037853 Bacteria 2289
342 Ga0436364_0729534 3300037853 Bacteria 5028
343 Ga0436364_0790279 3300037853 Bacteria 2933
344 Ga0436364_0961939 3300037853 Bacteria 5785
345 Ga0436364_1027283 3300037853 Bacteria 8278
346 Ga0436364_1243048 3300037853 Bacteria 1912
347 Ga0400486_16095 3300038742 Bacteria 2371
348 Ga0400483_292171 3300039062 Bacteria 65188
349 Ga0436365_0557618 3300039437 Bacteria 3163
350 Ga0436365_0612905 3300039437 Bacteria 3040
351 Ga0436365_0848884 3300039437 Bacteria 2621
352 Ga0436365_1034188 3300039437 Bacteria 34077
353 Ga0436365_1301518 3300039437 Bacteria 44224
354 Ga0436365_1738174 3300039437 Bacteria 3583
355 Ga0436360_0119299 3300039438 Bacteria 4999
356 Ga0436360_0233885 3300039438 Bacteria 2103
357 Ga0436360_0347755 3300039438 Bacteria 3733
358 Ga0436360_0354685 3300039438 Bacteria 5313
359 Ga0436360_0365560 3300039438 Bacteria 1324
360 Ga0436360_0788354 3300039438 Bacteria 1876
361 Ga0436360_1208531 3300039438 Bacteria 857
362 Ga0436361_0124664 3300039447 Bacteria 5541
363 Ga0436361_0205740 3300039447 Bacteria 6489
364 Ga0436361_0397425 3300039447 Bacteria 1005
365 Ga0436361_0727677 3300039447 Bacteria 2612
366 Ga0436361_0982947 3300039447 Bacteria 966
367 Ga0436361_1143633 3300039447 Bacteria 987
368 Ga0436363_0134158 3300039450 Bacteria 1708
369 Ga0436363_0269445 3300039450 Bacteria 2633
370 Ga0436363_0413557 3300039450 Bacteria 10195
371 Ga0436363_0423875 3300039450 Bacteria 3445
372 Ga0436363_0934104 3300039450 Bacteria 2070
373 Ga0436363_1600896 3300039450 Bacteria 1087
374 Ga0436362_0015457 3300039453 Bacteria 2013
375 Ga0436362_0304993 3300039453 Bacteria 1108
376 Ga0436362_0305268 3300039453 Bacteria 3246
377 Ga0436362_0345293 3300039453 Bacteria 970
378 Ga0436362_0439386 3300039453 Bacteria 1248
379 Ga0439466_0109720 3300041411 Bacteria 856
380 Ga0451793_0004549 3300041452 Bacteria 943
381 Ga0439435_0014469 3300042436 Bacteria 1949
382 Ga0451577_0225515 3300042876 Bacteria 1694
383 Ga0466969_0144838 3300044656 Bacteria 1097
384 Ga0466972_0132807 3300044658 Bacteria 1172
385 Ga0466961_0088171 3300044693 Bacteria 1960
386 Ga0466963_0018767 3300044694 Bacteria 4329
387 Ga0453684_0000015 3300044712 Bacteria 969198
388 Ga0453684_0000020 3300044712 Bacteria 879938
389 Ga0466957_0148345 3300044842 Bacteria 1515
390 Ga0466959_0055041 3300045049 Bacteria 2905
391 Ga0451576_0003329 3300045051 Bacteria 22260
392 Ga0451576_0076846 3300045051 Bacteria 3475
393 Ga0451576_0951006 3300045051 Bacteria 901
394 Ga0466967_0253280 3300045976 Bacteria 1682
395 Ga0466967_0293717 3300045976 Bacteria 1562
396 Ga0466967_1143672 3300045976 Bacteria 776
397 Ga0495592_0000762 3300046454 Bacteria 22399
398 Ga0495592_0003819 3300046454 Bacteria 10889
399 Ga0495592_0157846 3300046454 Bacteria 1563
400 Ga0495629_0006340 3300046459 Bacteria 8774
401 Ga0495629_0263377 3300046459 Bacteria 1185
402 Ga0495651_0004555 3300046462 Bacteria 10594
403 Ga0495651_0007570 3300046462 Bacteria 8307
404 Ga0495651_0083307 3300046462 Bacteria 2412
405 Ga0495651_0118058 3300046462 Bacteria 1952
406 Ga0495653_0000086 3300046463 Bacteria 76161
407 Ga0495580_0083741 3300046472 Bacteria 2222
408 Ga0495639_0021384 3300046475 Bacteria 2832
409 Ga0495662_0003051 3300046476 Bacteria 8445
410 Ga0495664_0000003 3300046477 Bacteria 551602
411 Ga0495664_0001415 3300046477 Bacteria 12716
412 Ga0495664_0024578 3300046477 Bacteria 3503
413 Ga0495664_0284276 3300046477 Bacteria 999
414 Ga0495594_0370127 3300046499 Bacteria 816
415 Ga0495608_0000011 3300046511 Bacteria 248514
416 Ga0495618_0000018 3300046514 Bacteria 139407
417 Ga0495618_0200070 3300046514 Bacteria 1265
418 Ga0495628_0000001 3300046516 Bacteria 917742
419 Ga0495628_0020351 3300046516 Bacteria 5476
420 Ga0495628_0026845 3300046516 Bacteria 4688
421 Ga0495630_0001287 3300046517 Bacteria 17287
422 Ga0495630_0059744 3300046517 Bacteria 2861
423 Ga0495632_0002735 3300046519 Bacteria 13101
424 Ga0495652_0000006 3300046529 Bacteria 459709
425 Ga0495652_0198891 3300046529 Bacteria 1522
426 Ga0495652_0391349 3300046529 Bacteria 986
427 Ga0495640_0000002 3300046533 Bacteria 646434
428 Ga0495640_0011000 3300046533 Bacteria 6970
429 Ga0495640_0222119 3300046533 Bacteria 1191
430 Ga0495586_0038973 3300046535 Bacteria 2554
431 Ga0495587_0000001 3300046536 Bacteria 724132
432 Ga0495587_0075114 3300046536 Bacteria 1962
433 Ga0495587_0078571 3300046536 Unclassified 1914
434 Ga0495645_0000009 3300046543 Bacteria 239632
435 Ga0495645_0011855 3300046543 Bacteria 6141
436 Ga0495645_0015122 3300046543 Bacteria 5486
437 Ga0495667_0000004 3300046559 Bacteria 295297
438 Ga0495667_0017708 3300046559 Bacteria 4813
439 Ga0495667_0138238 3300046559 Bacteria 1570
440 Ga0495634_0000014 3300046642 Bacteria 128091
441 Ga0495635_0000001 3300046663 Bacteria 704901
442 Ga0495635_0350442 3300046663 Bacteria 985
443 Ga0495657_0001040 3300046675 Bacteria 24263
444 Ga0495657_0034708 3300046675 Bacteria 3501
445 Ga0495657_0243384 3300046675 Bacteria 1085
446 Ga0495599_0000036 3300046678 Bacteria 102707
447 Ga0495599_0011772 3300046678 Bacteria 5377
448 Ga0495599_0102892 3300046678 Bacteria 1780
449 Ga0495599_0274085 3300046678 Bacteria 1023
450 Ga0495623_0017188 3300046679 Bacteria 4672
451 Ga0495646_0000019 3300046680 Bacteria 119527
452 Ga0495646_0016881 3300046680 Bacteria 4636
453 Ga0495646_0112019 3300046680 Bacteria 1553
454 Ga0495658_0037839 3300046683 Bacteria 2669
455 Ga0495658_0296235 3300046683 Bacteria 1023
456 Ga0495658_0340298 3300046683 Bacteria 953
457 Ga0495613_0005980 3300046689 Bacteria 9108
458 Ga0495613_0221248 3300046689 Bacteria 1329
459 Ga0495624_0266938 3300046690 Bacteria 1034
460 Ga0495670_0000007 3300046691 Bacteria 247088
461 Ga0495600_0000123 3300046809 Bacteria 43494
462 Ga0495600_0103027 3300046809 Bacteria 1860
463 Ga0495600_0159159 3300046809 Bacteria 1460
464 Ga0495581_0005814 3300047315 Bacteria 7153
465 Ga0495581_0125096 3300047315 Bacteria 1497
466 Ga0495604_0000008 3300047317 Bacteria 341160
467 Ga0495604_0022414 3300047317 Bacteria 5043
468 Ga0495674_0000016 3300047319 Bacteria 216763
469 Ga0495674_0034614 3300047319 Bacteria 4566
470 Ga0495674_0039910 3300047319 Bacteria 4203
471 Ga0495674_0317601 3300047319 Bacteria 1270
472 Ga0495680_0000349 3300047322 Bacteria 51602
473 Ga0495680_0032781 3300047322 Bacteria 4213
474 Ga0495680_0080994 3300047322 Bacteria 2452
475 Ga0495680_0284162 3300047322 Bacteria 1165
476 Ga0495675_0001070 3300047444 Bacteria 16605
477 Ga0495675_0015943 3300047444 Bacteria 4752
478 Ga0495675_0045395 3300047444 Bacteria 2798
479 Ga0495675_0185264 3300047444 Bacteria 1273
480 Ga0495684_0000002 3300047471 Bacteria 341216
481 Ga0495684_0101097 3300047471 Bacteria 2180
482 Ga0495684_0151713 3300047471 Bacteria 1732
483 Ga0495684_0180011 3300047471 Bacteria 1567
484 Ga0495686_0029987 3300047472 Bacteria 3535
485 Ga0495593_0008176 3300047673 Bacteria 6086
486 Ga0495602_0000066 3300048088 Bacteria 102731
487 Ga0495602_0000513 3300048088 Bacteria 36136
488 Ga0495602_0031496 3300048088 Bacteria 5014
489 Ga0495602_0152495 3300048088 Bacteria 1814
490 Ga0495602_0155083 3300048088 Bacteria 1794
491 Ga0496100_0309889 3300048903 Bacteria 1183
492 Ga0496101_0016142 3300048904 Bacteria 5042
493 Ga0496102_0101841 3300048905 Bacteria 2669
494 Ga0496102_0136771 3300048905 Bacteria 2296
495 Ga0496102_0482055 3300048905 Bacteria 1162
496 Ga0496104_0002439 3300048907 Bacteria 16017
497 Ga0496104_0006378 3300048907 Bacteria 10372
498 Ga0496104_0027620 3300048907 Bacteria 5253
499 Ga0496104_0062211 3300048907 Bacteria 3539
500 Ga0496104_0313168 3300048907 Bacteria 1482
501 Ga0496105_0000433 3300048908 Bacteria 27434
502 Ga0496105_0002518 3300048908 Bacteria 13288
503 Ga0496105_0002986 3300048908 Bacteria 12433
504 Ga0496105_0004363 3300048908 Bacteria 10649
505 Ga0496106_0160894 3300048909 Bacteria 1775
506 Ga0496106_0191675 3300048909 Bacteria 1625
507 Ga0496107_0231792 3300048910 Bacteria 1374
508 Ga0496108_0000416 3300048911 Bacteria 34834
509 Ga0496108_0073933 3300048911 Bacteria 2877
510 Ga0496108_0124885 3300048911 Bacteria 2209
511 Ga0496109_0001317 3300048912 Bacteria 20486
512 Ga0496109_0846257 3300048912 Bacteria 853
513 Ga0496110_0009228 3300048913 Bacteria 7973
514 Ga0496110_0031833 3300048913 Bacteria 4553
515 Ga0496110_0060328 3300048913 Bacteria 3344
516 Ga0496110_0110511 3300048913 Bacteria 2470
517 Ga0496110_0185844 3300048913 Bacteria 1887
518 Ga0496110_0218292 3300048913 Bacteria 1734
519 Ga0496110_0482089 3300048913 Bacteria 1130
520 Ga0496111_0003408 3300048914 Bacteria 9839
521 Ga0496111_0040603 3300048914 Bacteria 3338
522 Ga0496111_0302866 3300048914 Bacteria 1185
523 Ga0496112_0010780 3300048915 Bacteria 8313
524 Ga0496112_0033019 3300048915 Bacteria 5026
525 Ga0496112_0041717 3300048915 Bacteria 4490
526 Ga0496112_0310757 3300048915 Bacteria 1521
527 Ga0496113_0004716 3300048916 Bacteria 8413
528 Ga0496113_0024469 3300048916 Bacteria 4292
529 Ga0496113_0094188 3300048916 Bacteria 2313
530 Ga0496114_0198863 3300048917 Bacteria 1755
531 Ga0496114_0206925 3300048917 Bacteria 1720
532 Ga0496114_0501104 3300048917 Bacteria 1074
533 Ga0496115_0024070 3300048918 Bacteria 4731
534 Ga0496115_0038610 3300048918 Bacteria 3789
535 Ga0496115_0070353 3300048918 Bacteria 2836
536 Ga0496115_0083010 3300048918 Bacteria 2611
537 Ga0496115_0344654 3300048918 Bacteria 1216
538 Ga0496119_0077132 3300048922 Bacteria 1931
539 Ga0496120_0074565 3300048923 Bacteria 1853
540 Ga0496120_0153876 3300048923 Bacteria 1153
541 Ga0496121_0054182 3300048924 Bacteria 3354
542 Ga0496126_0182507 3300048929 Bacteria 1782
543 Ga0495682_0000882 3300049460 Bacteria 18611
544 Ga0501031_0024159 3300049568 Bacteria 3962
545 Ga0501031_0347154 3300049568 Bacteria 961
546 Ga0501032_0000546 3300049569 Bacteria 30501
547 Ga0501033_0000076 3300049570 Bacteria 93921
548 Ga0501033_0029643 3300049570 Bacteria 4112
549 Ga0501033_0147763 3300049570 Bacteria 1697
550 Ga0501034_0001507 3300049571 Bacteria 30558
551 Ga0501034_0002934 3300049571 Bacteria 19768
552 Ga0501034_0013853 3300049571 Bacteria 8300
553 Ga0501034_0078128 3300049571 Bacteria 3314
554 Ga0501034_0196629 3300049571 Bacteria 1976
555 Ga0501034_0221980 3300049571 Bacteria 1842
556 Ga0501036_0001029 3300049572 Bacteria 21072
557 Ga0501036_0018683 3300049572 Bacteria 5813
558 Ga0501036_0038467 3300049572 Bacteria 4049
559 Ga0501037_0000838 3300049573 Bacteria 22953
560 Ga0501037_0040606 3300049573 Bacteria 3424
561 Ga0501038_0004571 3300049574 Bacteria 12877
562 Ga0501038_0459049 3300049574 Bacteria 979
563 Ga0501039_0002888 3300049575 Bacteria 12860
564 Ga0501039_0012377 3300049575 Bacteria 6511
565 Ga0501039_0064179 3300049575 Bacteria 2846
566 Ga0501039_0430032 3300049575 Bacteria 1037
567 Ga0501040_0006992 3300049576 Bacteria 7311
568 Ga0501040_0031938 3300049576 Bacteria 3561
569 Ga0501040_0217472 3300049576 Bacteria 1359
570 Ga0501041_0001547 3300049577 Bacteria 12791
571 Ga0501041_0004937 3300049577 Bacteria 7754
572 Ga0501042_0002531 3300049578 Bacteria 11248
573 Ga0501042_0007204 3300049578 Bacteria 7278
574 Ga0501042_0455203 3300049578 Bacteria 928
575 Ga0501043_0000043 3300049579 Bacteria 115410
576 Ga0501043_0007635 3300049579 Bacteria 8569
577 Ga0501046_0012654 3300049580 Bacteria 7175
578 Ga0501046_0044343 3300049580 Bacteria 3537
579 Ga0501047_0003830 3300049581 Bacteria 14145
580 Ga0501047_0016124 3300049581 Bacteria 7127
581 Ga0501047_0058006 3300049581 Bacteria 3741
582 Ga0501047_0201981 3300049581 Bacteria 1849
583 Ga0501048_0000809 3300049582 Bacteria 22980
584 Ga0501048_0030397 3300049582 Bacteria 3908
585 Ga0501068_0028636 3300049584 Bacteria 3296
586 Ga0501068_0066663 3300049584 Bacteria 2193
587 Ga0501068_0096669 3300049584 Bacteria 1827
588 Ga0501070_0042766 3300049586 Bacteria 3773
589 Ga0501070_0160071 3300049586 Bacteria 1856
590 Ga0501070_0213540 3300049586 Bacteria 1583
591 Ga0501070_0294990 3300049586 Bacteria 1321
592 Ga0501071_0016801 3300049587 Bacteria 5034
593 Ga0501071_0033969 3300049587 Bacteria 3627
594 Ga0501071_0448272 3300049587 Bacteria 988
595 Ga0501072_0000611 3300049588 Bacteria 25731
596 Ga0501072_0001322 3300049588 Bacteria 18579
597 Ga0501072_0012372 3300049588 Bacteria 6521
598 Ga0501072_0368861 3300049588 Bacteria 1140
599 Ga0501072_0385704 3300049588 Bacteria 1112
600 Ga0501073_0028874 3300049589 Bacteria 3963
601 Ga0501073_0190818 3300049589 Bacteria 1418
602 Ga0501074_0053055 3300049590 Bacteria 2926
603 Ga0501075_0005902 3300049591 Bacteria 8376
604 Ga0501075_0224390 3300049591 Bacteria 1433
605 Ga0501075_0359342 3300049591 Bacteria 1110
606 Ga0501076_0002518 3300049592 Bacteria 12609
607 Ga0501076_0007284 3300049592 Bacteria 8050
608 Ga0501076_0517451 3300049592 Bacteria 984
609 Ga0501077_0012097 3300049593 Bacteria 5403
610 Ga0501077_0021059 3300049593 Bacteria 4125
611 Ga0501079_0000593 3300049741 Bacteria 23982
612 Ga0501079_0014911 3300049741 Bacteria 5923
613 Ga0501080_0019510 3300049742 Bacteria 6280
614 Ga0501080_0056161 3300049742 Bacteria 3667
615 Ga0501080_0232174 3300049742 Bacteria 1686
616 Ga0501080_0478525 3300049742 Bacteria 1114
617 Ga0501081_0025160 3300049743 Bacteria 4002
618 Ga0501035_0000958 3300049822 Bacteria 30505
619 Ga0501035_0082586 3300049822 Bacteria 2835
620 Ga0501035_0582887 3300049822 Bacteria 913
621 Ga0501044_0010596 3300049823 Bacteria 10000
622 Ga0501044_0062620 3300049823 Bacteria 3802
623 Ga0501044_0078020 3300049823 Bacteria 3357
624 Ga0501044_0100956 3300049823 Bacteria 2903
625 Ga0501044_0166694 3300049823 Bacteria 2177
626 Ga0501044_0214379 3300049823 Bacteria 1878
627 Ga0501045_0000080 3300049824 Bacteria 45916
628 Ga0501045_0047109 3300049824 Bacteria 3140
629 Ga0501045_0440284 3300049824 Bacteria 969
630 nmdc:mga0k408_54687_c1 3300050493 Bacteria 2313
631 nmdc:mga0qj67_41868_c1 3300050509 Bacteria 3604
632 nmdc:mga08y16_299903_c1 3300050511 Bacteria 1656
633 nmdc:mga08y16_42_c1 3300050511 Bacteria 128353
634 nmdc:mga0n895_534258_c1 3300050512 Bacteria 1179
635 nmdc:mga0rr50_72354_c1 3300050513 Bacteria 2632
636 nmdc:mga08x19_30359_c1 3300050514 Bacteria 3395
637 nmdc:mga08x19_67475_c1 3300050514 Bacteria 2326
638 nmdc:mga0sz30_109579_c1 3300050516 Bacteria 1209
639 Ga0495601_0000001 3300053077 Bacteria 549454
640 Ga0495601_0007865 3300053077 Bacteria 6277
641 Ga0495601_0099516 3300053077 Bacteria 1877
642 Ga0495601_0208886 3300053077 Bacteria 1275
643 Ga0495612_0000003 3300053078 Bacteria 303629
644 Ga0495612_0000204 3300053078 Bacteria 25372
645 Ga0495612_0052857 3300053078 Bacteria 1672
646 Ga0495612_0055227 3300053078 Bacteria 1637
647 Ga0495595_0000400 3300053084 Bacteria 16467
648 Ga0495595_0006488 3300053084 Bacteria 4774
649 Ga0495595_0180951 3300053084 Bacteria 1045
650 Ga0495619_0000004 3300053085 Bacteria 500068
651 Ga0495619_0004720 3300053085 Bacteria 8676
652 Ga0495619_0074730 3300053085 Bacteria 2273
653 Ga0495619_0182362 3300053085 Bacteria 1452
654 Ga0495619_0249565 3300053085 Bacteria 1230
655 Ga0500651_0317220 3300053093 Bacteria 891
656 Ga0500568_0006856 3300053139 Bacteria 5670
657 Ga0500619_017197 3300053154 Bacteria 2007
658 Ga0501084_0008447 3300054114 Bacteria 8512
659 Ga0501084_0043895 3300054114 Bacteria 3741
660 Ga0590071_010402 3300059421 Bacteria 2179
661 Ga0501082_0001982 3300060353 Bacteria 18013
662 Ga0501082_0044501 3300060353 Bacteria 3829
663 Ga0501082_0096032 3300060353 Bacteria 2562
664 Ga0501082_0568704 3300060353 Bacteria 992
665 Ga0530510_0006133 3300061734 Bacteria 8346
666 Ga0530510_0011857 3300061734 Bacteria 6116
667 Ga0530510_0146643 3300061734 Bacteria 1741
668 Ga0530510_0236115 3300061734 Bacteria 1361

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10019677 Ga0207695_100196775 214
2 3300025941 Ga0207711_10000001 Ga0207711_10000001775 214
3 3300025933 Ga0207706_10194512 Ga0207706_101945122 218
4 3300053093 Ga0500651_0317220 Ga0500651_0317220_18_689 223
5 3300005436 Ga0070713_100066455 Ga0070713_1000664552 227
6 3300006028 Ga0070717_10119287 Ga0070717_101192872 227
7 3300049581 Ga0501047_0201981 Ga0501047_0201981_181_879 232
8 3300053154 Ga0500619_017197 Ga0500619_017197_514_1212 232
9 3300006178 Ga0075367_10113627 Ga0075367_101136272 237
10 3300049586 Ga0501070_0042766 Ga0501070_0042766_363_1079 238
11 3300005339 Ga0070660_100483317 Ga0070660_1004833171 240
12 3300005458 Ga0070681_10000030 Ga0070681_100000302 240
13 3300005530 Ga0070679_100004492 Ga0070679_10000449211 240
14 3300005563 Ga0068855_100000080 Ga0068855_10000008056 240
15 3300005616 Ga0068852_100070479 Ga0068852_1000704793 240
16 3300005616 Ga0068852_100098394 Ga0068852_1000983942 240
17 3300009093 Ga0105240_10000575 Ga0105240_100005757 240
18 3300009093 Ga0105240_10016714 Ga0105240_100167147 240
19 3300009177 Ga0105248_10000001 Ga0105248_100000011096 240
20 3300009177 Ga0105248_10140574 Ga0105248_101405742 240
21 3300009551 Ga0105238_10005915 Ga0105238_100059155 240
22 3300010375 Ga0105239_10009459 Ga0105239_100094592 240
23 3300010375 Ga0105239_10042034 Ga0105239_100420342 240
24 3300013105 Ga0157369_10014185 Ga0157369_100141856 240
25 3300013307 Ga0157372_10298327 Ga0157372_102983272 240
26 3300025912 Ga0207707_10000001 Ga0207707_100000011051 240
27 3300025913 Ga0207695_10000012 Ga0207695_10000012781 240
28 3300025916 Ga0207663_10355244 Ga0207663_103552442 240
29 3300025917 Ga0207660_10000652 Ga0207660_1000065215 240
30 3300025921 Ga0207652_10000311 Ga0207652_1000031118 240
31 3300025924 Ga0207694_10000055 Ga0207694_1000005544 240
32 3300025949 Ga0207667_10000068 Ga0207667_10000068105 240
33 3300026041 Ga0207639_10057654 Ga0207639_100576542 240
34 3300026142 Ga0207698_10033786 Ga0207698_100337864 240
35 3300026142 Ga0207698_10582974 Ga0207698_105829742 240
36 3300031239 Ga0265328_10004683 Ga0265328_100046832 240
37 3300031249 Ga0265339_10016458 Ga0265339_100164583 240
38 3300031344 Ga0265316_10052522 Ga0265316_100525223 240
39 3300031711 Ga0265314_10038245 Ga0265314_100382454 240
40 3300048918 Ga0496115_0344654 Ga0496115_0344654_113_835 240
41 3300049460 Ga0495682_0000882 Ga0495682_0000882_6205_6927 240
42 3300049742 Ga0501080_0019510 Ga0501080_0019510_2884_3606 240
43 3300046691 Ga0495670_0000007 Ga0495670_0000007_244420_245157 243
44 3300039438 Ga0436360_0119299 Ga0436360_0119299_1603_2367 244
45 3300039453 Ga0436362_0345293 Ga0436362_0345293_217_957 244
46 3300031249 Ga0265339_10112626 Ga0265339_101126262 245
47 3300045976 Ga0466967_1143672 Ga0466967_1143672_14_757 245
48 3300046477 Ga0495664_0024578 Ga0495664_0024578_406_1143 245
49 3300046536 Ga0495587_0078571 Ga0495587_0078571_977_1714 245
50 3300046543 Ga0495645_0011855 Ga0495645_0011855_3005_3742 245
51 3300046678 Ga0495599_0102892 Ga0495599_0102892_837_1574 245
52 3300047444 Ga0495675_0045395 Ga0495675_0045395_848_1585 245
53 3300048929 Ga0496126_0182507 Ga0496126_0182507_593_1342 245
54 3300049571 Ga0501034_0221980 Ga0501034_0221980_380_1117 245
55 3300049581 Ga0501047_0003830 Ga0501047_0003830_7642_8379 245
56 3300049588 Ga0501072_0012372 Ga0501072_0012372_5146_5883 245
57 3300049589 Ga0501073_0028874 Ga0501073_0028874_285_1022 245
58 3300054114 Ga0501084_0043895 Ga0501084_0043895_2752_3489 245
59 iso_pu_bacteria 2919709256 2919710371 245
60 3300048088 Ga0495602_0031496 Ga0495602_0031496_965_1711 246
61 iso_pu_bacteria 2522572158 2523103468 246
62 3300011119 Ga0105246_10364994 Ga0105246_103649942 247
63 3300013306 Ga0163162_10693609 Ga0163162_106936092 247
64 3300014497 Ga0182008_10011974 Ga0182008_100119745 247
65 3300049570 Ga0501033_0147763 Ga0501033_0147763_400_1155 247
66 3300049823 Ga0501044_0100956 Ga0501044_0100956_1292_2047 247
67 3300014325 Ga0163163_10610693 Ga0163163_106106932 248
68 3300039437 Ga0436365_0557618 Ga0436365_0557618_1567_2343 248
69 3300042436 Ga0439435_0014469 Ga0439435_0014469_845_1618 248
70 iso_pu_bacteria 2883291878 2883297114 248
71 3300005434 Ga0070709_10062338 Ga0070709_100623382 249
72 3300005436 Ga0070713_100195418 Ga0070713_1001954182 249
73 3300005436 Ga0070713_100372584 Ga0070713_1003725841 249
74 3300005437 Ga0070710_10206854 Ga0070710_102068542 249
75 3300005439 Ga0070711_100090963 Ga0070711_1000909632 249
76 3300005467 Ga0070706_100239606 Ga0070706_1002396062 249
77 3300005536 Ga0070697_100127841 Ga0070697_1001278412 249
78 3300006028 Ga0070717_10006757 Ga0070717_100067574 249
79 3300006175 Ga0070712_100009526 Ga0070712_1000095265 249
80 3300006175 Ga0070712_100054421 Ga0070712_1000544213 249
81 3300009553 Ga0105249_10005913 Ga0105249_1000591312 249
82 3300017792 Ga0163161_10009039 Ga0163161_100090392 249
83 3300021388 Ga0213875_10001649 Ga0213875_1000164913 249
84 3300025901 Ga0207688_10099313 Ga0207688_100993132 249
85 3300025906 Ga0207699_10172630 Ga0207699_101726302 249
86 3300025915 Ga0207693_10004952 Ga0207693_100049522 249
87 3300025915 Ga0207693_10008584 Ga0207693_100085842 249
88 3300025916 Ga0207663_10083762 Ga0207663_100837622 249
89 3300025928 Ga0207700_10477644 Ga0207700_104776442 249
90 3300036647 Ga0316582_0061052 Ga0316582_0061052_1481_2236 249
91 3300037853 Ga0436364_0157955 Ga0436364_0157955_41554_42312 249
92 3300037853 Ga0436364_0729534 Ga0436364_0729534_1653_2489 249
93 3300039062 Ga0400483_292171 Ga0400483_292171_14376_15152 249
94 3300039438 Ga0436360_0347755 Ga0436360_0347755_2640_3392 249
95 3300039450 Ga0436363_0269445 Ga0436363_0269445_1225_1977 249
96 3300048913 Ga0496110_0031833 Ga0496110_0031833_1991_2746 249
97 3300048924 Ga0496121_0054182 Ga0496121_0054182_1187_1942 249
98 iso_pu_bacteria 2599185354 2600203248 249
99 iso_pu_bacteria 2713897090 2715500049 249
100 iso_pu_bacteria 2830075706 2830077987 249
101 iso_pu_bacteria 2834578030 2834578677 249
102 iso_pu_bacteria 2855020534 2855022119 249
103 3300044658 Ga0466972_0132807 Ga0466972_0132807_34_789 250
104 3300050516 nmdc:mga0sz30_109579_c1 nmdc:mga0sz30_109579_c1_214_969 250
105 iso_pu_bacteria 2751185897 2753766774 250
106 iso_pu_bacteria 2917554339 2917555886 250
107 3300005614 Ga0068856_100397712 Ga0068856_1003977122 251
108 3300046519 Ga0495632_0002735 Ga0495632_0002735_7108_7869 251
109 3300048907 Ga0496104_0002439 Ga0496104_0002439_6570_7364 251
110 3300048907 Ga0496104_0313168 Ga0496104_0313168_336_1130 251
111 3300048908 Ga0496105_0000433 Ga0496105_0000433_23074_23853 251
112 3300048908 Ga0496105_0004363 Ga0496105_0004363_8885_9679 251
113 3300048911 Ga0496108_0124885 Ga0496108_0124885_1288_2082 251
114 3300048912 Ga0496109_0846257 Ga0496109_0846257_75_839 251
115 3300048913 Ga0496110_0009228 Ga0496110_0009228_1326_2120 251
116 3300048915 Ga0496112_0033019 Ga0496112_0033019_383_1177 251
117 3300048916 Ga0496113_0094188 Ga0496113_0094188_1121_1915 251
118 3300048917 Ga0496114_0501104 Ga0496114_0501104_230_1024 251
119 3300048918 Ga0496115_0070353 Ga0496115_0070353_653_1447 251
120 3300048918 Ga0496115_0083010 Ga0496115_0083010_489_1268 251
121 iso_pu_bacteria 2523231067 2523467985 251
122 iso_pu_bacteria 2738543031 2739350014 251
123 iso_pu_bacteria 2842333319 2842340794 251
124 3300005367 Ga0070667_100206670 Ga0070667_1002066702 252
125 3300005435 Ga0070714_100336525 Ga0070714_1003365251 252
126 3300005441 Ga0070700_100132610 Ga0070700_1001326102 252
127 3300005444 Ga0070694_100461641 Ga0070694_1004616411 252
128 3300005467 Ga0070706_100281022 Ga0070706_1002810222 252
129 3300005518 Ga0070699_100816213 Ga0070699_1008162131 252
130 3300005535 Ga0070684_100031254 Ga0070684_1000312544 252
131 3300005539 Ga0068853_100405427 Ga0068853_1004054271 252
132 3300005546 Ga0070696_100219832 Ga0070696_1002198322 252
133 3300005563 Ga0068855_100165826 Ga0068855_1001658263 252
134 3300006173 Ga0070716_100160836 Ga0070716_1001608362 252
135 3300006358 Ga0068871_100092675 Ga0068871_1000926752 252
136 3300009098 Ga0105245_10139496 Ga0105245_101394962 252
137 3300009176 Ga0105242_10087691 Ga0105242_100876913 252
138 3300009177 Ga0105248_10051710 Ga0105248_100517103 252
139 3300009551 Ga0105238_10065786 Ga0105238_100657861 252
140 3300009551 Ga0105238_10159756 Ga0105238_101597562 252
141 3300013105 Ga0157369_10185899 Ga0157369_101858992 252
142 3300013307 Ga0157372_10505389 Ga0157372_105053892 252
143 3300020082 Ga0206353_11177956 Ga0206353_111779561 252
144 3300021384 Ga0213876_10105293 Ga0213876_101052932 252
145 3300025915 Ga0207693_10202544 Ga0207693_102025442 252
146 3300025922 Ga0207646_10016802 Ga0207646_100168022 252
147 3300025928 Ga0207700_10192416 Ga0207700_101924162 252
148 3300025934 Ga0207686_10085407 Ga0207686_100854071 252
149 3300025941 Ga0207711_10094294 Ga0207711_100942942 252
150 3300025942 Ga0207689_10321350 Ga0207689_103213502 252
151 3300025945 Ga0207679_10111008 Ga0207679_101110082 252
152 3300026035 Ga0207703_10342326 Ga0207703_103423262 252
153 3300026078 Ga0207702_10040096 Ga0207702_100400962 252
154 3300026116 Ga0207674_10128706 Ga0207674_101287062 252
155 3300031727 Ga0316576_10165397 Ga0316576_101653972 252
156 3300031728 Ga0316578_10062595 Ga0316578_100625952 252
157 3300035113 Ga0373936_0025050 Ga0373936_0025050_1473_2255 252
158 3300035116 Ga0373945_0002616 Ga0373945_0002616_432_1214 252
159 3300035117 Ga0373953_0000371 Ga0373953_0000371_8237_9019 252
160 3300035118 Ga0373954_0007576 Ga0373954_0007576_1558_2340 252
161 3300035170 Ga0373943_0004245 Ga0373943_0004245_4998_5780 252
162 3300035171 Ga0373946_0001712 Ga0373946_0001712_5254_6036 252
163 3300035172 Ga0373955_0000114 Ga0373955_0000114_17499_18281 252
164 3300035172 Ga0373955_0339587 Ga0373955_0339587_94_858 252
165 3300035410 Ga0373924_0000320 Ga0373924_0000320_8767_9549 252
166 3300035692 Ga0373935_0000395 Ga0373935_0000395_7582_8364 252
167 3300035695 Ga0373927_0003872 Ga0373927_0003872_2355_3137 252
168 3300035725 Ga0373947_0000980 Ga0373947_0000980_11363_12145 252
169 3300035725 Ga0373947_0104858 Ga0373947_0104858_887_1762 252
170 3300036401 Ga0373937_0000079 Ga0373937_0000079_23565_24347 252
171 3300036712 Ga0316584_0053180 Ga0316584_0053180_1136_1897 252
172 3300037068 Ga0373925_0000064 Ga0373925_0000064_7423_8205 252
173 3300037068 Ga0373925_0061537 Ga0373925_0061537_1017_1907 252
174 3300041452 Ga0451793_0004549 Ga0451793_0004549_110_877 252
175 3300044694 Ga0466963_0018767 Ga0466963_0018767_2178_2954 252
176 3300044842 Ga0466957_0148345 Ga0466957_0148345_479_1255 252
177 3300045976 Ga0466967_0253280 Ga0466967_0253280_257_1033 252
178 3300046454 Ga0495592_0000762 Ga0495592_0000762_14194_14976 252
179 3300046459 Ga0495629_0006340 Ga0495629_0006340_7126_7908 252
180 3300046462 Ga0495651_0004555 Ga0495651_0004555_2454_3236 252
181 3300046462 Ga0495651_0083307 Ga0495651_0083307_43_822 252
182 3300046463 Ga0495653_0000086 Ga0495653_0000086_67987_68769 252
183 3300046475 Ga0495639_0021384 Ga0495639_0021384_1610_2392 252
184 3300046476 Ga0495662_0003051 Ga0495662_0003051_1745_2527 252
185 3300046477 Ga0495664_0000003 Ga0495664_0000003_294330_295112 252
186 3300046511 Ga0495608_0000011 Ga0495608_0000011_240334_241116 252
187 3300046514 Ga0495618_0000018 Ga0495618_0000018_124423_125205 252
188 3300046516 Ga0495628_0000001 Ga0495628_0000001_783731_784513 252
189 3300046517 Ga0495630_0001287 Ga0495630_0001287_9212_9994 252
190 3300046517 Ga0495630_0059744 Ga0495630_0059744_1823_2698 252
191 3300046529 Ga0495652_0000006 Ga0495652_0000006_51803_52585 252
192 3300046533 Ga0495640_0000002 Ga0495640_0000002_238544_239326 252
193 3300046533 Ga0495640_0011000 Ga0495640_0011000_4771_5646 252
194 3300046535 Ga0495586_0038973 Ga0495586_0038973_310_1092 252
195 3300046536 Ga0495587_0000001 Ga0495587_0000001_311000_311782 252
196 3300046543 Ga0495645_0000009 Ga0495645_0000009_170902_171684 252
197 3300046559 Ga0495667_0000004 Ga0495667_0000004_210647_211429 252
198 3300046642 Ga0495634_0000014 Ga0495634_0000014_125382_126164 252
199 3300046663 Ga0495635_0000001 Ga0495635_0000001_296811_297593 252
200 3300046675 Ga0495657_0001040 Ga0495657_0001040_5956_6738 252
201 3300046675 Ga0495657_0243384 Ga0495657_0243384_279_1058 252
202 3300046678 Ga0495599_0000036 Ga0495599_0000036_94518_95300 252
203 3300046680 Ga0495646_0000019 Ga0495646_0000019_111280_112062 252
204 3300046683 Ga0495658_0037839 Ga0495658_0037839_1551_2333 252
205 3300046689 Ga0495613_0005980 Ga0495613_0005980_1747_2529 252
206 3300046809 Ga0495600_0000123 Ga0495600_0000123_1447_2229 252
207 3300046809 Ga0495600_0103027 Ga0495600_0103027_646_1425 252
208 3300047315 Ga0495581_0005814 Ga0495581_0005814_5307_6089 252
209 3300047317 Ga0495604_0000008 Ga0495604_0000008_208252_209034 252
210 3300047319 Ga0495674_0000016 Ga0495674_0000016_132241_133023 252
211 3300047319 Ga0495674_0034614 Ga0495674_0034614_79_954 252
212 3300047322 Ga0495680_0000349 Ga0495680_0000349_43407_44189 252
213 3300047444 Ga0495675_0001070 Ga0495675_0001070_7557_8339 252
214 3300047444 Ga0495675_0185264 Ga0495675_0185264_410_1189 252
215 3300047471 Ga0495684_0000002 Ga0495684_0000002_208310_209092 252
216 3300047471 Ga0495684_0180011 Ga0495684_0180011_682_1461 252
217 3300047673 Ga0495593_0008176 Ga0495593_0008176_3857_4639 252
218 3300048088 Ga0495602_0000066 Ga0495602_0000066_94511_95293 252
219 3300048905 Ga0496102_0136771 Ga0496102_0136771_607_1371 252
220 3300048909 Ga0496106_0160894 Ga0496106_0160894_410_1174 252
221 3300048910 Ga0496107_0231792 Ga0496107_0231792_303_1067 252
222 3300048913 Ga0496110_0110511 Ga0496110_0110511_843_1607 252
223 3300048914 Ga0496111_0302866 Ga0496111_0302866_329_1093 252
224 3300049591 Ga0501075_0359342 Ga0501075_0359342_182_946 252
225 3300049742 Ga0501080_0478525 Ga0501080_0478525_52_828 252
226 3300053077 Ga0495601_0000001 Ga0495601_0000001_247810_248592 252
227 3300053077 Ga0495601_0099516 Ga0495601_0099516_339_1118 252
228 3300053078 Ga0495612_0000003 Ga0495612_0000003_94513_95295 252
229 3300053078 Ga0495612_0052857 Ga0495612_0052857_657_1436 252
230 3300053084 Ga0495595_0000400 Ga0495595_0000400_8022_8804 252
231 3300053084 Ga0495595_0006488 Ga0495595_0006488_2836_3615 252
232 3300053085 Ga0495619_0000004 Ga0495619_0000004_247841_248623 252
233 3300053085 Ga0495619_0004720 Ga0495619_0004720_928_1707 252
234 iso_pu_bacteria 2597490356 2599102816 252
235 iso_pu_bacteria 2846952575 2846952690 252
236 3300005330 Ga0070690_100222285 Ga0070690_1002222852 253
237 3300005335 Ga0070666_10253688 Ga0070666_102536882 253
238 3300005337 Ga0070682_100269165 Ga0070682_1002691652 253
239 3300005347 Ga0070668_100262522 Ga0070668_1002625222 253
240 3300005355 Ga0070671_100100947 Ga0070671_1001009472 253
241 3300005434 Ga0070709_10045824 Ga0070709_100458242 253
242 3300005435 Ga0070714_100034276 Ga0070714_1000342765 253
243 3300005435 Ga0070714_100182644 Ga0070714_1001826442 253
244 3300005435 Ga0070714_100263261 Ga0070714_1002632612 253
245 3300005435 Ga0070714_100418143 Ga0070714_1004181432 253
246 3300005436 Ga0070713_100091015 Ga0070713_1000910152 253
247 3300005436 Ga0070713_100194464 Ga0070713_1001944642 253
248 3300005437 Ga0070710_10034000 Ga0070710_100340004 253
249 3300005437 Ga0070710_10062224 Ga0070710_100622242 253
250 3300005456 Ga0070678_100070705 Ga0070678_1000707052 253
251 3300005518 Ga0070699_100112640 Ga0070699_1001126402 253
252 3300005548 Ga0070665_100017169 Ga0070665_1000171697 253
253 3300005614 Ga0068856_100008810 Ga0068856_1000088103 253
254 3300005614 Ga0068856_100543826 Ga0068856_1005438261 253
255 3300006028 Ga0070717_10025871 Ga0070717_100258712 253
256 3300006028 Ga0070717_10081853 Ga0070717_100818532 253
257 3300006042 Ga0075368_10009923 Ga0075368_100099231 253
258 3300006173 Ga0070716_100142616 Ga0070716_1001426162 253
259 3300006195 Ga0075366_10152669 Ga0075366_101526692 253
260 3300006914 Ga0075436_100018711 Ga0075436_1000187113 253
261 3300009176 Ga0105242_10528125 Ga0105242_105281252 253
262 3300013297 Ga0157378_10217289 Ga0157378_102172892 253
263 3300013308 Ga0157375_10107814 Ga0157375_101078141 253
264 3300014969 Ga0157376_10225925 Ga0157376_102259252 253
265 3300025291 Ga0209675_1000878 Ga0209675_10008788 253
266 3300025898 Ga0207692_10145427 Ga0207692_101454272 253
267 3300025906 Ga0207699_10022975 Ga0207699_100229752 253
268 3300025906 Ga0207699_10061906 Ga0207699_100619062 253
269 3300025915 Ga0207693_10011991 Ga0207693_100119913 253
270 3300025922 Ga0207646_10104113 Ga0207646_101041132 253
271 3300025927 Ga0207687_10349928 Ga0207687_103499282 253
272 3300025928 Ga0207700_10019735 Ga0207700_100197353 253
273 3300025928 Ga0207700_10115044 Ga0207700_101150442 253
274 3300025928 Ga0207700_10152002 Ga0207700_101520022 253
275 3300025929 Ga0207664_10073519 Ga0207664_100735193 253
276 3300025929 Ga0207664_10104201 Ga0207664_101042012 253
277 3300025929 Ga0207664_10232992 Ga0207664_102329922 253
278 3300025929 Ga0207664_10357858 Ga0207664_103578582 253
279 3300025939 Ga0207665_10029799 Ga0207665_100297991 253
280 3300025939 Ga0207665_10191350 Ga0207665_101913502 253
281 3300025945 Ga0207679_10483186 Ga0207679_104831861 253
282 3300025972 Ga0207668_10292161 Ga0207668_102921612 253
283 3300026078 Ga0207702_10012415 Ga0207702_100124158 253
284 3300026078 Ga0207702_10600565 Ga0207702_106005651 253
285 3300026121 Ga0207683_10041007 Ga0207683_100410073 253
286 3300027512 Ga0209179_1026118 Ga0209179_10261181 253
287 3300028379 Ga0268266_10151567 Ga0268266_101515672 253
288 3300028381 Ga0268264_10681849 Ga0268264_106818491 253
289 3300031238 Ga0265332_10000508 Ga0265332_100005085 253
290 3300031247 Ga0265340_10009467 Ga0265340_100094672 253
291 3300031249 Ga0265339_10013810 Ga0265339_100138104 253
292 3300031250 Ga0265331_10006826 Ga0265331_100068264 253
293 3300031344 Ga0265316_10029170 Ga0265316_100291703 253
294 3300031548 Ga0307408_100045235 Ga0307408_1000452353 253
295 3300031712 Ga0265342_10000573 Ga0265342_1000057310 253
296 3300032005 Ga0307411_10057047 Ga0307411_100570472 253
297 3300035089 Ga0373944_0118880 Ga0373944_0118880_32_796 253
298 3300035111 Ga0373923_0035928 Ga0373923_0035928_764_1531 253
299 3300035113 Ga0373936_0009944 Ga0373936_0009944_371_1138 253
300 3300035116 Ga0373945_0059098 Ga0373945_0059098_345_1109 253
301 3300035117 Ga0373953_0075386 Ga0373953_0075386_98_865 253
302 3300035119 Ga0373956_0124269 Ga0373956_0124269_32_799 253
303 3300035120 Ga0373957_0011436 Ga0373957_0011436_1464_2231 253
304 3300035170 Ga0373943_0027098 Ga0373943_0027098_1313_2077 253
305 3300035410 Ga0373924_0048908 Ga0373924_0048908_478_1245 253
306 3300035692 Ga0373935_0214092 Ga0373935_0214092_293_1075 253
307 3300035692 Ga0373935_0503450 Ga0373935_0503450_99_863 253
308 3300035695 Ga0373927_0075067 Ga0373927_0075067_178_954 253
309 3300035695 Ga0373927_0075637 Ga0373927_0075637_646_1410 253
310 3300036401 Ga0373937_0192510 Ga0373937_0192510_1087_1854 253
311 3300036401 Ga0373937_0318456 Ga0373937_0318456_674_1441 253
312 3300037068 Ga0373925_0140813 Ga0373925_0140813_91_855 253
313 3300037068 Ga0373925_0303232 Ga0373925_0303232_156_932 253
314 3300037853 Ga0436364_0790279 Ga0436364_0790279_1739_2512 253
315 3300039437 Ga0436365_1301518 Ga0436365_1301518_30429_31196 253
316 3300039438 Ga0436360_1208531 Ga0436360_1208531_12_788 253
317 3300039447 Ga0436361_1143633 Ga0436361_1143633_50_850 253
318 3300039450 Ga0436363_0413557 Ga0436363_0413557_725_1492 253
319 3300041411 Ga0439466_0109720 Ga0439466_0109720_50_814 253
320 3300044712 Ga0453684_0000020 Ga0453684_0000020_637220_637981 253
321 3300046454 Ga0495592_0157846 Ga0495592_0157846_393_1160 253
322 3300046472 Ga0495580_0083741 Ga0495580_0083741_636_1400 253
323 3300046477 Ga0495664_0001415 Ga0495664_0001415_9300_10067 253
324 3300046499 Ga0495594_0370127 Ga0495594_0370127_24_791 253
325 3300046516 Ga0495628_0020351 Ga0495628_0020351_3700_4467 253
326 3300046529 Ga0495652_0198891 Ga0495652_0198891_548_1315 253
327 3300046536 Ga0495587_0075114 Ga0495587_0075114_857_1624 253
328 3300046543 Ga0495645_0015122 Ga0495645_0015122_37_804 253
329 3300046559 Ga0495667_0138238 Ga0495667_0138238_674_1441 253
330 3300046675 Ga0495657_0034708 Ga0495657_0034708_2278_3045 253
331 3300046678 Ga0495599_0011772 Ga0495599_0011772_2323_3090 253
332 3300046678 Ga0495599_0274085 Ga0495599_0274085_57_851 253
333 3300046679 Ga0495623_0017188 Ga0495623_0017188_3159_3926 253
334 3300046680 Ga0495646_0016881 Ga0495646_0016881_2005_2772 253
335 3300046683 Ga0495658_0296235 Ga0495658_0296235_120_896 253
336 3300046809 Ga0495600_0159159 Ga0495600_0159159_662_1429 253
337 3300047315 Ga0495581_0125096 Ga0495581_0125096_582_1358 253
338 3300047317 Ga0495604_0022414 Ga0495604_0022414_323_1090 253
339 3300047319 Ga0495674_0039910 Ga0495674_0039910_2678_3445 253
340 3300047322 Ga0495680_0284162 Ga0495680_0284162_190_957 253
341 3300047444 Ga0495675_0015943 Ga0495675_0015943_1901_2668 253
342 3300047472 Ga0495686_0029987 Ga0495686_0029987_277_1050 253
343 3300048088 Ga0495602_0000513 Ga0495602_0000513_34633_35400 253
344 3300048088 Ga0495602_0155083 Ga0495602_0155083_425_1192 253
345 3300048903 Ga0496100_0309889 Ga0496100_0309889_148_924 253
346 3300048905 Ga0496102_0101841 Ga0496102_0101841_118_894 253
347 3300048907 Ga0496104_0027620 Ga0496104_0027620_4251_5027 253
348 3300048908 Ga0496105_0002518 Ga0496105_0002518_10792_11568 253
349 3300048911 Ga0496108_0000416 Ga0496108_0000416_15414_16190 253
350 3300048912 Ga0496109_0001317 Ga0496109_0001317_8829_9605 253
351 3300048913 Ga0496110_0060328 Ga0496110_0060328_431_1207 253
352 3300048913 Ga0496110_0218292 Ga0496110_0218292_428_1204 253
353 3300048913 Ga0496110_0482089 Ga0496110_0482089_133_897 253
354 3300048914 Ga0496111_0003408 Ga0496111_0003408_4233_5009 253
355 3300048915 Ga0496112_0010780 Ga0496112_0010780_3584_4360 253
356 3300048915 Ga0496112_0041717 Ga0496112_0041717_1730_2494 253
357 3300048915 Ga0496112_0310757 Ga0496112_0310757_407_1183 253
358 3300048916 Ga0496113_0004716 Ga0496113_0004716_523_1299 253
359 3300048916 Ga0496113_0024469 Ga0496113_0024469_2188_2952 253
360 3300048917 Ga0496114_0198863 Ga0496114_0198863_960_1736 253
361 3300048918 Ga0496115_0038610 Ga0496115_0038610_877_1653 253
362 3300049568 Ga0501031_0347154 Ga0501031_0347154_172_936 253
363 3300049823 Ga0501044_0214379 Ga0501044_0214379_163_954 253
364 3300050493 nmdc:mga0k408_54687_c1 nmdc:mga0k408_54687_c1_163_927 253
365 3300050512 nmdc:mga0n895_534258_c1 nmdc:mga0n895_534258_c1_319_1083 253
366 3300050513 nmdc:mga0rr50_72354_c1 nmdc:mga0rr50_72354_c1_386_1150 253
367 3300050514 nmdc:mga08x19_30359_c1 nmdc:mga08x19_30359_c1_701_1465 253
368 3300053077 Ga0495601_0208886 Ga0495601_0208886_328_1122 253
369 3300053078 Ga0495612_0000204 Ga0495612_0000204_23371_24138 253
370 3300053084 Ga0495595_0180951 Ga0495595_0180951_89_883 253
371 3300053085 Ga0495619_0074730 Ga0495619_0074730_1309_2103 253
372 3300053085 Ga0495619_0249565 Ga0495619_0249565_56_841 253
373 iso_pu_bacteria 2883354860 2883359896 253
374 iso_pu_bacteria 2894232714 2894237373 253
375 3300005329 Ga0070683_100139107 Ga0070683_1001391073 254
376 3300005336 Ga0070680_100048084 Ga0070680_1000480842 254
377 3300005336 Ga0070680_100339324 Ga0070680_1003393242 254
378 3300005338 Ga0068868_100302908 Ga0068868_1003029082 254
379 3300005354 Ga0070675_100640950 Ga0070675_1006409501 254
380 3300005356 Ga0070674_100415668 Ga0070674_1004156681 254
381 3300005366 Ga0070659_100140947 Ga0070659_1001409472 254
382 3300005436 Ga0070713_100417991 Ga0070713_1004179912 254
383 3300005456 Ga0070678_100045225 Ga0070678_1000452253 254
384 3300005458 Ga0070681_10000290 Ga0070681_1000029026 254
385 3300005458 Ga0070681_10119067 Ga0070681_101190673 254
386 3300005458 Ga0070681_10343277 Ga0070681_103432772 254
387 3300005530 Ga0070679_100000949 Ga0070679_10000094921 254
388 3300005535 Ga0070684_100139060 Ga0070684_1001390602 254
389 3300005536 Ga0070697_100395805 Ga0070697_1003958051 254
390 3300005548 Ga0070665_100064747 Ga0070665_1000647472 254
391 3300005577 Ga0068857_100209552 Ga0068857_1002095522 254
392 3300005614 Ga0068856_100074699 Ga0068856_1000746993 254
393 3300005617 Ga0068859_100640636 Ga0068859_1006406361 254
394 3300005843 Ga0068860_100440442 Ga0068860_1004404422 254
395 3300005981 Ga0081538_10010446 Ga0081538_100104462 254
396 3300005985 Ga0081539_10007126 Ga0081539_100071265 254
397 3300006175 Ga0070712_100272217 Ga0070712_1002722172 254
398 3300006871 Ga0075434_100219561 Ga0075434_1002195611 254
399 3300006931 Ga0097620_100640558 Ga0097620_1006405581 254
400 3300009093 Ga0105240_10140015 Ga0105240_101400153 254
401 3300009553 Ga0105249_10877629 Ga0105249_108776292 254
402 3300013104 Ga0157370_10002708 Ga0157370_1000270817 254
403 3300013105 Ga0157369_10031164 Ga0157369_100311644 254
404 3300021388 Ga0213875_10002605 Ga0213875_100026052 254
405 3300021388 Ga0213875_10003096 Ga0213875_100030965 254
406 3300021388 Ga0213875_10080605 Ga0213875_100806052 254
407 3300025912 Ga0207707_10005682 Ga0207707_1000568212 254
408 3300025913 Ga0207695_10029022 Ga0207695_100290226 254
409 3300025915 Ga0207693_10260295 Ga0207693_102602952 254
410 3300025915 Ga0207693_10288956 Ga0207693_102889562 254
411 3300025917 Ga0207660_10201020 Ga0207660_102010202 254
412 3300025917 Ga0207660_10357529 Ga0207660_103575291 254
413 3300025921 Ga0207652_10010915 Ga0207652_100109157 254
414 3300025929 Ga0207664_10437747 Ga0207664_104377472 254
415 3300025931 Ga0207644_10056066 Ga0207644_100560662 254
416 3300025932 Ga0207690_10104307 Ga0207690_101043071 254
417 3300025944 Ga0207661_10303870 Ga0207661_103038702 254
418 3300025960 Ga0207651_10360294 Ga0207651_103602941 254
419 3300026116 Ga0207674_10208602 Ga0207674_102086022 254
420 3300026121 Ga0207683_10045974 Ga0207683_100459743 254
421 3300028379 Ga0268266_10003807 Ga0268266_1000380712 254
422 3300028379 Ga0268266_10162519 Ga0268266_101625192 254
423 3300028381 Ga0268264_10156289 Ga0268264_101562892 254
424 3300031548 Ga0307408_100029367 Ga0307408_1000293673 254
425 3300031649 Ga0307514_10005043 Ga0307514_100050438 254
426 3300031901 Ga0307406_10467875 Ga0307406_104678751 254
427 3300035083 Ga0373926_0095548 Ga0373926_0095548_218_988 254
428 3300035111 Ga0373923_0162325 Ga0373923_0162325_113_898 254
429 3300035172 Ga0373955_0097961 Ga0373955_0097961_124_906 254
430 3300035691 Ga0373931_0057234 Ga0373931_0057234_301_1095 254
431 3300035692 Ga0373935_0275705 Ga0373935_0275705_363_1157 254
432 3300035724 Ga0373933_0142157 Ga0373933_0142157_670_1464 254
433 3300035724 Ga0373933_0259471 Ga0373933_0259471_89_859 254
434 3300035725 Ga0373947_0019078 Ga0373947_0019078_2806_3576 254
435 3300035725 Ga0373947_0024667 Ga0373947_0024667_1163_1945 254
436 3300036401 Ga0373937_0010551 Ga0373937_0010551_5721_6503 254
437 3300036401 Ga0373937_0091941 Ga0373937_0091941_491_1261 254
438 3300036401 Ga0373937_0319624 Ga0373937_0319624_441_1211 254
439 3300037068 Ga0373925_0005920 Ga0373925_0005920_6329_7099 254
440 3300037068 Ga0373925_0418983 Ga0373925_0418983_134_910 254
441 3300037312 Ga0395899_0014326 Ga0395899_0014326_4701_5501 254
442 3300037418 Ga0395900_0150390 Ga0395900_0150390_552_1352 254
443 3300037466 Ga0395898_0066631 Ga0395898_0066631_2115_2915 254
444 3300037853 Ga0436364_0128168 Ga0436364_0128168_22188_22982 254
445 3300037853 Ga0436364_0146609 Ga0436364_0146609_10479_11246 254
446 3300037853 Ga0436364_0320085 Ga0436364_0320085_316_1086 254
447 3300037853 Ga0436364_1027283 Ga0436364_1027283_6839_7609 254
448 3300038742 Ga0400486_16095 Ga0400486_16095_539_1306 254
449 3300039437 Ga0436365_1738174 Ga0436365_1738174_416_1186 254
450 3300039438 Ga0436360_0788354 Ga0436360_0788354_889_1656 254
451 3300044712 Ga0453684_0000015 Ga0453684_0000015_613956_614723 254
452 3300045051 Ga0451576_0003329 Ga0451576_0003329_19280_20053 254
453 3300045051 Ga0451576_0076846 Ga0451576_0076846_2596_3411 254
454 3300045051 Ga0451576_0951006 Ga0451576_0951006_49_831 254
455 3300045976 Ga0466967_0293717 Ga0466967_0293717_666_1451 254
456 3300046454 Ga0495592_0003819 Ga0495592_0003819_1831_2613 254
457 3300046459 Ga0495629_0263377 Ga0495629_0263377_97_882 254
458 3300046462 Ga0495651_0007570 Ga0495651_0007570_1566_2348 254
459 3300046477 Ga0495664_0284276 Ga0495664_0284276_117_899 254
460 3300046514 Ga0495618_0200070 Ga0495618_0200070_196_981 254
461 3300046516 Ga0495628_0026845 Ga0495628_0026845_2124_2906 254
462 3300046529 Ga0495652_0391349 Ga0495652_0391349_164_946 254
463 3300046533 Ga0495640_0222119 Ga0495640_0222119_330_1100 254
464 3300046559 Ga0495667_0017708 Ga0495667_0017708_1299_2084 254
465 3300046663 Ga0495635_0350442 Ga0495635_0350442_157_927 254
466 3300046680 Ga0495646_0112019 Ga0495646_0112019_363_1148 254
467 3300046683 Ga0495658_0340298 Ga0495658_0340298_139_909 254
468 3300046689 Ga0495613_0221248 Ga0495613_0221248_321_1103 254
469 3300046690 Ga0495624_0266938 Ga0495624_0266938_206_976 254
470 3300047319 Ga0495674_0317601 Ga0495674_0317601_170_952 254
471 3300047322 Ga0495680_0032781 Ga0495680_0032781_569_1351 254
472 3300047322 Ga0495680_0080994 Ga0495680_0080994_872_1657 254
473 3300047471 Ga0495684_0101097 Ga0495684_0101097_729_1514 254
474 3300047471 Ga0495684_0151713 Ga0495684_0151713_649_1419 254
475 3300048907 Ga0496104_0062211 Ga0496104_0062211_2086_2916 254
476 3300048913 Ga0496110_0185844 Ga0496110_0185844_258_1088 254
477 3300048917 Ga0496114_0206925 Ga0496114_0206925_768_1598 254
478 3300048918 Ga0496115_0024070 Ga0496115_0024070_142_972 254
479 3300048922 Ga0496119_0077132 Ga0496119_0077132_973_1743 254
480 3300048923 Ga0496120_0074565 Ga0496120_0074565_459_1229 254
481 3300049571 Ga0501034_0002934 Ga0501034_0002934_8467_9240 254
482 3300049571 Ga0501034_0013853 Ga0501034_0013853_4392_5192 254
483 3300049586 Ga0501070_0160071 Ga0501070_0160071_896_1681 254
484 3300050514 nmdc:mga08x19_67475_c1 nmdc:mga08x19_67475_c1_1283_2068 254
485 iso_pu_bacteria 2899803654 2899804435 254
486 3300005844 Ga0068862_100014189 Ga0068862_1000141899 255
487 3300005937 Ga0081455_10003778 Ga0081455_1000377814 255
488 3300005985 Ga0081539_10000072 Ga0081539_1000007262 255
489 3300009098 Ga0105245_10234921 Ga0105245_102349212 255
490 3300009177 Ga0105248_10133028 Ga0105248_101330282 255
491 3300010375 Ga0105239_10026796 Ga0105239_100267963 255
492 3300013104 Ga0157370_10016281 Ga0157370_100162812 255
493 3300014325 Ga0163163_10045518 Ga0163163_100455184 255
494 3300014325 Ga0163163_10333408 Ga0163163_103334082 255
495 3300014326 Ga0157380_10213444 Ga0157380_102134442 255
496 3300021384 Ga0213876_10063700 Ga0213876_100637002 255
497 3300021388 Ga0213875_10006915 Ga0213875_100069153 255
498 3300021388 Ga0213875_10045609 Ga0213875_100456092 255
499 3300025302 Ga0207426_1012877 Ga0207426_10128772 255
500 3300025923 Ga0207681_10026942 Ga0207681_100269422 255
501 3300025923 Ga0207681_10253209 Ga0207681_102532092 255
502 3300025929 Ga0207664_10309010 Ga0207664_103090102 255
503 3300025944 Ga0207661_10336739 Ga0207661_103367392 255
504 3300026118 Ga0207675_100008717 Ga0207675_1000087175 255
505 3300027866 Ga0209813_10048756 Ga0209813_100487562 255
506 3300027907 Ga0207428_10000651 Ga0207428_1000065114 255
507 3300028380 Ga0268265_10095407 Ga0268265_100954072 255
508 3300037853 Ga0436364_0559442 Ga0436364_0559442_3962_4738 255
509 3300037853 Ga0436364_0961939 Ga0436364_0961939_3020_3814 255
510 3300039437 Ga0436365_0612905 Ga0436365_0612905_1566_2339 255
511 3300039438 Ga0436360_0233885 Ga0436360_0233885_921_1688 255
512 3300039447 Ga0436361_0727677 Ga0436361_0727677_221_1000 255
513 3300046462 Ga0495651_0118058 Ga0495651_0118058_772_1668 255
514 3300048088 Ga0495602_0152495 Ga0495602_0152495_485_1381 255
515 3300048905 Ga0496102_0482055 Ga0496102_0482055_343_1131 255
516 3300048923 Ga0496120_0153876 Ga0496120_0153876_28_807 255
517 3300049572 Ga0501036_0038467 Ga0501036_0038467_3156_3926 255
518 3300049574 Ga0501038_0459049 Ga0501038_0459049_195_965 255
519 3300049575 Ga0501039_0012377 Ga0501039_0012377_4657_5427 255
520 3300049575 Ga0501039_0430032 Ga0501039_0430032_125_916 255
521 3300049576 Ga0501040_0006992 Ga0501040_0006992_1519_2289 255
522 3300049576 Ga0501040_0217472 Ga0501040_0217472_126_896 255
523 3300049577 Ga0501041_0004937 Ga0501041_0004937_5159_5929 255
524 3300049578 Ga0501042_0002531 Ga0501042_0002531_5992_6762 255
525 3300049579 Ga0501043_0007635 Ga0501043_0007635_4997_5767 255
526 3300049580 Ga0501046_0044343 Ga0501046_0044343_451_1221 255
527 3300049582 Ga0501048_0000809 Ga0501048_0000809_1910_2680 255
528 3300049584 Ga0501068_0066663 Ga0501068_0066663_866_1636 255
529 3300049584 Ga0501068_0096669 Ga0501068_0096669_902_1672 255
530 3300049586 Ga0501070_0213540 Ga0501070_0213540_345_1115 255
531 3300049587 Ga0501071_0016801 Ga0501071_0016801_2680_3450 255
532 3300049587 Ga0501071_0448272 Ga0501071_0448272_49_828 255
533 3300049588 Ga0501072_0000611 Ga0501072_0000611_4808_5578 255
534 3300049588 Ga0501072_0368861 Ga0501072_0368861_53_823 255
535 3300049588 Ga0501072_0385704 Ga0501072_0385704_209_1003 255
536 3300049589 Ga0501073_0190818 Ga0501073_0190818_457_1227 255
537 3300049590 Ga0501074_0053055 Ga0501074_0053055_724_1494 255
538 3300049591 Ga0501075_0005902 Ga0501075_0005902_5605_6375 255
539 3300049592 Ga0501076_0007284 Ga0501076_0007284_3592_4362 255
540 3300049592 Ga0501076_0517451 Ga0501076_0517451_103_897 255
541 3300049593 Ga0501077_0012097 Ga0501077_0012097_3120_3890 255
542 3300049593 Ga0501077_0021059 Ga0501077_0021059_1851_2621 255
543 3300049741 Ga0501079_0014911 Ga0501079_0014911_2855_3625 255
544 3300049742 Ga0501080_0232174 Ga0501080_0232174_449_1219 255
545 3300049822 Ga0501035_0082586 Ga0501035_0082586_1668_2438 255
546 3300050511 nmdc:mga08y16_42_c1 nmdc:mga08y16_42_c1_97434_98204 255
547 3300059421 Ga0590071_010402 Ga0590071_010402_122_892 255
548 3300060353 Ga0501082_0044501 Ga0501082_0044501_1823_2596 255
549 3300061734 Ga0530510_0011857 Ga0530510_0011857_5121_5891 255
550 3300061734 Ga0530510_0236115 Ga0530510_0236115_539_1309 255
551 3300005444 Ga0070694_100429723 Ga0070694_1004297232 256
552 3300005459 Ga0068867_100134777 Ga0068867_1001347773 256
553 3300005545 Ga0070695_100108497 Ga0070695_1001084971 256
554 3300005546 Ga0070696_100113534 Ga0070696_1001135342 256
555 3300006844 Ga0075428_100512541 Ga0075428_1005125411 256
556 3300009098 Ga0105245_10636795 Ga0105245_106367951 256
557 3300009148 Ga0105243_10029034 Ga0105243_100290343 256
558 3300009545 Ga0105237_10052414 Ga0105237_100524144 256
559 3300025914 Ga0207671_10044036 Ga0207671_100440364 256
560 3300031616 Ga0307508_10030386 Ga0307508_100303864 256
561 3300031995 Ga0307409_100319803 Ga0307409_1003198031 256
562 3300032002 Ga0307416_100805156 Ga0307416_1008051561 256
563 3300032004 Ga0307414_10092133 Ga0307414_100921333 256
564 3300032126 Ga0307415_100032315 Ga0307415_1000323153 256
565 3300033180 Ga0307510_10059307 Ga0307510_100593072 256
566 3300037471 Ga0395905_0092306 Ga0395905_0092306_1977_2762 256
567 3300039438 Ga0436360_0365560 Ga0436360_0365560_433_1221 256
568 3300039453 Ga0436362_0304993 Ga0436362_0304993_140_925 256
569 3300042876 Ga0451577_0225515 Ga0451577_0225515_671_1462 256
570 3300049570 Ga0501033_0029643 Ga0501033_0029643_1856_2629 256
571 3300049573 Ga0501037_0040606 Ga0501037_0040606_2413_3186 256
572 3300049578 Ga0501042_0455203 Ga0501042_0455203_114_905 256
573 3300049822 Ga0501035_0582887 Ga0501035_0582887_26_799 256
574 3300049823 Ga0501044_0078020 Ga0501044_0078020_2177_2977 256
575 3300049824 Ga0501045_0440284 Ga0501045_0440284_90_884 256
576 3300060353 Ga0501082_0568704 Ga0501082_0568704_108_899 256
577 iso_pu_bacteria 2508501050 2508727247 256
578 iso_pu_bacteria 2508501114 2509077705 256
579 iso_pu_bacteria 2773857925 2774872370 256
580 iso_pu_bacteria 2775506901 2776261879 256
581 iso_pu_bacteria 2835312727 2835313908 256
582 iso_pu_bacteria 2882456835 2882457077 256
583 3300005327 Ga0070658_10308596 Ga0070658_103085962 257
584 3300005336 Ga0070680_100195337 Ga0070680_1001953373 257
585 3300005356 Ga0070674_100108898 Ga0070674_1001088982 257
586 3300006844 Ga0075428_100410051 Ga0075428_1004100512 257
587 3300009093 Ga0105240_10308317 Ga0105240_103083172 257
588 3300009545 Ga0105237_10142718 Ga0105237_101427182 257
589 3300025909 Ga0207705_10307919 Ga0207705_103079192 257
590 3300031247 Ga0265340_10011425 Ga0265340_100114254 257
591 3300031344 Ga0265316_10095422 Ga0265316_100954222 257
592 3300031595 Ga0265313_10011988 Ga0265313_100119885 257
593 3300031911 Ga0307412_10336332 Ga0307412_103363321 257
594 3300035692 Ga0373935_0443529 Ga0373935_0443529_107_907 257
595 3300037068 Ga0373925_0199315 Ga0373925_0199315_527_1309 257
596 3300037853 Ga0436364_0645563 Ga0436364_0645563_163_948 257
597 3300039438 Ga0436360_0354685 Ga0436360_0354685_4420_5205 257
598 3300039447 Ga0436361_0124664 Ga0436361_0124664_128_913 257
599 3300039450 Ga0436363_0423875 Ga0436363_0423875_2441_3226 257
600 3300039450 Ga0436363_0934104 Ga0436363_0934104_382_1167 257
601 3300039453 Ga0436362_0439386 Ga0436362_0439386_35_820 257
602 3300044656 Ga0466969_0144838 Ga0466969_0144838_148_933 257
603 3300044693 Ga0466961_0088171 Ga0466961_0088171_139_924 257
604 3300045049 Ga0466959_0055041 Ga0466959_0055041_1456_2241 257
605 3300048914 Ga0496111_0040603 Ga0496111_0040603_372_1172 257
606 3300049568 Ga0501031_0024159 Ga0501031_0024159_2578_3351 257
607 3300049569 Ga0501032_0000546 Ga0501032_0000546_5093_5866 257
608 3300049570 Ga0501033_0000076 Ga0501033_0000076_86055_86828 257
609 3300049571 Ga0501034_0001507 Ga0501034_0001507_24664_25437 257
610 3300049572 Ga0501036_0001029 Ga0501036_0001029_15189_15962 257
611 3300049572 Ga0501036_0018683 Ga0501036_0018683_3017_3805 257
612 3300049573 Ga0501037_0000838 Ga0501037_0000838_17130_17903 257
613 3300049574 Ga0501038_0004571 Ga0501038_0004571_5139_5912 257
614 3300049575 Ga0501039_0002888 Ga0501039_0002888_6966_7739 257
615 3300049575 Ga0501039_0064179 Ga0501039_0064179_2005_2793 257
616 3300049576 Ga0501040_0031938 Ga0501040_0031938_2312_3100 257
617 3300049577 Ga0501041_0001547 Ga0501041_0001547_36_824 257
618 3300049578 Ga0501042_0007204 Ga0501042_0007204_5528_6316 257
619 3300049579 Ga0501043_0000043 Ga0501043_0000043_90778_91551 257
620 3300049580 Ga0501046_0012654 Ga0501046_0012654_1005_1793 257
621 3300049581 Ga0501047_0016124 Ga0501047_0016124_1832_2686 257
622 3300049582 Ga0501048_0030397 Ga0501048_0030397_853_1641 257
623 3300049584 Ga0501068_0028636 Ga0501068_0028636_1007_1861 257
624 3300049586 Ga0501070_0294990 Ga0501070_0294990_414_1268 257
625 3300049588 Ga0501072_0001322 Ga0501072_0001322_5613_6401 257
626 3300049592 Ga0501076_0002518 Ga0501076_0002518_6398_7186 257
627 3300049741 Ga0501079_0000593 Ga0501079_0000593_9157_9945 257
628 3300049742 Ga0501080_0056161 Ga0501080_0056161_2838_3626 257
629 3300049743 Ga0501081_0025160 Ga0501081_0025160_2325_3113 257
630 3300049822 Ga0501035_0000958 Ga0501035_0000958_5093_5866 257
631 3300049823 Ga0501044_0010596 Ga0501044_0010596_4155_4928 257
632 3300049823 Ga0501044_0062620 Ga0501044_0062620_1586_2440 257
633 3300049824 Ga0501045_0000080 Ga0501045_0000080_14278_15066 257
634 3300050509 nmdc:mga0qj67_41868_c1 nmdc:mga0qj67_41868_c1_774_1562 257
635 3300054114 Ga0501084_0008447 Ga0501084_0008447_2190_2978 257
636 3300060353 Ga0501082_0001982 Ga0501082_0001982_15116_15904 257
637 3300061734 Ga0530510_0006133 Ga0530510_0006133_2301_3089 257
638 iso_pu_bacteria 2837678835 2837679533 257
639 3300021377 Ga0213874_10068018 Ga0213874_100680181 258
640 3300021384 Ga0213876_10005904 Ga0213876_100059043 258
641 3300021384 Ga0213876_10017423 Ga0213876_100174234 258
642 3300021384 Ga0213876_10192721 Ga0213876_101927211 258
643 3300031235 Ga0265330_10025039 Ga0265330_100250392 258
644 3300031241 Ga0265325_10036069 Ga0265325_100360692 258
645 3300037853 Ga0436364_1243048 Ga0436364_1243048_1040_1828 258
646 3300039437 Ga0436365_0848884 Ga0436365_0848884_1795_2595 258
647 3300039437 Ga0436365_1034188 Ga0436365_1034188_23882_24664 258
648 3300039447 Ga0436361_0982947 Ga0436361_0982947_20_823 258
649 3300039450 Ga0436363_0134158 Ga0436363_0134158_787_1659 258
650 3300039450 Ga0436363_1600896 Ga0436363_1600896_138_926 258
651 3300049571 Ga0501034_0078128 Ga0501034_0078128_1276_2079 258
652 3300049581 Ga0501047_0058006 Ga0501047_0058006_1235_2038 258
653 3300049823 Ga0501044_0166694 Ga0501044_0166694_728_1597 258
654 3300053139 Ga0500568_0006856 Ga0500568_0006856_3335_4117 258
655 3300005354 Ga0070675_100312348 Ga0070675_1003123482 259
656 3300005356 Ga0070674_100375926 Ga0070674_1003759261 259
657 3300005545 Ga0070695_100187440 Ga0070695_1001874401 259
658 3300005842 Ga0068858_100069416 Ga0068858_1000694163 259
659 3300006847 Ga0075431_100122844 Ga0075431_1001228442 259
660 3300009093 Ga0105240_10463591 Ga0105240_104635912 259
661 3300009148 Ga0105243_10590104 Ga0105243_105901041 259
662 3300013297 Ga0157378_10233806 Ga0157378_102338062 259
663 3300013308 Ga0157375_10081147 Ga0157375_100811474 259
664 3300014969 Ga0157376_10090386 Ga0157376_100903862 259
665 3300025901 Ga0207688_10157615 Ga0207688_101576151 259
666 3300025926 Ga0207659_10384700 Ga0207659_103847002 259
667 3300025933 Ga0207706_10065284 Ga0207706_100652844 259
668 3300025972 Ga0207668_10151257 Ga0207668_101512572 259
669 3300026035 Ga0207703_10060350 Ga0207703_100603503 259
670 3300026118 Ga0207675_100404189 Ga0207675_1004041891 259
671 3300039447 Ga0436361_0205740 Ga0436361_0205740_3202_4005 259
672 3300039447 Ga0436361_0397425 Ga0436361_0397425_68_886 259
673 3300039453 Ga0436362_0015457 Ga0436362_0015457_1143_1949 259
674 3300039453 Ga0436362_0305268 Ga0436362_0305268_1172_1990 259
675 3300048904 Ga0496101_0016142 Ga0496101_0016142_899_1690 259
676 3300048907 Ga0496104_0006378 Ga0496104_0006378_7839_8630 259
677 3300048908 Ga0496105_0002986 Ga0496105_0002986_9905_10696 259
678 3300048909 Ga0496106_0191675 Ga0496106_0191675_257_1048 259
679 3300048911 Ga0496108_0073933 Ga0496108_0073933_80_871 259
680 3300049587 Ga0501071_0033969 Ga0501071_0033969_674_1489 259
681 3300049591 Ga0501075_0224390 Ga0501075_0224390_513_1328 259
682 3300049824 Ga0501045_0047109 Ga0501045_0047109_2160_2975 259
683 3300050511 nmdc:mga08y16_299903_c1 nmdc:mga08y16_299903_c1_753_1544 259
684 3300060353 Ga0501082_0096032 Ga0501082_0096032_1585_2400 259
685 3300061734 Ga0530510_0146643 Ga0530510_0146643_840_1631 259
686 iso_pu_bacteria 2884298095 2884299179 259
687 3300003762 Ga0055542_1017295 Ga0055542_10172951 260
688 3300003763 Ga0055529_1006290 Ga0055529_10062902 260
689 3300025254 Ga0209148_1000366 Ga0209148_10003665 260
690 3300025272 Ga0209455_1000738 Ga0209455_100073820 260
691 3300049571 Ga0501034_0196629 Ga0501034_0196629_654_1490 260
692 3300053077 Ga0495601_0007865 Ga0495601_0007865_3284_4090 260
693 3300053078 Ga0495612_0055227 Ga0495612_0055227_206_1012 260
694 3300053085 Ga0495619_0182362 Ga0495619_0182362_100_906 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

49

130

0.98

PF02754

CCG

Cysteine-rich domain

178

263

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.824 11 253
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.815 12 253
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7718 11 253
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7608 12 253
5xr8-assembly1.cif.gz_A crystal structure of the human cb1 in complex with agonist am841 0.6311 10 84
ID Description Score Start End Superfamily
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9689 143 226 3.40.30.10
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9441 14 92 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9364 143 226 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9265 143 227 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9239 14 92 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2T1HSQ9-F1-model_v4 Fe-S oxidoreductase 0.9974 24 258 GO:0005829
GO:0016491
AF-A0A849MZJ2-F1-model_v4 (Fe-S)-binding protein 0.9967 10 259 GO:0005829
GO:0016491
AF-A0A7W0XHE5-F1-model_v4 (Fe-S)-binding protein 0.9954 10 260 GO:0005829
GO:0016491
AF-B6IVC3-F1-model_v4 Cysteine-rich domain protein 0.9948 9 258 GO:0005829
GO:0016491
AF-J6J7J9-F1-model_v4 Putative L-lactate dehydrogenase 0.9936 10 258 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map