F475763

General Info

Members Datasets Scaffolds Average Seq Length
694 557 1388 274

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0009988|Ga0500637_0009988_1639_2601
Length 320
Sequence MPSPIDLLPPLREVIAKHDLLARKSLGQHFLCDLNLTRKIASLAGDLTDCTAFEIGPGPGGLTRALVETDAKKIIAIEKDRRCIAALKDVIEASEGRLEVIEGDALKIDLIPLARSLPLTRRADARHPLPPAGGEGTQEKPLALQSREREGPVAKQREGEGQYAVVANLPYNIGTELLLGWLETIDEYKSLTLMFQAEVADRLAAEPDSKTYGRLSVITQFCCDIERVLDIPARAFTPPPKVDSAVVHLTPRKNRPKDVSFKMMGRVTAAAFGQRRKMLRSSLKPLGGEELLKRAGIKPELRAENLSVADFENLARKFGM

Samples

Sample ID Description Type Environment
1 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
233 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
234 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
235 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
236 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
237 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
238 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
239 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
240 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
241 2512875024
242 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
243 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
244 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
245 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
246 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
247 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
248 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
249 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
250 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
251 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
252 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
253 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
254 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
255 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
256 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
257 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
258 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
259 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
260 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
261 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
262 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
263 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
264 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
265 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
266 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
267 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
268 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
269 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
270 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
271 2643221558 Rhizobium sp. Root149 Isolate Unclassified
272 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
273 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
274 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
275 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
276 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
277 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
278 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
279 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
280 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
281 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
282 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
283 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
284 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
285 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
286 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
287 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
288 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
289 2791355265 Rhizobium sp. H4 Isolate Nodule
290 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
291 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
292 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
293 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
294 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
295 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
296 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
297 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
298 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
299 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
300 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
301 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
302 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
303 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
304 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
305 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
306 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
307 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
308 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
309 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
310 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
311 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
312 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
313 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
314 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
315 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
316 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
317 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
318 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
319 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
320 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
321 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
322 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
323 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
324 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
325 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
326 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
327 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
328 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
329 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
330 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
331 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
332 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
333 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
334 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
335 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
336 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
337 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
338 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
339 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
340 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
341 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
342 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
343 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
344 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
345 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
346 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
347 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
348 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
349 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
350 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
351 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
352 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
353 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
354 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
355 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
356 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
357 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
358 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
359 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
360 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
361 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
362 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
363 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
364 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
365 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
366 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
367 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
368 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
369 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
370 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
371 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
372 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
373 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
374 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
375 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
376 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
377 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
378 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
379 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
380 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
381 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
382 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
383 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
384 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
385 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
386 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
387 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
388 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
389 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
390 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
391 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
392 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
393 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
394 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
395 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
396 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
397 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
398 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
399 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
400 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
401 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
402 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
403 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
404 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
405 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
406 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
407 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
408 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
409 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
410 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
411 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
412 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
413 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
414 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
415 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
416 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
417 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
418 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
419 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
420 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
421 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
422 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
423 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
424 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
425 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
426 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
427 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
428 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
429 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
430 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
431 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
432 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
433 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
434 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
435 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
436 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
437 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
438 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
439 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
440 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
441 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
442 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
443 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
444 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
445 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
446 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
447 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
448 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
449 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
450 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
451 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
452 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
453 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
454 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
455 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
456 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
457 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
458 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
459 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
460 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
461 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
462 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
463 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
464 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
465 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
466 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
467 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
468 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
469 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
470 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
471 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
472 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
473 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
474 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
475 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
476 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
477 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
478 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
479 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
480 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
481 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
482 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
483 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
484 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
485 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
486 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
487 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
488 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
489 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
490 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
491 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
492 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
493 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
494 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
495 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
496 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
497 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
498 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
499 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
500 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
501 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
502 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
503 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
504 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
505 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
506 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
507 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
508 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
509 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
510 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
511 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
512 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
513 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
514 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
515 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
516 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
517 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
518 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
519 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
520 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
521 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
522 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
523 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
524 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
525 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
526 3004167301 Mesorhizobium loti 582 Isolate Unclassified
527 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
528 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
529 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
530 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
531 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
532 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
533 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
534 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
535 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
536 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
537 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
538 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
539 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
540 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
541 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
542 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
543 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
544 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
545 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
546 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
547 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
548 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
549 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
550 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
551 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
552 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
553 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
554 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
555 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
556 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
557 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.74
Metatranscriptomes 0
Isolates 47.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 35.45
Rhizoplane 2.45
Rhizosphere 32.85
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500637_0009988 3300053178 Bacteria 4854
2 JGI24740J21852_10001214 3300001979 Bacteria 11651
3 JGI24740J21852_10004386 3300001979 Bacteria 6067
4 JGI24740J21852_10052704 3300001979 Bacteria 1157
5 JGI25155J39150_1000032 3300002704 Bacteria 105511
6 JGI25156J39149_1000129 3300002705 Bacteria 54812
7 JGI25162J39368_1000676 3300002737 Bacteria 23903
8 JGI25162J39368_1001230 3300002737 Bacteria 14797
9 JGI25154J39366_1000324 3300002738 Bacteria 27739
10 JGI25154J39366_1001340 3300002738 Bacteria 9024
11 JGI25157J39369_1000061 3300002741 Bacteria 105511
12 JGI25151J46595_10000192 3300003187 Bacteria 75239
13 JGI25406J46586_10006486 3300003203 Bacteria 5384
14 JGI25165J46597_1000028 3300003214 Bacteria 325146
15 JGI25165J46597_1001649 3300003214 Bacteria 10326
16 JGI25165J46597_1001657 3300003214 Bacteria 10216
17 JGI25153J46596_10016299 3300003215 Bacteria 2984
18 rootH1_10095545 3300003323 Bacteria 1152
19 Ga0055542_1001417 3300003762 Bacteria 12078
20 Ga0055536_1001177 3300003781 Bacteria 16274
21 Ga0055540_1001974 3300003792 Bacteria 11464
22 Ga0055531_10003014 3300003794 Bacteria 10927
23 Ga0058692_1001868 3300003856 Bacteria 7390
24 Ga0065165_1002531 3300005262 Bacteria 15197
25 Ga0070683_100183995 3300005329 Bacteria 1983
26 Ga0070670_100001700 3300005331 Bacteria 17910
27 Ga0070670_100080028 3300005331 Bacteria 2808
28 Ga0068869_100052973 3300005334 Bacteria 2948
29 Ga0070680_100172908 3300005336 Bacteria 1818
30 Ga0070660_100019894 3300005339 Bacteria 4925
31 Ga0070660_100474035 3300005339 Bacteria 1040
32 Ga0070661_100159659 3300005344 Bacteria 1707
33 Ga0070668_100008467 3300005347 Bacteria 7639
34 Ga0070669_100046389 3300005353 Bacteria 3169
35 Ga0070675_100093086 3300005354 Bacteria 2528
36 Ga0070674_100006650 3300005356 Bacteria 6760
37 Ga0070667_100023391 3300005367 Bacteria 5126
38 Ga0070681_10006925 3300005458 Bacteria 11038
39 Ga0070681_10007314 3300005458 Bacteria 10782
40 Ga0068867_100138010 3300005459 Bacteria 1903
41 Ga0068867_100181272 3300005459 Bacteria 1675
42 Ga0068853_100256899 3300005539 Bacteria 1605
43 Ga0068853_100314655 3300005539 Bacteria 1450
44 Ga0070672_100083788 3300005543 Bacteria 2559
45 Ga0070696_100057745 3300005546 Bacteria 2709
46 Ga0070665_100029356 3300005548 Bacteria 5536
47 Ga0068855_100029275 3300005563 Bacteria 6586
48 Ga0068855_100514237 3300005563 Bacteria 1300
49 Ga0068856_100241901 3300005614 Bacteria 1820
50 Ga0068856_100278244 3300005614 Bacteria 1690
51 Ga0068852_100065931 3300005616 Bacteria 3160
52 Ga0068852_100089570 3300005616 Bacteria 2750
53 Ga0068864_100101980 3300005618 Bacteria 2546
54 Ga0068861_100395306 3300005719 Bacteria 1225
55 Ga0068860_100035203 3300005843 Bacteria 4804
56 Ga0068862_100007560 3300005844 Bacteria 9007
57 Ga0068862_100026297 3300005844 Bacteria 4891
58 Ga0081539_10001131 3300005985 Bacteria 48406
59 Ga0075365_10005167 3300006038 Bacteria 7016
60 Ga0075368_10023034 3300006042 Bacteria 2375
61 Ga0075363_100022794 3300006048 Bacteria 3168
62 Ga0075363_100290793 3300006048 Bacteria 947
63 Ga0075364_10003667 3300006051 Bacteria 8756
64 Ga0075364_10025065 3300006051 Bacteria 3794
65 Ga0075364_10066637 3300006051 Bacteria 2365
66 Ga0075364_10238721 3300006051 Bacteria 1234
67 Ga0075367_10034225 3300006178 Bacteria 2933
68 Ga0075367_10051599 3300006178 Bacteria 2431
69 Ga0075367_10067879 3300006178 Bacteria 2138
70 Ga0075367_10110435 3300006178 Bacteria 1687
71 Ga0075369_10074628 3300006186 Bacteria 1496
72 Ga0075369_10175854 3300006186 Bacteria 984
73 Ga0075370_10025852 3300006353 Bacteria 3249
74 Ga0075370_10097326 3300006353 Bacteria 1701
75 Ga0075428_100416352 3300006844 Bacteria 1440
76 Ga0075430_100183521 3300006846 Bacteria 1740
77 Ga0075430_100185697 3300006846 Bacteria 1729
78 Ga0075431_100206251 3300006847 Bacteria 2009
79 Ga0075433_10252023 3300006852 Bacteria 1566
80 Ga0075429_100560990 3300006880 Bacteria 1001
81 Ga0079104_1000032 3300006946 Bacteria 203094
82 Ga0099826_10001725 3300006948 Bacteria 13474
83 Ga0105240_10000032 3300009093 Bacteria 283907
84 Ga0105240_10013259 3300009093 Bacteria 11335
85 Ga0105240_10142359 3300009093 Bacteria 2866
86 Ga0105240_10250849 3300009093 Bacteria 2047
87 Ga0111539_10119641 3300009094 Bacteria 3086
88 Ga0114129_10312268 3300009147 Unclassified 2092
89 Ga0105241_10093597 3300009174 Bacteria 2375
90 Ga0105241_10476011 3300009174 Bacteria 1109
91 Ga0105242_10546590 3300009176 Bacteria 1110
92 Ga0105248_10360355 3300009177 Bacteria 1637
93 Ga0105237_10000754 3300009545 Bacteria 44371
94 Ga0105237_10697015 3300009545 Bacteria 1022
95 Ga0105238_10321139 3300009551 Bacteria 1534
96 Ga0105238_10553860 3300009551 Bacteria 1154
97 Ga0105249_10212467 3300009553 Bacteria 1899
98 Ga0105239_10058313 3300010375 Bacteria 4236
99 Ga0105239_10067623 3300010375 Bacteria 3925
100 Ga0105239_10199662 3300010375 Bacteria 2240
101 Ga0105239_10393531 3300010375 Bacteria 1568
102 Ga0105239_10554858 3300010375 Bacteria 1308
103 Ga0157373_10012663 3300013100 Bacteria 6202
104 Ga0157371_10017171 3300013102 Bacteria 5381
105 Ga0157370_10000972 3300013104 Bacteria 36292
106 Ga0157370_10068924 3300013104 Bacteria 3342
107 Ga0157370_10425196 3300013104 Bacteria 1222
108 Ga0157369_10057945 3300013105 Bacteria 4179
109 Ga0157374_10226926 3300013296 Bacteria 1834
110 Ga0157372_10220544 3300013307 Bacteria 2198
111 Ga0182008_10029256 3300014497 Bacteria 2784
112 Ga0182007_10019077 3300015262 Bacteria 2472
113 Ga0182005_1005393 3300015265 Bacteria 3999
114 Ga0213872_10000693 3300021361 Bacteria 25305
115 Ga0213872_10008428 3300021361 Bacteria 4991
116 Ga0213874_10029116 3300021377 Bacteria 1583
117 Ga0213876_10000134 3300021384 Bacteria 80875
118 Ga0209435_100042 3300025206 Bacteria 105563
119 Ga0209437_100033 3300025233 Bacteria 512520
120 Ga0209437_100075 3300025233 Bacteria 297202
121 Ga0209437_107205 3300025233 Bacteria 1821
122 Ga0209646_1000145 3300025246 Bacteria 105563
123 Ga0209026_1000120 3300025250 Bacteria 130091
124 Ga0209026_1000160 3300025250 Bacteria 105563
125 Ga0209677_101323 3300025253 Bacteria 10926
126 Ga0209148_1000056 3300025254 Bacteria 363380
127 Ga0209759_1000177 3300025256 Bacteria 105563
128 Ga0209759_1000368 3300025256 Bacteria 56484
129 Ga0209233_1000056 3300025261 Bacteria 438104
130 Ga0209233_1000064 3300025261 Bacteria 392156
131 Ga0209233_1000087 3300025261 Bacteria 325225
132 Ga0209233_1000209 3300025261 Bacteria 115124
133 Ga0209233_1009458 3300025261 Bacteria 2964
134 Ga0209455_1000137 3300025272 Bacteria 142099
135 Ga0209676_1002466 3300025292 Bacteria 13070
136 Ga0209025_1000077 3300025294 Bacteria 271958
137 Ga0209758_1000554 3300025297 Bacteria 59218
138 Ga0209758_1003923 3300025297 Bacteria 12985
139 Ga0209758_1004764 3300025297 Bacteria 11008
140 Ga0209050_1010473 3300025298 Bacteria 4564
141 Ga0209051_1000459 3300025303 Bacteria 53735
142 Ga0209257_1002585 3300025304 Bacteria 17600
143 Ga0207707_10010344 3300025912 Bacteria 8095
144 Ga0207707_10028728 3300025912 Bacteria 4859
145 Ga0207695_10000024 3300025913 Bacteria 632311
146 Ga0207695_10003143 3300025913 Bacteria 23591
147 Ga0207695_10015043 3300025913 Bacteria 9131
148 Ga0207671_10000718 3300025914 Bacteria 42274
149 Ga0207671_10064787 3300025914 Bacteria 2717
150 Ga0207660_10077156 3300025917 Bacteria 2438
151 Ga0207660_10110648 3300025917 Bacteria 2067
152 Ga0207657_10090293 3300025919 Bacteria 2557
153 Ga0207681_10140543 3300025923 Bacteria 1797
154 Ga0207650_10025936 3300025925 Bacteria 4178
155 Ga0207659_10044372 3300025926 Bacteria 3128
156 Ga0207711_10262745 3300025941 Bacteria 1587
157 Ga0207689_10065924 3300025942 Bacteria 2978
158 Ga0207667_10020984 3300025949 Bacteria 7245
159 Ga0207667_10222472 3300025949 Bacteria 1934
160 Ga0207712_10059712 3300025961 Bacteria 2700
161 Ga0207668_10001888 3300025972 Bacteria 12260
162 Ga0207640_10043430 3300025981 Bacteria 2873
163 Ga0207658_10016989 3300025986 Bacteria 5008
164 Ga0207639_10092724 3300026041 Bacteria 2421
165 Ga0207639_10387256 3300026041 Bacteria 1257
166 Ga0207702_10145723 3300026078 Bacteria 2149
167 Ga0207648_10079288 3300026089 Bacteria 2864
168 Ga0207648_10083342 3300026089 Bacteria 2789
169 Ga0207648_10092376 3300026089 Bacteria 2646
170 Ga0209281_1000053 3300027111 Bacteria 309587
171 Ga0209371_1001029 3300027312 Bacteria 21140
172 Ga0209282_1000102 3300027666 Bacteria 57412
173 Ga0209813_10028846 3300027866 Bacteria 1621
174 Ga0207428_10142070 3300027907 Bacteria 1831
175 Ga0268266_10044390 3300028379 Bacteria 3800
176 Ga0268266_10241232 3300028379 Bacteria 1668
177 Ga0268266_10246104 3300028379 Bacteria 1652
178 Ga0268265_10048603 3300028380 Bacteria 3185
179 Ga0268264_10021248 3300028381 Bacteria 5303
180 Ga0307515_10000070 3300028794 Bacteria 239322
181 Ga0265338_10030725 3300028800 Bacteria 5282
182 Ga0268256_1001309 3300030500 Bacteria 15327
183 Ga0265331_10002627 3300031250 Bacteria 12061
184 Ga0265331_10028764 3300031250 Bacteria 2778
185 Ga0265327_10000190 3300031251 Bacteria 130086
186 Ga0265316_10027899 3300031344 Bacteria 4667
187 Ga0265316_10057177 3300031344 Bacteria 3043
188 Ga0307513_10008189 3300031456 Bacteria 13404
189 Ga0307516_10000004 3300031730 Bacteria 367451
190 Ga0307413_10128578 3300031824 Bacteria 1730
191 Ga0307410_10120870 3300031852 Bacteria 1910
192 Ga0307407_10194377 3300031903 Bacteria 1355
193 Ga0307416_100227722 3300032002 Bacteria 1794
194 Ga0395899_0000213 3300037312 Bacteria 83403
195 Ga0395899_0141708 3300037312 Bacteria 1710
196 Ga0395899_0511327 3300037312 Bacteria 778
197 Ga0395900_0000121 3300037418 Bacteria 135026
198 Ga0395900_0011881 3300037418 Bacteria 8903
199 Ga0395900_0217756 3300037418 Bacteria 1926
200 Ga0395900_0246857 3300037418 Bacteria 1788
201 Ga0395900_0280327 3300037418 Bacteria 1659
202 Ga0395898_0000247 3300037466 Bacteria 135026
203 Ga0395898_0085187 3300037466 Bacteria 3046
204 Ga0395898_0603117 3300037466 Bacteria 1041
205 Ga0395905_0000112 3300037471 Bacteria 135010
206 Ga0395905_0018071 3300037471 Bacteria 6694
207 Ga0395905_0055874 3300037471 Bacteria 3695
208 Ga0436364_1313619 3300037853 Bacteria 1395
209 Ga0395901_0000078 3300038443 Bacteria 135026
210 Ga0395901_0007884 3300038443 Bacteria 10743
211 Ga0395901_0030144 3300038443 Bacteria 5588
212 Ga0395901_0064543 3300038443 Bacteria 3812
213 Ga0400483_138427 3300039062 Bacteria 1445
214 Ga0400483_157157 3300039062 Bacteria 2691
215 Ga0400483_178012 3300039062 Bacteria 2457
216 Ga0436365_0881464 3300039437 Bacteria 1800
217 Ga0436365_1830840 3300039437 Bacteria 45078
218 Ga0436361_0187236 3300039447 Bacteria 14656
219 Ga0436361_0206950 3300039447 Bacteria 229672
220 Ga0436363_1297661 3300039450 Bacteria 5607
221 Ga0451855_1869378 3300041511 Bacteria 973
222 Ga0466972_0168153 3300044658 Bacteria 1029
223 Ga0453684_0061971 3300044712 Bacteria 4795
224 Ga0466968_0060343 3300044735 Bacteria 1635
225 Ga0466960_0114492 3300044901 Bacteria 1405
226 Ga0451576_0002273 3300045051 Bacteria 29322
227 Ga0495638_0002756 3300046460 Bacteria 14121
228 Ga0495607_0102276 3300046501 Bacteria 1533
229 Ga0495607_0105419 3300046501 Bacteria 1503
230 Ga0495583_0004487 3300046506 Bacteria 9971
231 Ga0495606_0011595 3300046507 Bacteria 7167
232 Ga0495606_0076436 3300046507 Bacteria 2093
233 Ga0495610_0021290 3300046512 Bacteria 3570
234 Ga0495637_0066954 3300046520 Bacteria 1459
235 Ga0495643_0048138 3300046522 Bacteria 2306
236 Ga0495648_0165350 3300046524 Bacteria 1139
237 Ga0495654_0000092 3300046530 Bacteria 101504
238 Ga0495597_0032202 3300046542 Bacteria 2380
239 Ga0495633_0009132 3300046558 Bacteria 5504
240 Ga0495633_0126357 3300046558 Bacteria 1183
241 Ga0495656_0161522 3300046615 Bacteria 1089
242 Ga0495668_0046834 3300046616 Bacteria 2402
243 Ga0495625_0051172 3300046660 Bacteria 2962
244 Ga0495669_0000001 3300046684 Bacteria 291866
245 Ga0495613_0000964 3300046689 Bacteria 22013
246 Ga0495670_0203564 3300046691 Bacteria 1049
247 Ga0495660_0067953 3300046810 Bacteria 1897
248 Ga0495673_0137288 3300047469 Bacteria 956
249 Ga0496102_0020221 3300048905 Bacteria 5881
250 Ga0496107_0173742 3300048910 Bacteria 1599
251 Ga0496110_0370540 3300048913 Bacteria 1305
252 Ga0496111_0000236 3300048914 Bacteria 26454
253 Ga0496111_0431528 3300048914 Bacteria 973
254 Ga0496112_0010289 3300048915 Bacteria 8481
255 Ga0496113_0090953 3300048916 Bacteria 2352
256 Ga0496116_0000036 3300048919 Bacteria 388508
257 Ga0496116_0000123 3300048919 Bacteria 161733
258 Ga0496116_0055212 3300048919 Bacteria 2610
259 Ga0496117_0005581 3300048920 Bacteria 13162
260 Ga0496117_0013040 3300048920 Bacteria 7276
261 Ga0496118_0002790 3300048921 Bacteria 22870
262 Ga0496118_0003518 3300048921 Bacteria 19619
263 Ga0496118_0013692 3300048921 Bacteria 7654
264 Ga0496118_0052275 3300048921 Bacteria 3118
265 Ga0496119_0000208 3300048922 Bacteria 83742
266 Ga0496119_0018528 3300048922 Bacteria 5175
267 Ga0496119_0030665 3300048922 Bacteria 3620
268 Ga0496120_0000781 3300048923 Bacteria 46067
269 Ga0496121_0001948 3300048924 Bacteria 32895
270 Ga0496121_0004987 3300048924 Bacteria 17381
271 Ga0496121_0096399 3300048924 Bacteria 2295
272 Ga0496121_0340326 3300048924 Bacteria 1003
273 Ga0496122_0000160 3300048925 Bacteria 159236
274 Ga0496122_0004196 3300048925 Bacteria 18127
275 Ga0496122_0006797 3300048925 Bacteria 12992
276 Ga0496122_0019960 3300048925 Bacteria 6092
277 Ga0496122_0030419 3300048925 Bacteria 4523
278 Ga0496122_0041368 3300048925 Bacteria 3645
279 Ga0496122_0078027 3300048925 Bacteria 2322
280 Ga0496123_0000034 3300048926 Bacteria 274836
281 Ga0496123_0004429 3300048926 Bacteria 14773
282 Ga0496123_0009397 3300048926 Bacteria 8809
283 Ga0496124_0000349 3300048927 Bacteria 84498
284 Ga0496124_0006016 3300048927 Bacteria 13378
285 Ga0496124_0008594 3300048927 Bacteria 10654
286 Ga0496124_0037757 3300048927 Bacteria 4198
287 Ga0496124_0072319 3300048927 Bacteria 2856
288 Ga0496124_0282378 3300048927 Bacteria 1209
289 Ga0496124_0316671 3300048927 Bacteria 1119
290 Ga0496125_0025328 3300048928 Bacteria 5435
291 Ga0496126_0000156 3300048929 Bacteria 158537
292 Ga0496126_0036343 3300048929 Bacteria 4606
293 Ga0496126_0233016 3300048929 Bacteria 1542
294 Ga0496126_0253397 3300048929 Bacteria 1466
295 Ga0496126_0403878 3300048929 Bacteria 1107
296 Ga0501031_0002553 3300049568 Bacteria 11599
297 Ga0501032_0000025 3300049569 Bacteria 138521
298 Ga0501032_0206680 3300049569 Bacteria 1281
299 Ga0501033_0000229 3300049570 Bacteria 54036
300 Ga0501033_0000742 3300049570 Bacteria 29975
301 Ga0501033_0330678 3300049570 Bacteria 1069
302 Ga0501034_0000189 3300049571 Bacteria 115780
303 Ga0501034_0001654 3300049571 Bacteria 28764
304 Ga0501034_0024556 3300049571 Bacteria 6131
305 Ga0501034_0150335 3300049571 Bacteria 2305
306 Ga0501034_0435433 3300049571 Bacteria 1230
307 Ga0501036_0001402 3300049572 Bacteria 18518
308 Ga0501037_0000176 3300049573 Bacteria 60011
309 Ga0501038_0000862 3300049574 Bacteria 26891
310 Ga0501039_0000003 3300049575 Bacteria 357424
311 Ga0501043_0000051 3300049579 Bacteria 106957
312 Ga0501043_0168340 3300049579 Bacteria 1710
313 Ga0501043_0185702 3300049579 Bacteria 1619
314 Ga0501046_0042431 3300049580 Bacteria 3628
315 Ga0501047_0018334 3300049581 Bacteria 6708
316 Ga0501047_0025612 3300049581 Bacteria 5671
317 Ga0501047_0029991 3300049581 Bacteria 5244
318 Ga0501047_0050464 3300049581 Bacteria 4018
319 Ga0501047_0180447 3300049581 Bacteria 1978
320 Ga0501067_0168292 3300049583 Bacteria 1221
321 Ga0501071_0144515 3300049587 Bacteria 1773
322 Ga0501072_0133088 3300049588 Bacteria 1983
323 Ga0501080_0011665 3300049742 Bacteria 8049
324 Ga0501083_0016175 3300049744 Bacteria 5223
325 Ga0501035_0000102 3300049822 Bacteria 106915
326 Ga0501035_0000950 3300049822 Bacteria 30620
327 Ga0501044_0020712 3300049823 Bacteria 7019
328 Ga0501044_0105376 3300049823 Bacteria 2832
329 Ga0501044_0282309 3300049823 Bacteria 1594
330 nmdc:mga03n38_106237_c1 3300050490 Bacteria 1361
331 nmdc:mga00v17_206289_c1 3300050491 Bacteria 1271
332 nmdc:mga00v17_21259_c1 3300050491 Bacteria 3729
333 nmdc:mga00v17_261276_c1 3300050491 Bacteria 1123
334 nmdc:mga00v17_556_c1 3300050491 Bacteria 20858
335 nmdc:mga0yw44_19023_c1 3300050492 Bacteria 3778
336 nmdc:mga0yw44_26440_c1 3300050492 Bacteria 3315
337 nmdc:mga0k408_49705_c1 3300050493 Bacteria 2427
338 nmdc:mga06z11_24472_c1 3300050494 Bacteria 2849
339 nmdc:mga07m45_24675_c1 3300050496 Bacteria 3295
340 nmdc:mga05p37_100388_c1 3300050507 Bacteria 3564
341 nmdc:mga09592_564724_c1 3300050508 Bacteria 977
342 nmdc:mga0qj67_84686_c1 3300050509 Bacteria 2542
343 nmdc:mga08y16_62367_c1 3300050511 Bacteria 3893
344 nmdc:mga0n895_8900_c1 3300050512 Bacteria 8746
345 nmdc:mga0a205_336780_c1 3300050515 Bacteria 1378
346 Ga0495655_0018261 3300053083 Bacteria 1539
347 Ga0500643_021878 3300053087 Bacteria 2068
348 Ga0500562_000800 3300053108 Bacteria 7686
349 Ga0500572_001733 3300053111 Bacteria 5661
350 Ga0500595_004093 3300053119 Bacteria 6617
351 Ga0500607_159938 3300053121 Bacteria 1031
352 Ga0500608_067653 3300053122 Bacteria 1702
353 Ga0500618_000227 3300053125 Bacteria 44231
354 Ga0500618_007584 3300053125 Bacteria 3082
355 Ga0500652_006919 3300053131 Bacteria 3681
356 Ga0500573_0001776 3300053140 Bacteria 10485
357 Ga0500573_0012488 3300053140 Bacteria 4770
358 Ga0500616_0001544 3300053153 Bacteria 21664
359 Ga0500616_0006086 3300053153 Bacteria 7991
360 Ga0500620_000690 3300053155 Bacteria 5782
361 Ga0500627_0163785 3300053158 Bacteria 1003
362 Ga0500633_0075135 3300053160 Bacteria 1214
363 Ga0500634_0000112 3300053161 Bacteria 30260
364 Ga0500634_0068617 3300053161 Bacteria 1862
365 Ga0500636_0067626 3300053177 Bacteria 2075
366 Ga0501082_0000811 3300060353 Bacteria 27462
367 2503203294 2503198000 Bacteria 6884444
368 2509116056 2508501123 Bacteria 6283661
369 2509141470 2508501127 Bacteria 7037543
370 2509371832 2509276018 Bacteria 6910194
371 2509397725 2509276022 Bacteria 6200534
372 2510318981 2510065059 Bacteria 6847884
373 2510839677 2510461069 Bacteria 5505000
374 2511174517 2510917026 Bacteria 7046020
375 2512929817 2512875016 Bacteria 6529530
376 2512964586 2512875024 Bacteria 7195110
377 2513590219 2513237087 Bacteria 5817514
378 2513609081 2513237090 Bacteria 7096802
379 2514033300 2513237164 Bacteria 7563725
380 2514420483 2513237305 Bacteria 7293571
381 2514588177 2513237351 Bacteria 6968952
382 2523102558 2522572158 Bacteria 6514390
383 2585231481 2582581299 Bacteria 6518058
384 2585278917 2582581308 Bacteria 7413247
385 2585325469 2582581315 Bacteria 7318924
386 2585329626 2582581316 Bacteria 7774528
387 2585530714 2585427527 Bacteria 7273426
388 2585554894 2585427530 Bacteria 7383882
389 2585995130 2585427633 Bacteria 6413184
390 2585999677 2585427634 Bacteria 6455027
391 2588515409 2588253730 Bacteria 6881675
392 2597815013 2597489875 Bacteria 7010078
393 2599106086 2597490356 Bacteria 7030811
394 2599333754 2599185156 Bacteria 5403036
395 2599602583 2599185210 Bacteria 5624189
396 2599722027 2599185236 Bacteria 6875203
397 2599937998 2599185301 Bacteria 6161860
398 2600375279 2600254933 Bacteria 4750527
399 2601608664 2600255279 Bacteria 5605316
400 2601745438 2600255308 Bacteria 5611129
401 2616305810 2615840626 Bacteria 7921970
402 2616553948 2615840698 Bacteria 7319877
403 2643773604 2643221550 Bacteria 4619371
404 2643775444 2643221551 Bacteria 3750538
405 2643793890 2643221555 Bacteria 3749717
406 2643809994 2643221558 Bacteria 5460675
407 2643837779 2643221564 Bacteria 4193379
408 2643985341 2643221595 Bacteria 6565519
409 2644155023 2643221627 Bacteria 6761570
410 2644196528 2643221634 Bacteria 6705461
411 2644242896 2643221643 Bacteria 5749658
412 2671115297 2667528174 Bacteria 6435400
413 2671692764 2671180139 Bacteria 4196045
414 2688600132 2687453392 Bacteria 6880454
415 2694633679 2693429783 Bacteria 7019804
416 2694639982 2693429784 Bacteria 7241525
417 2723577412 2721755686 Bacteria 7343952
418 2738946530 2738541317 Bacteria 5340176
419 2756673305 2756170246 Bacteria 7451806
420 2765465211 2765235802 Bacteria 5618596
421 2770197357 2767802442 Bacteria 5747986
422 2776912788 2775507049 Bacteria 6284736
423 2792749115 2791355123 Bacteria 8049106
424 2793353582 2791355265 Bacteria 6539969
425 2819639239 2818991453 Bacteria 7181617
426 2819684102 2818991461 Bacteria 7026071
427 2821124297 2821123053 Bacteria 7836056
428 2821449371 2821443989 Bacteria 7658172
429 2837681212 2837678835 Bacteria 5252418
430 2838031436 2838029111 Bacteria 6603031
431 2838741210 2838736955 Bacteria 5760694
432 2841741125 2841734538 Bacteria 6784580
433 2841844893 2841840854 Bacteria 5761912
434 2842144615 2842140634 Bacteria 5759631
435 2842333655 2842333319 Bacteria 8899485
436 2842477969 2842475841 Bacteria 6603183
437 2842482863 2842482326 Bacteria 7212537
438 2842504778 2842502639 Bacteria 6604161
439 2842509738 2842509118 Bacteria 6850950
440 2842924808 2842922631 Bacteria 5824079
441 2844005766 2844002411 Bacteria 7168230
442 2844015444 2844009547 Bacteria 6728125
443 2844533647 2844533157 Bacteria 7517899
444 2846955880 2846952575 Bacteria 6587527
445 2847671814 2847670302 Bacteria 6165597
446 2847688045 2847686936 Bacteria 6278406
447 2848862299 2848858292 Bacteria 7391279
448 2854683558 2854681122 Bacteria 4548679
449 2854897195 2854896431 Bacteria 5869725
450 2854918185 2854916844 Bacteria 5725939
451 2856318456 2856314179 Bacteria 6477897
452 2856324408 2856320880 Bacteria 7263508
453 2856333387 2856328259 Bacteria 6528202
454 2856335712 2856334872 Bacteria 7037011
455 2856345456 2856342000 Bacteria 7176905
456 2856350409 2856349417 Bacteria 6230045
457 2856362074 2856356410 Bacteria 6297484
458 2856364609 2856364286 Bacteria 6939991
459 2857355865 2857349434 Bacteria 7926032
460 2857375518 2857367948 Bacteria 6965560
461 2857531877 2857531043 Bacteria 6754041
462 2869165012 2869162929 Bacteria 6399702
463 2869175763 2869169390 Bacteria 6659796
464 2869240244 2869234852 Bacteria 6654993
465 2869248585 2869242130 Bacteria 6609239
466 2869256484 2869249662 Bacteria 6868783
467 2869260184 2869256925 Bacteria 6981691
468 2869264435 2869264136 Bacteria 6880765
469 2869276513 2869271264 Bacteria 6908218
470 2869281594 2869278585 Bacteria 7077053
471 2869292718 2869285874 Bacteria 6901219
472 2871429531 2871429161 Bacteria 6547891
473 2871456680 2871451962 Bacteria 7336357
474 2871462212 2871459585 Bacteria 6866887
475 2871470002 2871466892 Bacteria 6923287
476 2871478512 2871474448 Bacteria 6806570
477 2871488446 2871481445 Bacteria 6700002
478 2871493934 2871488783 Bacteria 6929816
479 2871498448 2871495908 Bacteria 6935695
480 2874103817 2874102143 Bacteria 6342645
481 2874111271 2874109183 Bacteria 6517025
482 2874120114 2874116593 Bacteria 6674494
483 2874127563 2874123672 Bacteria 7238285
484 2874132698 2874131515 Bacteria 6820270
485 2874140742 2874139085 Bacteria 7021506
486 2874146994 2874146452 Bacteria 7533118
487 2874157026 2874155637 Bacteria 6724144
488 2874163468 2874162495 Bacteria 6174670
489 2874175451 2874168670 Bacteria 8062617
490 2876366620 2876363079 Bacteria 6544991
491 2876372266 2876369609 Bacteria 6807521
492 2876379667 2876377896 Bacteria 6565995
493 2876388113 2876386047 Bacteria 6698674
494 2876399477 2876392853 Bacteria 6660880
495 2876406245 2876399893 Bacteria 6927900
496 2876411932 2876406927 Bacteria 6191900
497 2876414465 2876413966 Bacteria 6831344
498 2876424469 2876420981 Bacteria 6687741
499 2878037792 2878035449 Bacteria 6555736
500 2878742523 2878738818 Bacteria 7136951
501 2878746297 2878745973 Bacteria 6867388
502 2878756510 2878753008 Bacteria 6922523
503 2878762667 2878760144 Bacteria 6823465
504 2878769633 2878767105 Bacteria 6898628
505 2878775917 2878774303 Bacteria 6108671
506 2878783626 2878781027 Bacteria 6834456
507 2878793530 2878788777 Bacteria 6567085
508 2881153654 2881147464 Bacteria 7779814
509 2881157451 2881155292 Bacteria 6461656
510 2881162809 2881161766 Bacteria 7127907
511 2881847017 2881845957 Bacteria 6611900
512 2881857060 2881853255 Bacteria 6698367
513 2881867287 2881861095 Bacteria 7128710
514 2882634377 2882632389 Bacteria 8154593
515 2882915271 2882912400 Bacteria 6801539
516 2885311559 2885305155 Bacteria 7348390
517 2885316396 2885312484 Bacteria 6415165
518 2885321161 2885318864 Bacteria 6729568
519 2885327065 2885326080 Bacteria 7134805
520 2885349999 2885342637 Bacteria 7011821
521 2885356052 2885350715 Bacteria 6787678
522 2888341306 2888337043 Bacteria 6629336
523 2888348490 2888343758 Bacteria 6611049
524 2889012970 2889010040 Bacteria 6749192
525 2889022162 2889016732 Bacteria 6700763
526 2891051624 2891048133 Bacteria 4447501
527 2899261802 2899259804 Bacteria 3320927
528 2899803788 2899803654 Bacteria 5577784
529 2903452796 2903448605 Bacteria 7357801
530 2903500639 2903492973 Bacteria 13473544
531 2903502562 2903492973 Bacteria 13473544
532 2903518240 2903513507 Bacteria 6344008
533 2903524487 2903521522 Bacteria 6525694
534 2903530118 2903528002 Bacteria 6586099
535 2903543246 2903540706 Bacteria 7062119
536 2904581381 2904578770 Bacteria 5302906
537 2904666004 2904659560 Bacteria 6685615
538 2906308430 2906308376 Bacteria 6841989
539 2906321978 2906321335 Bacteria 6579571
540 2906331212 2906328253 Bacteria 6585166
541 2906355772 2906354277 Bacteria 6991324
542 2906375479 2906370794 Bacteria 6881062
543 2906386883 2906386501 Bacteria 5977019
544 2906411685 2906408224 Bacteria 6162342
545 2906418493 2906414383 Bacteria 6580790
546 2913310947 2913308742 Bacteria 5350706
547 2919122617 2919119836 Bacteria 5208557
548 2919167379 2919166419 Bacteria 4952238
549 2919171408 2919171160 Bacteria 6499771
550 2919409318 2919408235 Bacteria 6149349
551 2922137674 2922130491 Bacteria 7173936
552 2922154110 2922151315 Bacteria 6902399
553 2922165445 2922158528 Bacteria 6573167
554 2922176873 2922172374 Bacteria 6167644
555 2922193034 2922185730 Bacteria 7113964
556 2924735385 2924733363 Bacteria 7574837
557 2924743055 2924741084 Bacteria 6661321
558 2924751453 2924748358 Bacteria 6154725
559 2924756390 2924754689 Bacteria 6774424
560 2924764629 2924762789 Bacteria 6561353
561 2924780323 2924776078 Bacteria 7492003
562 2924788095 2924784321 Bacteria 7416538
563 2933595079 2933594066 Bacteria 5594265
564 2937814357 2937813078 Bacteria 7783518
565 2937829281 2937822353 Bacteria 7290551
566 2937840500 2937836603 Bacteria 6811263
567 2937852405 2937848649 Bacteria 6983481
568 2937862744 2937861824 Bacteria 6660327
569 2937882845 2937877337 Bacteria 7246526
570 2937891484 2937891427 Bacteria 6357007
571 2937973182 2937972304 Bacteria 7532020
572 2937986440 2937980651 Bacteria 6517427
573 2937997095 2937994558 Bacteria 7036190
574 2938015505 2938014810 Bacteria 6700592
575 2958037555 2958034702 Bacteria 6989922
576 2958046732 2958041894 Bacteria 13082850
577 2958047266 2958041894 Bacteria 13082850
578 2958068678 2958064165 Bacteria 7158582
579 2958071375 2958071322 Bacteria 6815895
580 2958089970 2958084443 Bacteria 7312792
581 2958105461 2958100919 Bacteria 6800575
582 2958112382 2958108152 Bacteria 6681128
583 2958116990 2958115193 Bacteria 6923548
584 2958126408 2958122699 Bacteria 7280457
585 2958137389 2958130278 Bacteria 6897202
586 2958148992 2958144490 Bacteria 6677056
587 2958167565 2958165035 Bacteria 6906348
588 2958177389 2958172287 Bacteria 6716688
589 2958180234 2958179912 Bacteria 6874908
590 2961078066 2961077736 Bacteria 7079850
591 2961121348 2961114664 Bacteria 6680456
592 2961135143 2961127735 Bacteria 7196641
593 2961143484 2961136820 Bacteria 6775228
594 2961166037 2961163497 Bacteria 6901077
595 2961172799 2961170736 Bacteria 7072258
596 2961190646 2961183825 Bacteria 6688536
597 2963649414 2963644680 Bacteria 6530403
598 2965020856 2965018300 Bacteria 6883036
599 2965030659 2965025482 Bacteria 6532201
600 2965046029 2965040258 Bacteria 6855979
601 2965053313 2965047637 Bacteria 6623551
602 2965062816 2965062239 Bacteria 7412989
603 2965095116 2965089291 Bacteria 6866420
604 2965107272 2965102966 Bacteria 6800987
605 2965120111 2965119406 Bacteria 6956431
606 2967998011 2967996073 Bacteria 6787468
607 2968008662 2968003550 Bacteria 6929263
608 2968019611 2968016561 Bacteria 7022047
609 2968084577 2968083720 Bacteria 7351627
610 2968096905 2968091066 Bacteria 6052692
611 2968102384 2968097103 Bacteria 6107094
612 2968117501 2968110612 Bacteria 6814636
613 2968118284 2968117919 Bacteria 6536078
614 2968131096 2968128360 Bacteria 6270294
615 2968146102 2968138860 Bacteria 6605449
616 2968174434 2968171901 Bacteria 6894245
617 2970472932 2970469710 Bacteria 6969209
618 2970492078 2970489779 Bacteria 6517260
619 2970505393 2970503327 Bacteria 7099517
620 2970512514 2970510686 Bacteria 7006402
621 2970529707 2970524798 Bacteria 6840927
622 2970535252 2970532167 Bacteria 6553173
623 2970545087 2970540015 Bacteria 6977556
624 2970551110 2970547951 Bacteria 6931819
625 2970557525 2970554993 Bacteria 6814252
626 2970596197 2970593180 Bacteria 7073582
627 2970624992 2970619444 Bacteria 6986144
628 2970627372 2970627176 Bacteria 6680862
629 2977825691 2977821940 Bacteria 6906439
630 2977832260 2977828996 Bacteria 7007971
631 2977844864 2977843712 Bacteria 6753583
632 2977862824 2977858184 Bacteria 6215359
633 2977869569 2977864932 Bacteria 7534097
634 2977873749 2977872689 Bacteria 7270173
635 2977914993 2977907340 Bacteria 6577984
636 2977915314 2977915119 Bacteria 6829656
637 2977927225 2977922695 Bacteria 6956781
638 2977937007 2977935797 Bacteria 6252826
639 2977943844 2977942078 Bacteria 7570577
640 2977954377 2977950692 Bacteria 6893264
641 2977960054 2977957713 Bacteria 6877875
642 2977972511 2977971508 Bacteria 7472917
643 2977989923 2977986579 Bacteria 6581278
644 2979751392 2979742915 Bacteria 7301278
645 2979770064 2979764755 Bacteria 6610066
646 2979779447 2979772303 Bacteria 6618277
647 2979785945 2979779861 Bacteria 6219781
648 2979794270 2979793036 Bacteria 6808957
649 2979810114 2979808191 Bacteria 7179355
650 2987639679 2987636660 Bacteria 8088555
651 2987648775 2987645492 Bacteria 6117018
652 2987658667 2987652177 Bacteria 6969023
653 2987662044 2987659509 Bacteria 6966464
654 2987667433 2987666974 Bacteria 6509233
655 2987674016 2987673487 Bacteria 6884027
656 2995393784 2995392953 Bacteria 4539380
657 2996313323 2996310559 Bacteria 6357320
658 2996342532 2996341866 Bacteria 6643098
659 2996351948 2996348954 Bacteria 7239054
660 2996392344 2996386984 Bacteria 6978667
661 3000018631 3000017691 Bacteria 3772574
662 3000141853 3000135777 Bacteria 6891109
663 3004170901 3004167301 Bacteria 8330599
664 3004191095 3004188549 Bacteria 6952365
665 3004199916 3004195979 Bacteria 6776956
666 3004207252 3004203850 Bacteria 7307914
667 3004214644 3004211236 Bacteria 7417683
668 3004219327 3004218560 Bacteria 7421728
669 3004238116 3004232784 Bacteria 6662140
670 3004240345 3004239961 Bacteria 6892290
671 3004252837 3004248173 Bacteria 6563236
672 3004273132 3004268573 Bacteria 7043476
673 3004278646 3004275668 Bacteria 7114440
674 3004295124 3004289098 Bacteria 6135450
675 3004339398 3004334049 Bacteria 8449246
676 637079561 637000159 Bacteria 7596297
677 649874609 649633066 Bacteria 6690028
678 8004301768 8004300914 Bacteria 6132239
679 8004321170 8004312739 Bacteria 7444653
680 8004365565 8004361976 Bacteria 6858373
681 8004378099 8004374579 Bacteria 6898112
682 8004388462 8004387939 Bacteria 7049250
683 8004401866 8004395343 Bacteria 6620908
684 8004450704 8004445564 Bacteria 6322258
685 8004634181 8004633249 Bacteria 6723080
686 8004641754 8004640170 Bacteria 6723001
687 8004700628 8004695233 Bacteria 6731676
688 8004710872 8004703790 Bacteria 8006957
689 8004714686 8004714634 Bacteria 6776161
690 8004731419 8004727605 Bacteria 6643904
691 8005684559 8005682033 Bacteria 6726518
692 8018152543 8018150411 Bacteria 5549903
693 8055434205 8055431914 Bacteria 4551896
694 8055622703 8055617313 Bacteria 7548464
695 Ga0500637_0009988
696 JGI24740J21852_10001214
697 JGI24740J21852_10004386
698 JGI24740J21852_10052704
699 JGI25155J39150_1000032
700 JGI25156J39149_1000129
701 JGI25162J39368_1000676
702 JGI25162J39368_1001230
703 JGI25154J39366_1000324
704 JGI25154J39366_1001340
705 JGI25157J39369_1000061
706 JGI25151J46595_10000192
707 JGI25406J46586_10006486
708 JGI25165J46597_1000028
709 JGI25165J46597_1001649
710 JGI25165J46597_1001657
711 JGI25153J46596_10016299
712 rootH1_10095545
713 Ga0055542_1001417
714 Ga0055536_1001177
715 Ga0055540_1001974
716 Ga0055531_10003014
717 Ga0058692_1001868
718 Ga0065165_1002531
719 Ga0070683_100183995
720 Ga0070670_100001700
721 Ga0070670_100080028
722 Ga0068869_100052973
723 Ga0070680_100172908
724 Ga0070660_100019894
725 Ga0070660_100474035
726 Ga0070661_100159659
727 Ga0070668_100008467
728 Ga0070669_100046389
729 Ga0070675_100093086
730 Ga0070674_100006650
731 Ga0070667_100023391
732 Ga0070681_10006925
733 Ga0070681_10007314
734 Ga0068867_100138010
735 Ga0068867_100181272
736 Ga0068853_100256899
737 Ga0068853_100314655
738 Ga0070672_100083788
739 Ga0070696_100057745
740 Ga0070665_100029356
741 Ga0068855_100029275
742 Ga0068855_100514237
743 Ga0068856_100241901
744 Ga0068856_100278244
745 Ga0068852_100065931
746 Ga0068852_100089570
747 Ga0068864_100101980
748 Ga0068861_100395306
749 Ga0068860_100035203
750 Ga0068862_100007560
751 Ga0068862_100026297
752 Ga0081539_10001131
753 Ga0075365_10005167
754 Ga0075368_10023034
755 Ga0075363_100022794
756 Ga0075363_100290793
757 Ga0075364_10003667
758 Ga0075364_10025065
759 Ga0075364_10066637
760 Ga0075364_10238721
761 Ga0075367_10034225
762 Ga0075367_10051599
763 Ga0075367_10067879
764 Ga0075367_10110435
765 Ga0075369_10074628
766 Ga0075369_10175854
767 Ga0075370_10025852
768 Ga0075370_10097326
769 Ga0075428_100416352
770 Ga0075430_100183521
771 Ga0075430_100185697
772 Ga0075431_100206251
773 Ga0075433_10252023
774 Ga0075429_100560990
775 Ga0079104_1000032
776 Ga0099826_10001725
777 Ga0105240_10000032
778 Ga0105240_10013259
779 Ga0105240_10142359
780 Ga0105240_10250849
781 Ga0111539_10119641
782 Ga0114129_10312268
783 Ga0105241_10093597
784 Ga0105241_10476011
785 Ga0105242_10546590
786 Ga0105248_10360355
787 Ga0105237_10000754
788 Ga0105237_10697015
789 Ga0105238_10321139
790 Ga0105238_10553860
791 Ga0105249_10212467
792 Ga0105239_10058313
793 Ga0105239_10067623
794 Ga0105239_10199662
795 Ga0105239_10393531
796 Ga0105239_10554858
797 Ga0157373_10012663
798 Ga0157371_10017171
799 Ga0157370_10000972
800 Ga0157370_10068924
801 Ga0157370_10425196
802 Ga0157369_10057945
803 Ga0157374_10226926
804 Ga0157372_10220544
805 Ga0182008_10029256
806 Ga0182007_10019077
807 Ga0182005_1005393
808 Ga0213872_10000693
809 Ga0213872_10008428
810 Ga0213874_10029116
811 Ga0213876_10000134
812 Ga0209435_100042
813 Ga0209437_100033
814 Ga0209437_100075
815 Ga0209437_107205
816 Ga0209646_1000145
817 Ga0209026_1000120
818 Ga0209026_1000160
819 Ga0209677_101323
820 Ga0209148_1000056
821 Ga0209759_1000177
822 Ga0209759_1000368
823 Ga0209233_1000056
824 Ga0209233_1000064
825 Ga0209233_1000087
826 Ga0209233_1000209
827 Ga0209233_1009458
828 Ga0209455_1000137
829 Ga0209676_1002466
830 Ga0209025_1000077
831 Ga0209758_1000554
832 Ga0209758_1003923
833 Ga0209758_1004764
834 Ga0209050_1010473
835 Ga0209051_1000459
836 Ga0209257_1002585
837 Ga0207707_10010344
838 Ga0207707_10028728
839 Ga0207695_10000024
840 Ga0207695_10003143
841 Ga0207695_10015043
842 Ga0207671_10000718
843 Ga0207671_10064787
844 Ga0207660_10077156
845 Ga0207660_10110648
846 Ga0207657_10090293
847 Ga0207681_10140543
848 Ga0207650_10025936
849 Ga0207659_10044372
850 Ga0207711_10262745
851 Ga0207689_10065924
852 Ga0207667_10020984
853 Ga0207667_10222472
854 Ga0207712_10059712
855 Ga0207668_10001888
856 Ga0207640_10043430
857 Ga0207658_10016989
858 Ga0207639_10092724
859 Ga0207639_10387256
860 Ga0207702_10145723
861 Ga0207648_10079288
862 Ga0207648_10083342
863 Ga0207648_10092376
864 Ga0209281_1000053
865 Ga0209371_1001029
866 Ga0209282_1000102
867 Ga0209813_10028846
868 Ga0207428_10142070
869 Ga0268266_10044390
870 Ga0268266_10241232
871 Ga0268266_10246104
872 Ga0268265_10048603
873 Ga0268264_10021248
874 Ga0307515_10000070
875 Ga0265338_10030725
876 Ga0268256_1001309
877 Ga0265331_10002627
878 Ga0265331_10028764
879 Ga0265327_10000190
880 Ga0265316_10027899
881 Ga0265316_10057177
882 Ga0307513_10008189
883 Ga0307516_10000004
884 Ga0307413_10128578
885 Ga0307410_10120870
886 Ga0307407_10194377
887 Ga0307416_100227722
888 Ga0395899_0000213
889 Ga0395899_0141708
890 Ga0395899_0511327
891 Ga0395900_0000121
892 Ga0395900_0011881
893 Ga0395900_0217756
894 Ga0395900_0246857
895 Ga0395900_0280327
896 Ga0395898_0000247
897 Ga0395898_0085187
898 Ga0395898_0603117
899 Ga0395905_0000112
900 Ga0395905_0018071
901 Ga0395905_0055874
902 Ga0436364_1313619
903 Ga0395901_0000078
904 Ga0395901_0007884
905 Ga0395901_0030144
906 Ga0395901_0064543
907 Ga0400483_138427
908 Ga0400483_157157
909 Ga0400483_178012
910 Ga0436365_0881464
911 Ga0436365_1830840
912 Ga0436361_0187236
913 Ga0436361_0206950
914 Ga0436363_1297661
915 Ga0451855_1869378
916 Ga0466972_0168153
917 Ga0453684_0061971
918 Ga0466968_0060343
919 Ga0466960_0114492
920 Ga0451576_0002273
921 Ga0495638_0002756
922 Ga0495607_0102276
923 Ga0495607_0105419
924 Ga0495583_0004487
925 Ga0495606_0011595
926 Ga0495606_0076436
927 Ga0495610_0021290
928 Ga0495637_0066954
929 Ga0495643_0048138
930 Ga0495648_0165350
931 Ga0495654_0000092
932 Ga0495597_0032202
933 Ga0495633_0009132
934 Ga0495633_0126357
935 Ga0495656_0161522
936 Ga0495668_0046834
937 Ga0495625_0051172
938 Ga0495669_0000001
939 Ga0495613_0000964
940 Ga0495670_0203564
941 Ga0495660_0067953
942 Ga0495673_0137288
943 Ga0496102_0020221
944 Ga0496107_0173742
945 Ga0496110_0370540
946 Ga0496111_0000236
947 Ga0496111_0431528
948 Ga0496112_0010289
949 Ga0496113_0090953
950 Ga0496116_0000036
951 Ga0496116_0000123
952 Ga0496116_0055212
953 Ga0496117_0005581
954 Ga0496117_0013040
955 Ga0496118_0002790
956 Ga0496118_0003518
957 Ga0496118_0013692
958 Ga0496118_0052275
959 Ga0496119_0000208
960 Ga0496119_0018528
961 Ga0496119_0030665
962 Ga0496120_0000781
963 Ga0496121_0001948
964 Ga0496121_0004987
965 Ga0496121_0096399
966 Ga0496121_0340326
967 Ga0496122_0000160
968 Ga0496122_0004196
969 Ga0496122_0006797
970 Ga0496122_0019960
971 Ga0496122_0030419
972 Ga0496122_0041368
973 Ga0496122_0078027
974 Ga0496123_0000034
975 Ga0496123_0004429
976 Ga0496123_0009397
977 Ga0496124_0000349
978 Ga0496124_0006016
979 Ga0496124_0008594
980 Ga0496124_0037757
981 Ga0496124_0072319
982 Ga0496124_0282378
983 Ga0496124_0316671
984 Ga0496125_0025328
985 Ga0496126_0000156
986 Ga0496126_0036343
987 Ga0496126_0233016
988 Ga0496126_0253397
989 Ga0496126_0403878
990 Ga0501031_0002553
991 Ga0501032_0000025
992 Ga0501032_0206680
993 Ga0501033_0000229
994 Ga0501033_0000742
995 Ga0501033_0330678
996 Ga0501034_0000189
997 Ga0501034_0001654
998 Ga0501034_0024556
999 Ga0501034_0150335
1000 Ga0501034_0435433
1001 Ga0501036_0001402
1002 Ga0501037_0000176
1003 Ga0501038_0000862
1004 Ga0501039_0000003
1005 Ga0501043_0000051
1006 Ga0501043_0168340
1007 Ga0501043_0185702
1008 Ga0501046_0042431
1009 Ga0501047_0018334
1010 Ga0501047_0025612
1011 Ga0501047_0029991
1012 Ga0501047_0050464
1013 Ga0501047_0180447
1014 Ga0501067_0168292
1015 Ga0501071_0144515
1016 Ga0501072_0133088
1017 Ga0501080_0011665
1018 Ga0501083_0016175
1019 Ga0501035_0000102
1020 Ga0501035_0000950
1021 Ga0501044_0020712
1022 Ga0501044_0105376
1023 Ga0501044_0282309
1024 nmdc:mga03n38_106237_c1
1025 nmdc:mga00v17_206289_c1
1026 nmdc:mga00v17_21259_c1
1027 nmdc:mga00v17_261276_c1
1028 nmdc:mga00v17_556_c1
1029 nmdc:mga0yw44_19023_c1
1030 nmdc:mga0yw44_26440_c1
1031 nmdc:mga0k408_49705_c1
1032 nmdc:mga06z11_24472_c1
1033 nmdc:mga07m45_24675_c1
1034 nmdc:mga05p37_100388_c1
1035 nmdc:mga09592_564724_c1
1036 nmdc:mga0qj67_84686_c1
1037 nmdc:mga08y16_62367_c1
1038 nmdc:mga0n895_8900_c1
1039 nmdc:mga0a205_336780_c1
1040 Ga0495655_0018261
1041 Ga0500643_021878
1042 Ga0500562_000800
1043 Ga0500572_001733
1044 Ga0500595_004093
1045 Ga0500607_159938
1046 Ga0500608_067653
1047 Ga0500618_000227
1048 Ga0500618_007584
1049 Ga0500652_006919
1050 Ga0500573_0001776
1051 Ga0500573_0012488
1052 Ga0500616_0001544
1053 Ga0500616_0006086
1054 Ga0500620_000690
1055 Ga0500627_0163785
1056 Ga0500633_0075135
1057 Ga0500634_0000112
1058 Ga0500634_0068617
1059 Ga0500636_0067626
1060 Ga0501082_0000811
1061 2503203294
1062 2509116056
1063 2509141470
1064 2509371832
1065 2509397725
1066 2510318981
1067 2510839677
1068 2511174517
1069 2512929817
1070 2512964586
1071 2513590219
1072 2513609081
1073 2514033300
1074 2514420483
1075 2514588177
1076 2523102558
1077 2585231481
1078 2585278917
1079 2585325469
1080 2585329626
1081 2585530714
1082 2585554894
1083 2585995130
1084 2585999677
1085 2588515409
1086 2597815013
1087 2599106086
1088 2599333754
1089 2599602583
1090 2599722027
1091 2599937998
1092 2600375279
1093 2601608664
1094 2601745438
1095 2616305810
1096 2616553948
1097 2643773604
1098 2643775444
1099 2643793890
1100 2643809994
1101 2643837779
1102 2643985341
1103 2644155023
1104 2644196528
1105 2644242896
1106 2671115297
1107 2671692764
1108 2688600132
1109 2694633679
1110 2694639982
1111 2723577412
1112 2738946530
1113 2756673305
1114 2765465211
1115 2770197357
1116 2776912788
1117 2792749115
1118 2793353582
1119 2819639239
1120 2819684102
1121 2821124297
1122 2821449371
1123 2837681212
1124 2838031436
1125 2838741210
1126 2841741125
1127 2841844893
1128 2842144615
1129 2842333655
1130 2842477969
1131 2842482863
1132 2842504778
1133 2842509738
1134 2842924808
1135 2844005766
1136 2844015444
1137 2844533647
1138 2846955880
1139 2847671814
1140 2847688045
1141 2848862299
1142 2854683558
1143 2854897195
1144 2854918185
1145 2856318456
1146 2856324408
1147 2856333387
1148 2856335712
1149 2856345456
1150 2856350409
1151 2856362074
1152 2856364609
1153 2857355865
1154 2857375518
1155 2857531877
1156 2869165012
1157 2869175763
1158 2869240244
1159 2869248585
1160 2869256484
1161 2869260184
1162 2869264435
1163 2869276513
1164 2869281594
1165 2869292718
1166 2871429531
1167 2871456680
1168 2871462212
1169 2871470002
1170 2871478512
1171 2871488446
1172 2871493934
1173 2871498448
1174 2874103817
1175 2874111271
1176 2874120114
1177 2874127563
1178 2874132698
1179 2874140742
1180 2874146994
1181 2874157026
1182 2874163468
1183 2874175451
1184 2876366620
1185 2876372266
1186 2876379667
1187 2876388113
1188 2876399477
1189 2876406245
1190 2876411932
1191 2876414465
1192 2876424469
1193 2878037792
1194 2878742523
1195 2878746297
1196 2878756510
1197 2878762667
1198 2878769633
1199 2878775917
1200 2878783626
1201 2878793530
1202 2881153654
1203 2881157451
1204 2881162809
1205 2881847017
1206 2881857060
1207 2881867287
1208 2882634377
1209 2882915271
1210 2885311559
1211 2885316396
1212 2885321161
1213 2885327065
1214 2885349999
1215 2885356052
1216 2888341306
1217 2888348490
1218 2889012970
1219 2889022162
1220 2891051624
1221 2899261802
1222 2899803788
1223 2903452796
1224 2903500639
1225 2903502562
1226 2903518240
1227 2903524487
1228 2903530118
1229 2903543246
1230 2904581381
1231 2904666004
1232 2906308430
1233 2906321978
1234 2906331212
1235 2906355772
1236 2906375479
1237 2906386883
1238 2906411685
1239 2906418493
1240 2913310947
1241 2919122617
1242 2919167379
1243 2919171408
1244 2919409318
1245 2922137674
1246 2922154110
1247 2922165445
1248 2922176873
1249 2922193034
1250 2924735385
1251 2924743055
1252 2924751453
1253 2924756390
1254 2924764629
1255 2924780323
1256 2924788095
1257 2933595079
1258 2937814357
1259 2937829281
1260 2937840500
1261 2937852405
1262 2937862744
1263 2937882845
1264 2937891484
1265 2937973182
1266 2937986440
1267 2937997095
1268 2938015505
1269 2958037555
1270 2958046732
1271 2958047266
1272 2958068678
1273 2958071375
1274 2958089970
1275 2958105461
1276 2958112382
1277 2958116990
1278 2958126408
1279 2958137389
1280 2958148992
1281 2958167565
1282 2958177389
1283 2958180234
1284 2961078066
1285 2961121348
1286 2961135143
1287 2961143484
1288 2961166037
1289 2961172799
1290 2961190646
1291 2963649414
1292 2965020856
1293 2965030659
1294 2965046029
1295 2965053313
1296 2965062816
1297 2965095116
1298 2965107272
1299 2965120111
1300 2967998011
1301 2968008662
1302 2968019611
1303 2968084577
1304 2968096905
1305 2968102384
1306 2968117501
1307 2968118284
1308 2968131096
1309 2968146102
1310 2968174434
1311 2970472932
1312 2970492078
1313 2970505393
1314 2970512514
1315 2970529707
1316 2970535252
1317 2970545087
1318 2970551110
1319 2970557525
1320 2970596197
1321 2970624992
1322 2970627372
1323 2977825691
1324 2977832260
1325 2977844864
1326 2977862824
1327 2977869569
1328 2977873749
1329 2977914993
1330 2977915314
1331 2977927225
1332 2977937007
1333 2977943844
1334 2977954377
1335 2977960054
1336 2977972511
1337 2977989923
1338 2979751392
1339 2979770064
1340 2979779447
1341 2979785945
1342 2979794270
1343 2979810114
1344 2987639679
1345 2987648775
1346 2987658667
1347 2987662044
1348 2987667433
1349 2987674016
1350 2995393784
1351 2996313323
1352 2996342532
1353 2996351948
1354 2996392344
1355 3000018631
1356 3000141853
1357 3004170901
1358 3004191095
1359 3004199916
1360 3004207252
1361 3004214644
1362 3004219327
1363 3004238116
1364 3004240345
1365 3004252837
1366 3004273132
1367 3004278646
1368 3004295124
1369 3004339398
1370 637079561
1371 649874609
1372 8004301768
1373 8004321170
1374 8004365565
1375 8004378099
1376 8004388462
1377 8004401866
1378 8004450704
1379 8004634181
1380 8004641754
1381 8004700628
1382 8004710872
1383 8004714686
1384 8004731419
1385 8005684559
1386 8018152543
1387 8055434205
1388 8055622703

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

20

318

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9383 27 273
4jxj-assembly1.cif.gz_A crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing 0.9379 28 275
4jxj-assembly1.cif.gz_A crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing 0.9342 28 275
7pnt-assembly1.cif.gz_c assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa and tfb1m 0.9288 27 274
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9237 27 273
ID Description Score Start End Superfamily
4jxjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9637 28 212 3.40.50.150
af_Q54M56_2_236_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9559 7 214 3.40.50.150
4jxjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9533 28 212 3.40.50.150
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9496 20 212 3.40.50.150
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9347 20 212 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A436BH90-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9937 165 275 GO:0000179
GO:0003723
GO:0005829
AF-A0A351T7M2-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9863 27 204 GO:0000179
GO:0003723
GO:0005829
AF-A0A539CV97-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9848 1 274 GO:0003723
GO:0005829
GO:0052908
AF-A0A659YI97-F1-model_v4 deleted 0.9818 90 249
AF-A0A539CV97-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9777 1 274 GO:0003723
GO:0005829
GO:0052908

Map