F475763
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 557 | 1388 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300053178|Ga0500637_0009988|Ga0500637_0009988_1639_2601 |
| Length | 320 |
| Sequence | MPSPIDLLPPLREVIAKHDLLARKSLGQHFLCDLNLTRKIASLAGDLTDCTAFEIGPGPGGLTRALVETDAKKIIAIEKDRRCIAALKDVIEASEGRLEVIEGDALKIDLIPLARSLPLTRRADARHPLPPAGGEGTQEKPLALQSREREGPVAKQREGEGQYAVVANLPYNIGTELLLGWLETIDEYKSLTLMFQAEVADRLAAEPDSKTYGRLSVITQFCCDIERVLDIPARAFTPPPKVDSAVVHLTPRKNRPKDVSFKMMGRVTAAAFGQRRKMLRSSLKPLGGEELLKRAGIKPELRAENLSVADFENLARKFGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 57 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 78 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 142 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 143 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 144 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 145 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 146 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 175 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 178 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 179 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 180 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 181 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 204 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 205 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 207 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 208 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 209 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 217 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 218 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 219 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 220 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 221 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 222 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 224 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 225 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 226 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 227 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 229 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 230 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 231 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 233 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 234 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 235 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 236 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 237 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 238 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 239 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 240 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 241 | 2512875024 | |||
| 242 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 243 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 244 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 245 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 246 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 247 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 248 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 249 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 250 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 251 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 252 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 253 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 254 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 255 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 256 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 257 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 258 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 259 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 260 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 261 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 262 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 263 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 264 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 265 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 266 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 267 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 268 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 269 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 270 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 271 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 272 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 273 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 274 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 275 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 276 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 277 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 278 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 279 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 280 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 281 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 282 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 283 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 284 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 285 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 286 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 287 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 288 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 289 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 290 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 291 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 292 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 293 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 294 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 295 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 296 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 297 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 298 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 299 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 300 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 301 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 302 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 303 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 304 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 305 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 306 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 307 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 308 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 309 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 310 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 311 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 312 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 313 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 314 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 315 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 316 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 317 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 318 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 319 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 320 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 321 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 322 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 323 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 324 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 325 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 326 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 327 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 328 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 329 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 330 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 331 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 332 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 333 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 334 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 335 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 336 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 337 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 338 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 339 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 340 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 341 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 342 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 343 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 344 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 345 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 346 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 347 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 348 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 349 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 350 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 351 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 352 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 353 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 354 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 355 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 356 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 357 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 358 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 359 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 360 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 361 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 362 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 363 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 364 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 365 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 366 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 367 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 368 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 369 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 370 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 371 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 372 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 373 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 374 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 375 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 376 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 377 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 378 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 379 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 380 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 381 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 382 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 383 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 384 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 385 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 386 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 387 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 388 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 389 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 390 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 391 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 392 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 393 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 394 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 395 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 396 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 397 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 398 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 399 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 400 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 401 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 402 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 403 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 404 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 405 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 406 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 407 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 408 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 409 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 410 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 411 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 412 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 413 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 414 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 415 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 416 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 417 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 418 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 419 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 420 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 421 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 422 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 423 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 424 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 425 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 426 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 427 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 428 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 429 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 430 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 431 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 432 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 433 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 434 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 435 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 436 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 437 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 438 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 439 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 440 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 441 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 442 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 443 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 444 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 445 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 446 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 447 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 448 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 449 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 450 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 451 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 452 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 453 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 454 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 455 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 456 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 457 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 458 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 459 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 460 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 461 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 462 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 463 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 464 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 465 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 466 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 467 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 468 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 469 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 470 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 471 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 472 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 473 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 474 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 475 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 476 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 477 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 478 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 479 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 480 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 481 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 482 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 483 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 484 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 485 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 486 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 487 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 488 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 489 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 490 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 491 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 492 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 493 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 494 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 495 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 496 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 497 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 498 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 499 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 500 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 501 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 502 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 503 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 504 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 505 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 506 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 507 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 508 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 509 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 510 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 511 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 512 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 513 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 514 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 515 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 516 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 517 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 518 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 519 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 520 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 521 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 522 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 523 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 524 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 525 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 526 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 527 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 528 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 529 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 530 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 531 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 532 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 533 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 534 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 535 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 536 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 537 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 538 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 539 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 540 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 541 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 542 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 543 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 544 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 545 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 546 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 547 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 548 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 549 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 550 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 551 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 552 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 553 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 554 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 555 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 556 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 557 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.74 |
| Metatranscriptomes | 0 |
| Isolates | 47.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.24 |
| Nodule | 35.45 |
| Rhizoplane | 2.45 |
| Rhizosphere | 32.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500637_0009988 | 3300053178 | Bacteria | 4854 |
| 2 | JGI24740J21852_10001214 | 3300001979 | Bacteria | 11651 |
| 3 | JGI24740J21852_10004386 | 3300001979 | Bacteria | 6067 |
| 4 | JGI24740J21852_10052704 | 3300001979 | Bacteria | 1157 |
| 5 | JGI25155J39150_1000032 | 3300002704 | Bacteria | 105511 |
| 6 | JGI25156J39149_1000129 | 3300002705 | Bacteria | 54812 |
| 7 | JGI25162J39368_1000676 | 3300002737 | Bacteria | 23903 |
| 8 | JGI25162J39368_1001230 | 3300002737 | Bacteria | 14797 |
| 9 | JGI25154J39366_1000324 | 3300002738 | Bacteria | 27739 |
| 10 | JGI25154J39366_1001340 | 3300002738 | Bacteria | 9024 |
| 11 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 12 | JGI25151J46595_10000192 | 3300003187 | Bacteria | 75239 |
| 13 | JGI25406J46586_10006486 | 3300003203 | Bacteria | 5384 |
| 14 | JGI25165J46597_1000028 | 3300003214 | Bacteria | 325146 |
| 15 | JGI25165J46597_1001649 | 3300003214 | Bacteria | 10326 |
| 16 | JGI25165J46597_1001657 | 3300003214 | Bacteria | 10216 |
| 17 | JGI25153J46596_10016299 | 3300003215 | Bacteria | 2984 |
| 18 | rootH1_10095545 | 3300003323 | Bacteria | 1152 |
| 19 | Ga0055542_1001417 | 3300003762 | Bacteria | 12078 |
| 20 | Ga0055536_1001177 | 3300003781 | Bacteria | 16274 |
| 21 | Ga0055540_1001974 | 3300003792 | Bacteria | 11464 |
| 22 | Ga0055531_10003014 | 3300003794 | Bacteria | 10927 |
| 23 | Ga0058692_1001868 | 3300003856 | Bacteria | 7390 |
| 24 | Ga0065165_1002531 | 3300005262 | Bacteria | 15197 |
| 25 | Ga0070683_100183995 | 3300005329 | Bacteria | 1983 |
| 26 | Ga0070670_100001700 | 3300005331 | Bacteria | 17910 |
| 27 | Ga0070670_100080028 | 3300005331 | Bacteria | 2808 |
| 28 | Ga0068869_100052973 | 3300005334 | Bacteria | 2948 |
| 29 | Ga0070680_100172908 | 3300005336 | Bacteria | 1818 |
| 30 | Ga0070660_100019894 | 3300005339 | Bacteria | 4925 |
| 31 | Ga0070660_100474035 | 3300005339 | Bacteria | 1040 |
| 32 | Ga0070661_100159659 | 3300005344 | Bacteria | 1707 |
| 33 | Ga0070668_100008467 | 3300005347 | Bacteria | 7639 |
| 34 | Ga0070669_100046389 | 3300005353 | Bacteria | 3169 |
| 35 | Ga0070675_100093086 | 3300005354 | Bacteria | 2528 |
| 36 | Ga0070674_100006650 | 3300005356 | Bacteria | 6760 |
| 37 | Ga0070667_100023391 | 3300005367 | Bacteria | 5126 |
| 38 | Ga0070681_10006925 | 3300005458 | Bacteria | 11038 |
| 39 | Ga0070681_10007314 | 3300005458 | Bacteria | 10782 |
| 40 | Ga0068867_100138010 | 3300005459 | Bacteria | 1903 |
| 41 | Ga0068867_100181272 | 3300005459 | Bacteria | 1675 |
| 42 | Ga0068853_100256899 | 3300005539 | Bacteria | 1605 |
| 43 | Ga0068853_100314655 | 3300005539 | Bacteria | 1450 |
| 44 | Ga0070672_100083788 | 3300005543 | Bacteria | 2559 |
| 45 | Ga0070696_100057745 | 3300005546 | Bacteria | 2709 |
| 46 | Ga0070665_100029356 | 3300005548 | Bacteria | 5536 |
| 47 | Ga0068855_100029275 | 3300005563 | Bacteria | 6586 |
| 48 | Ga0068855_100514237 | 3300005563 | Bacteria | 1300 |
| 49 | Ga0068856_100241901 | 3300005614 | Bacteria | 1820 |
| 50 | Ga0068856_100278244 | 3300005614 | Bacteria | 1690 |
| 51 | Ga0068852_100065931 | 3300005616 | Bacteria | 3160 |
| 52 | Ga0068852_100089570 | 3300005616 | Bacteria | 2750 |
| 53 | Ga0068864_100101980 | 3300005618 | Bacteria | 2546 |
| 54 | Ga0068861_100395306 | 3300005719 | Bacteria | 1225 |
| 55 | Ga0068860_100035203 | 3300005843 | Bacteria | 4804 |
| 56 | Ga0068862_100007560 | 3300005844 | Bacteria | 9007 |
| 57 | Ga0068862_100026297 | 3300005844 | Bacteria | 4891 |
| 58 | Ga0081539_10001131 | 3300005985 | Bacteria | 48406 |
| 59 | Ga0075365_10005167 | 3300006038 | Bacteria | 7016 |
| 60 | Ga0075368_10023034 | 3300006042 | Bacteria | 2375 |
| 61 | Ga0075363_100022794 | 3300006048 | Bacteria | 3168 |
| 62 | Ga0075363_100290793 | 3300006048 | Bacteria | 947 |
| 63 | Ga0075364_10003667 | 3300006051 | Bacteria | 8756 |
| 64 | Ga0075364_10025065 | 3300006051 | Bacteria | 3794 |
| 65 | Ga0075364_10066637 | 3300006051 | Bacteria | 2365 |
| 66 | Ga0075364_10238721 | 3300006051 | Bacteria | 1234 |
| 67 | Ga0075367_10034225 | 3300006178 | Bacteria | 2933 |
| 68 | Ga0075367_10051599 | 3300006178 | Bacteria | 2431 |
| 69 | Ga0075367_10067879 | 3300006178 | Bacteria | 2138 |
| 70 | Ga0075367_10110435 | 3300006178 | Bacteria | 1687 |
| 71 | Ga0075369_10074628 | 3300006186 | Bacteria | 1496 |
| 72 | Ga0075369_10175854 | 3300006186 | Bacteria | 984 |
| 73 | Ga0075370_10025852 | 3300006353 | Bacteria | 3249 |
| 74 | Ga0075370_10097326 | 3300006353 | Bacteria | 1701 |
| 75 | Ga0075428_100416352 | 3300006844 | Bacteria | 1440 |
| 76 | Ga0075430_100183521 | 3300006846 | Bacteria | 1740 |
| 77 | Ga0075430_100185697 | 3300006846 | Bacteria | 1729 |
| 78 | Ga0075431_100206251 | 3300006847 | Bacteria | 2009 |
| 79 | Ga0075433_10252023 | 3300006852 | Bacteria | 1566 |
| 80 | Ga0075429_100560990 | 3300006880 | Bacteria | 1001 |
| 81 | Ga0079104_1000032 | 3300006946 | Bacteria | 203094 |
| 82 | Ga0099826_10001725 | 3300006948 | Bacteria | 13474 |
| 83 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 84 | Ga0105240_10013259 | 3300009093 | Bacteria | 11335 |
| 85 | Ga0105240_10142359 | 3300009093 | Bacteria | 2866 |
| 86 | Ga0105240_10250849 | 3300009093 | Bacteria | 2047 |
| 87 | Ga0111539_10119641 | 3300009094 | Bacteria | 3086 |
| 88 | Ga0114129_10312268 | 3300009147 | Unclassified | 2092 |
| 89 | Ga0105241_10093597 | 3300009174 | Bacteria | 2375 |
| 90 | Ga0105241_10476011 | 3300009174 | Bacteria | 1109 |
| 91 | Ga0105242_10546590 | 3300009176 | Bacteria | 1110 |
| 92 | Ga0105248_10360355 | 3300009177 | Bacteria | 1637 |
| 93 | Ga0105237_10000754 | 3300009545 | Bacteria | 44371 |
| 94 | Ga0105237_10697015 | 3300009545 | Bacteria | 1022 |
| 95 | Ga0105238_10321139 | 3300009551 | Bacteria | 1534 |
| 96 | Ga0105238_10553860 | 3300009551 | Bacteria | 1154 |
| 97 | Ga0105249_10212467 | 3300009553 | Bacteria | 1899 |
| 98 | Ga0105239_10058313 | 3300010375 | Bacteria | 4236 |
| 99 | Ga0105239_10067623 | 3300010375 | Bacteria | 3925 |
| 100 | Ga0105239_10199662 | 3300010375 | Bacteria | 2240 |
| 101 | Ga0105239_10393531 | 3300010375 | Bacteria | 1568 |
| 102 | Ga0105239_10554858 | 3300010375 | Bacteria | 1308 |
| 103 | Ga0157373_10012663 | 3300013100 | Bacteria | 6202 |
| 104 | Ga0157371_10017171 | 3300013102 | Bacteria | 5381 |
| 105 | Ga0157370_10000972 | 3300013104 | Bacteria | 36292 |
| 106 | Ga0157370_10068924 | 3300013104 | Bacteria | 3342 |
| 107 | Ga0157370_10425196 | 3300013104 | Bacteria | 1222 |
| 108 | Ga0157369_10057945 | 3300013105 | Bacteria | 4179 |
| 109 | Ga0157374_10226926 | 3300013296 | Bacteria | 1834 |
| 110 | Ga0157372_10220544 | 3300013307 | Bacteria | 2198 |
| 111 | Ga0182008_10029256 | 3300014497 | Bacteria | 2784 |
| 112 | Ga0182007_10019077 | 3300015262 | Bacteria | 2472 |
| 113 | Ga0182005_1005393 | 3300015265 | Bacteria | 3999 |
| 114 | Ga0213872_10000693 | 3300021361 | Bacteria | 25305 |
| 115 | Ga0213872_10008428 | 3300021361 | Bacteria | 4991 |
| 116 | Ga0213874_10029116 | 3300021377 | Bacteria | 1583 |
| 117 | Ga0213876_10000134 | 3300021384 | Bacteria | 80875 |
| 118 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 119 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 120 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 121 | Ga0209437_107205 | 3300025233 | Bacteria | 1821 |
| 122 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 123 | Ga0209026_1000120 | 3300025250 | Bacteria | 130091 |
| 124 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 125 | Ga0209677_101323 | 3300025253 | Bacteria | 10926 |
| 126 | Ga0209148_1000056 | 3300025254 | Bacteria | 363380 |
| 127 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 128 | Ga0209759_1000368 | 3300025256 | Bacteria | 56484 |
| 129 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 130 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 131 | Ga0209233_1000087 | 3300025261 | Bacteria | 325225 |
| 132 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 133 | Ga0209233_1009458 | 3300025261 | Bacteria | 2964 |
| 134 | Ga0209455_1000137 | 3300025272 | Bacteria | 142099 |
| 135 | Ga0209676_1002466 | 3300025292 | Bacteria | 13070 |
| 136 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 137 | Ga0209758_1000554 | 3300025297 | Bacteria | 59218 |
| 138 | Ga0209758_1003923 | 3300025297 | Bacteria | 12985 |
| 139 | Ga0209758_1004764 | 3300025297 | Bacteria | 11008 |
| 140 | Ga0209050_1010473 | 3300025298 | Bacteria | 4564 |
| 141 | Ga0209051_1000459 | 3300025303 | Bacteria | 53735 |
| 142 | Ga0209257_1002585 | 3300025304 | Bacteria | 17600 |
| 143 | Ga0207707_10010344 | 3300025912 | Bacteria | 8095 |
| 144 | Ga0207707_10028728 | 3300025912 | Bacteria | 4859 |
| 145 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 146 | Ga0207695_10003143 | 3300025913 | Bacteria | 23591 |
| 147 | Ga0207695_10015043 | 3300025913 | Bacteria | 9131 |
| 148 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 149 | Ga0207671_10064787 | 3300025914 | Bacteria | 2717 |
| 150 | Ga0207660_10077156 | 3300025917 | Bacteria | 2438 |
| 151 | Ga0207660_10110648 | 3300025917 | Bacteria | 2067 |
| 152 | Ga0207657_10090293 | 3300025919 | Bacteria | 2557 |
| 153 | Ga0207681_10140543 | 3300025923 | Bacteria | 1797 |
| 154 | Ga0207650_10025936 | 3300025925 | Bacteria | 4178 |
| 155 | Ga0207659_10044372 | 3300025926 | Bacteria | 3128 |
| 156 | Ga0207711_10262745 | 3300025941 | Bacteria | 1587 |
| 157 | Ga0207689_10065924 | 3300025942 | Bacteria | 2978 |
| 158 | Ga0207667_10020984 | 3300025949 | Bacteria | 7245 |
| 159 | Ga0207667_10222472 | 3300025949 | Bacteria | 1934 |
| 160 | Ga0207712_10059712 | 3300025961 | Bacteria | 2700 |
| 161 | Ga0207668_10001888 | 3300025972 | Bacteria | 12260 |
| 162 | Ga0207640_10043430 | 3300025981 | Bacteria | 2873 |
| 163 | Ga0207658_10016989 | 3300025986 | Bacteria | 5008 |
| 164 | Ga0207639_10092724 | 3300026041 | Bacteria | 2421 |
| 165 | Ga0207639_10387256 | 3300026041 | Bacteria | 1257 |
| 166 | Ga0207702_10145723 | 3300026078 | Bacteria | 2149 |
| 167 | Ga0207648_10079288 | 3300026089 | Bacteria | 2864 |
| 168 | Ga0207648_10083342 | 3300026089 | Bacteria | 2789 |
| 169 | Ga0207648_10092376 | 3300026089 | Bacteria | 2646 |
| 170 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 171 | Ga0209371_1001029 | 3300027312 | Bacteria | 21140 |
| 172 | Ga0209282_1000102 | 3300027666 | Bacteria | 57412 |
| 173 | Ga0209813_10028846 | 3300027866 | Bacteria | 1621 |
| 174 | Ga0207428_10142070 | 3300027907 | Bacteria | 1831 |
| 175 | Ga0268266_10044390 | 3300028379 | Bacteria | 3800 |
| 176 | Ga0268266_10241232 | 3300028379 | Bacteria | 1668 |
| 177 | Ga0268266_10246104 | 3300028379 | Bacteria | 1652 |
| 178 | Ga0268265_10048603 | 3300028380 | Bacteria | 3185 |
| 179 | Ga0268264_10021248 | 3300028381 | Bacteria | 5303 |
| 180 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 181 | Ga0265338_10030725 | 3300028800 | Bacteria | 5282 |
| 182 | Ga0268256_1001309 | 3300030500 | Bacteria | 15327 |
| 183 | Ga0265331_10002627 | 3300031250 | Bacteria | 12061 |
| 184 | Ga0265331_10028764 | 3300031250 | Bacteria | 2778 |
| 185 | Ga0265327_10000190 | 3300031251 | Bacteria | 130086 |
| 186 | Ga0265316_10027899 | 3300031344 | Bacteria | 4667 |
| 187 | Ga0265316_10057177 | 3300031344 | Bacteria | 3043 |
| 188 | Ga0307513_10008189 | 3300031456 | Bacteria | 13404 |
| 189 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 190 | Ga0307413_10128578 | 3300031824 | Bacteria | 1730 |
| 191 | Ga0307410_10120870 | 3300031852 | Bacteria | 1910 |
| 192 | Ga0307407_10194377 | 3300031903 | Bacteria | 1355 |
| 193 | Ga0307416_100227722 | 3300032002 | Bacteria | 1794 |
| 194 | Ga0395899_0000213 | 3300037312 | Bacteria | 83403 |
| 195 | Ga0395899_0141708 | 3300037312 | Bacteria | 1710 |
| 196 | Ga0395899_0511327 | 3300037312 | Bacteria | 778 |
| 197 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 198 | Ga0395900_0011881 | 3300037418 | Bacteria | 8903 |
| 199 | Ga0395900_0217756 | 3300037418 | Bacteria | 1926 |
| 200 | Ga0395900_0246857 | 3300037418 | Bacteria | 1788 |
| 201 | Ga0395900_0280327 | 3300037418 | Bacteria | 1659 |
| 202 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 203 | Ga0395898_0085187 | 3300037466 | Bacteria | 3046 |
| 204 | Ga0395898_0603117 | 3300037466 | Bacteria | 1041 |
| 205 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 206 | Ga0395905_0018071 | 3300037471 | Bacteria | 6694 |
| 207 | Ga0395905_0055874 | 3300037471 | Bacteria | 3695 |
| 208 | Ga0436364_1313619 | 3300037853 | Bacteria | 1395 |
| 209 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 210 | Ga0395901_0007884 | 3300038443 | Bacteria | 10743 |
| 211 | Ga0395901_0030144 | 3300038443 | Bacteria | 5588 |
| 212 | Ga0395901_0064543 | 3300038443 | Bacteria | 3812 |
| 213 | Ga0400483_138427 | 3300039062 | Bacteria | 1445 |
| 214 | Ga0400483_157157 | 3300039062 | Bacteria | 2691 |
| 215 | Ga0400483_178012 | 3300039062 | Bacteria | 2457 |
| 216 | Ga0436365_0881464 | 3300039437 | Bacteria | 1800 |
| 217 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 218 | Ga0436361_0187236 | 3300039447 | Bacteria | 14656 |
| 219 | Ga0436361_0206950 | 3300039447 | Bacteria | 229672 |
| 220 | Ga0436363_1297661 | 3300039450 | Bacteria | 5607 |
| 221 | Ga0451855_1869378 | 3300041511 | Bacteria | 973 |
| 222 | Ga0466972_0168153 | 3300044658 | Bacteria | 1029 |
| 223 | Ga0453684_0061971 | 3300044712 | Bacteria | 4795 |
| 224 | Ga0466968_0060343 | 3300044735 | Bacteria | 1635 |
| 225 | Ga0466960_0114492 | 3300044901 | Bacteria | 1405 |
| 226 | Ga0451576_0002273 | 3300045051 | Bacteria | 29322 |
| 227 | Ga0495638_0002756 | 3300046460 | Bacteria | 14121 |
| 228 | Ga0495607_0102276 | 3300046501 | Bacteria | 1533 |
| 229 | Ga0495607_0105419 | 3300046501 | Bacteria | 1503 |
| 230 | Ga0495583_0004487 | 3300046506 | Bacteria | 9971 |
| 231 | Ga0495606_0011595 | 3300046507 | Bacteria | 7167 |
| 232 | Ga0495606_0076436 | 3300046507 | Bacteria | 2093 |
| 233 | Ga0495610_0021290 | 3300046512 | Bacteria | 3570 |
| 234 | Ga0495637_0066954 | 3300046520 | Bacteria | 1459 |
| 235 | Ga0495643_0048138 | 3300046522 | Bacteria | 2306 |
| 236 | Ga0495648_0165350 | 3300046524 | Bacteria | 1139 |
| 237 | Ga0495654_0000092 | 3300046530 | Bacteria | 101504 |
| 238 | Ga0495597_0032202 | 3300046542 | Bacteria | 2380 |
| 239 | Ga0495633_0009132 | 3300046558 | Bacteria | 5504 |
| 240 | Ga0495633_0126357 | 3300046558 | Bacteria | 1183 |
| 241 | Ga0495656_0161522 | 3300046615 | Bacteria | 1089 |
| 242 | Ga0495668_0046834 | 3300046616 | Bacteria | 2402 |
| 243 | Ga0495625_0051172 | 3300046660 | Bacteria | 2962 |
| 244 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 245 | Ga0495613_0000964 | 3300046689 | Bacteria | 22013 |
| 246 | Ga0495670_0203564 | 3300046691 | Bacteria | 1049 |
| 247 | Ga0495660_0067953 | 3300046810 | Bacteria | 1897 |
| 248 | Ga0495673_0137288 | 3300047469 | Bacteria | 956 |
| 249 | Ga0496102_0020221 | 3300048905 | Bacteria | 5881 |
| 250 | Ga0496107_0173742 | 3300048910 | Bacteria | 1599 |
| 251 | Ga0496110_0370540 | 3300048913 | Bacteria | 1305 |
| 252 | Ga0496111_0000236 | 3300048914 | Bacteria | 26454 |
| 253 | Ga0496111_0431528 | 3300048914 | Bacteria | 973 |
| 254 | Ga0496112_0010289 | 3300048915 | Bacteria | 8481 |
| 255 | Ga0496113_0090953 | 3300048916 | Bacteria | 2352 |
| 256 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 257 | Ga0496116_0000123 | 3300048919 | Bacteria | 161733 |
| 258 | Ga0496116_0055212 | 3300048919 | Bacteria | 2610 |
| 259 | Ga0496117_0005581 | 3300048920 | Bacteria | 13162 |
| 260 | Ga0496117_0013040 | 3300048920 | Bacteria | 7276 |
| 261 | Ga0496118_0002790 | 3300048921 | Bacteria | 22870 |
| 262 | Ga0496118_0003518 | 3300048921 | Bacteria | 19619 |
| 263 | Ga0496118_0013692 | 3300048921 | Bacteria | 7654 |
| 264 | Ga0496118_0052275 | 3300048921 | Bacteria | 3118 |
| 265 | Ga0496119_0000208 | 3300048922 | Bacteria | 83742 |
| 266 | Ga0496119_0018528 | 3300048922 | Bacteria | 5175 |
| 267 | Ga0496119_0030665 | 3300048922 | Bacteria | 3620 |
| 268 | Ga0496120_0000781 | 3300048923 | Bacteria | 46067 |
| 269 | Ga0496121_0001948 | 3300048924 | Bacteria | 32895 |
| 270 | Ga0496121_0004987 | 3300048924 | Bacteria | 17381 |
| 271 | Ga0496121_0096399 | 3300048924 | Bacteria | 2295 |
| 272 | Ga0496121_0340326 | 3300048924 | Bacteria | 1003 |
| 273 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 274 | Ga0496122_0004196 | 3300048925 | Bacteria | 18127 |
| 275 | Ga0496122_0006797 | 3300048925 | Bacteria | 12992 |
| 276 | Ga0496122_0019960 | 3300048925 | Bacteria | 6092 |
| 277 | Ga0496122_0030419 | 3300048925 | Bacteria | 4523 |
| 278 | Ga0496122_0041368 | 3300048925 | Bacteria | 3645 |
| 279 | Ga0496122_0078027 | 3300048925 | Bacteria | 2322 |
| 280 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 281 | Ga0496123_0004429 | 3300048926 | Bacteria | 14773 |
| 282 | Ga0496123_0009397 | 3300048926 | Bacteria | 8809 |
| 283 | Ga0496124_0000349 | 3300048927 | Bacteria | 84498 |
| 284 | Ga0496124_0006016 | 3300048927 | Bacteria | 13378 |
| 285 | Ga0496124_0008594 | 3300048927 | Bacteria | 10654 |
| 286 | Ga0496124_0037757 | 3300048927 | Bacteria | 4198 |
| 287 | Ga0496124_0072319 | 3300048927 | Bacteria | 2856 |
| 288 | Ga0496124_0282378 | 3300048927 | Bacteria | 1209 |
| 289 | Ga0496124_0316671 | 3300048927 | Bacteria | 1119 |
| 290 | Ga0496125_0025328 | 3300048928 | Bacteria | 5435 |
| 291 | Ga0496126_0000156 | 3300048929 | Bacteria | 158537 |
| 292 | Ga0496126_0036343 | 3300048929 | Bacteria | 4606 |
| 293 | Ga0496126_0233016 | 3300048929 | Bacteria | 1542 |
| 294 | Ga0496126_0253397 | 3300048929 | Bacteria | 1466 |
| 295 | Ga0496126_0403878 | 3300048929 | Bacteria | 1107 |
| 296 | Ga0501031_0002553 | 3300049568 | Bacteria | 11599 |
| 297 | Ga0501032_0000025 | 3300049569 | Bacteria | 138521 |
| 298 | Ga0501032_0206680 | 3300049569 | Bacteria | 1281 |
| 299 | Ga0501033_0000229 | 3300049570 | Bacteria | 54036 |
| 300 | Ga0501033_0000742 | 3300049570 | Bacteria | 29975 |
| 301 | Ga0501033_0330678 | 3300049570 | Bacteria | 1069 |
| 302 | Ga0501034_0000189 | 3300049571 | Bacteria | 115780 |
| 303 | Ga0501034_0001654 | 3300049571 | Bacteria | 28764 |
| 304 | Ga0501034_0024556 | 3300049571 | Bacteria | 6131 |
| 305 | Ga0501034_0150335 | 3300049571 | Bacteria | 2305 |
| 306 | Ga0501034_0435433 | 3300049571 | Bacteria | 1230 |
| 307 | Ga0501036_0001402 | 3300049572 | Bacteria | 18518 |
| 308 | Ga0501037_0000176 | 3300049573 | Bacteria | 60011 |
| 309 | Ga0501038_0000862 | 3300049574 | Bacteria | 26891 |
| 310 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 311 | Ga0501043_0000051 | 3300049579 | Bacteria | 106957 |
| 312 | Ga0501043_0168340 | 3300049579 | Bacteria | 1710 |
| 313 | Ga0501043_0185702 | 3300049579 | Bacteria | 1619 |
| 314 | Ga0501046_0042431 | 3300049580 | Bacteria | 3628 |
| 315 | Ga0501047_0018334 | 3300049581 | Bacteria | 6708 |
| 316 | Ga0501047_0025612 | 3300049581 | Bacteria | 5671 |
| 317 | Ga0501047_0029991 | 3300049581 | Bacteria | 5244 |
| 318 | Ga0501047_0050464 | 3300049581 | Bacteria | 4018 |
| 319 | Ga0501047_0180447 | 3300049581 | Bacteria | 1978 |
| 320 | Ga0501067_0168292 | 3300049583 | Bacteria | 1221 |
| 321 | Ga0501071_0144515 | 3300049587 | Bacteria | 1773 |
| 322 | Ga0501072_0133088 | 3300049588 | Bacteria | 1983 |
| 323 | Ga0501080_0011665 | 3300049742 | Bacteria | 8049 |
| 324 | Ga0501083_0016175 | 3300049744 | Bacteria | 5223 |
| 325 | Ga0501035_0000102 | 3300049822 | Bacteria | 106915 |
| 326 | Ga0501035_0000950 | 3300049822 | Bacteria | 30620 |
| 327 | Ga0501044_0020712 | 3300049823 | Bacteria | 7019 |
| 328 | Ga0501044_0105376 | 3300049823 | Bacteria | 2832 |
| 329 | Ga0501044_0282309 | 3300049823 | Bacteria | 1594 |
| 330 | nmdc:mga03n38_106237_c1 | 3300050490 | Bacteria | 1361 |
| 331 | nmdc:mga00v17_206289_c1 | 3300050491 | Bacteria | 1271 |
| 332 | nmdc:mga00v17_21259_c1 | 3300050491 | Bacteria | 3729 |
| 333 | nmdc:mga00v17_261276_c1 | 3300050491 | Bacteria | 1123 |
| 334 | nmdc:mga00v17_556_c1 | 3300050491 | Bacteria | 20858 |
| 335 | nmdc:mga0yw44_19023_c1 | 3300050492 | Bacteria | 3778 |
| 336 | nmdc:mga0yw44_26440_c1 | 3300050492 | Bacteria | 3315 |
| 337 | nmdc:mga0k408_49705_c1 | 3300050493 | Bacteria | 2427 |
| 338 | nmdc:mga06z11_24472_c1 | 3300050494 | Bacteria | 2849 |
| 339 | nmdc:mga07m45_24675_c1 | 3300050496 | Bacteria | 3295 |
| 340 | nmdc:mga05p37_100388_c1 | 3300050507 | Bacteria | 3564 |
| 341 | nmdc:mga09592_564724_c1 | 3300050508 | Bacteria | 977 |
| 342 | nmdc:mga0qj67_84686_c1 | 3300050509 | Bacteria | 2542 |
| 343 | nmdc:mga08y16_62367_c1 | 3300050511 | Bacteria | 3893 |
| 344 | nmdc:mga0n895_8900_c1 | 3300050512 | Bacteria | 8746 |
| 345 | nmdc:mga0a205_336780_c1 | 3300050515 | Bacteria | 1378 |
| 346 | Ga0495655_0018261 | 3300053083 | Bacteria | 1539 |
| 347 | Ga0500643_021878 | 3300053087 | Bacteria | 2068 |
| 348 | Ga0500562_000800 | 3300053108 | Bacteria | 7686 |
| 349 | Ga0500572_001733 | 3300053111 | Bacteria | 5661 |
| 350 | Ga0500595_004093 | 3300053119 | Bacteria | 6617 |
| 351 | Ga0500607_159938 | 3300053121 | Bacteria | 1031 |
| 352 | Ga0500608_067653 | 3300053122 | Bacteria | 1702 |
| 353 | Ga0500618_000227 | 3300053125 | Bacteria | 44231 |
| 354 | Ga0500618_007584 | 3300053125 | Bacteria | 3082 |
| 355 | Ga0500652_006919 | 3300053131 | Bacteria | 3681 |
| 356 | Ga0500573_0001776 | 3300053140 | Bacteria | 10485 |
| 357 | Ga0500573_0012488 | 3300053140 | Bacteria | 4770 |
| 358 | Ga0500616_0001544 | 3300053153 | Bacteria | 21664 |
| 359 | Ga0500616_0006086 | 3300053153 | Bacteria | 7991 |
| 360 | Ga0500620_000690 | 3300053155 | Bacteria | 5782 |
| 361 | Ga0500627_0163785 | 3300053158 | Bacteria | 1003 |
| 362 | Ga0500633_0075135 | 3300053160 | Bacteria | 1214 |
| 363 | Ga0500634_0000112 | 3300053161 | Bacteria | 30260 |
| 364 | Ga0500634_0068617 | 3300053161 | Bacteria | 1862 |
| 365 | Ga0500636_0067626 | 3300053177 | Bacteria | 2075 |
| 366 | Ga0501082_0000811 | 3300060353 | Bacteria | 27462 |
| 367 | 2503203294 | 2503198000 | Bacteria | 6884444 |
| 368 | 2509116056 | 2508501123 | Bacteria | 6283661 |
| 369 | 2509141470 | 2508501127 | Bacteria | 7037543 |
| 370 | 2509371832 | 2509276018 | Bacteria | 6910194 |
| 371 | 2509397725 | 2509276022 | Bacteria | 6200534 |
| 372 | 2510318981 | 2510065059 | Bacteria | 6847884 |
| 373 | 2510839677 | 2510461069 | Bacteria | 5505000 |
| 374 | 2511174517 | 2510917026 | Bacteria | 7046020 |
| 375 | 2512929817 | 2512875016 | Bacteria | 6529530 |
| 376 | 2512964586 | 2512875024 | Bacteria | 7195110 |
| 377 | 2513590219 | 2513237087 | Bacteria | 5817514 |
| 378 | 2513609081 | 2513237090 | Bacteria | 7096802 |
| 379 | 2514033300 | 2513237164 | Bacteria | 7563725 |
| 380 | 2514420483 | 2513237305 | Bacteria | 7293571 |
| 381 | 2514588177 | 2513237351 | Bacteria | 6968952 |
| 382 | 2523102558 | 2522572158 | Bacteria | 6514390 |
| 383 | 2585231481 | 2582581299 | Bacteria | 6518058 |
| 384 | 2585278917 | 2582581308 | Bacteria | 7413247 |
| 385 | 2585325469 | 2582581315 | Bacteria | 7318924 |
| 386 | 2585329626 | 2582581316 | Bacteria | 7774528 |
| 387 | 2585530714 | 2585427527 | Bacteria | 7273426 |
| 388 | 2585554894 | 2585427530 | Bacteria | 7383882 |
| 389 | 2585995130 | 2585427633 | Bacteria | 6413184 |
| 390 | 2585999677 | 2585427634 | Bacteria | 6455027 |
| 391 | 2588515409 | 2588253730 | Bacteria | 6881675 |
| 392 | 2597815013 | 2597489875 | Bacteria | 7010078 |
| 393 | 2599106086 | 2597490356 | Bacteria | 7030811 |
| 394 | 2599333754 | 2599185156 | Bacteria | 5403036 |
| 395 | 2599602583 | 2599185210 | Bacteria | 5624189 |
| 396 | 2599722027 | 2599185236 | Bacteria | 6875203 |
| 397 | 2599937998 | 2599185301 | Bacteria | 6161860 |
| 398 | 2600375279 | 2600254933 | Bacteria | 4750527 |
| 399 | 2601608664 | 2600255279 | Bacteria | 5605316 |
| 400 | 2601745438 | 2600255308 | Bacteria | 5611129 |
| 401 | 2616305810 | 2615840626 | Bacteria | 7921970 |
| 402 | 2616553948 | 2615840698 | Bacteria | 7319877 |
| 403 | 2643773604 | 2643221550 | Bacteria | 4619371 |
| 404 | 2643775444 | 2643221551 | Bacteria | 3750538 |
| 405 | 2643793890 | 2643221555 | Bacteria | 3749717 |
| 406 | 2643809994 | 2643221558 | Bacteria | 5460675 |
| 407 | 2643837779 | 2643221564 | Bacteria | 4193379 |
| 408 | 2643985341 | 2643221595 | Bacteria | 6565519 |
| 409 | 2644155023 | 2643221627 | Bacteria | 6761570 |
| 410 | 2644196528 | 2643221634 | Bacteria | 6705461 |
| 411 | 2644242896 | 2643221643 | Bacteria | 5749658 |
| 412 | 2671115297 | 2667528174 | Bacteria | 6435400 |
| 413 | 2671692764 | 2671180139 | Bacteria | 4196045 |
| 414 | 2688600132 | 2687453392 | Bacteria | 6880454 |
| 415 | 2694633679 | 2693429783 | Bacteria | 7019804 |
| 416 | 2694639982 | 2693429784 | Bacteria | 7241525 |
| 417 | 2723577412 | 2721755686 | Bacteria | 7343952 |
| 418 | 2738946530 | 2738541317 | Bacteria | 5340176 |
| 419 | 2756673305 | 2756170246 | Bacteria | 7451806 |
| 420 | 2765465211 | 2765235802 | Bacteria | 5618596 |
| 421 | 2770197357 | 2767802442 | Bacteria | 5747986 |
| 422 | 2776912788 | 2775507049 | Bacteria | 6284736 |
| 423 | 2792749115 | 2791355123 | Bacteria | 8049106 |
| 424 | 2793353582 | 2791355265 | Bacteria | 6539969 |
| 425 | 2819639239 | 2818991453 | Bacteria | 7181617 |
| 426 | 2819684102 | 2818991461 | Bacteria | 7026071 |
| 427 | 2821124297 | 2821123053 | Bacteria | 7836056 |
| 428 | 2821449371 | 2821443989 | Bacteria | 7658172 |
| 429 | 2837681212 | 2837678835 | Bacteria | 5252418 |
| 430 | 2838031436 | 2838029111 | Bacteria | 6603031 |
| 431 | 2838741210 | 2838736955 | Bacteria | 5760694 |
| 432 | 2841741125 | 2841734538 | Bacteria | 6784580 |
| 433 | 2841844893 | 2841840854 | Bacteria | 5761912 |
| 434 | 2842144615 | 2842140634 | Bacteria | 5759631 |
| 435 | 2842333655 | 2842333319 | Bacteria | 8899485 |
| 436 | 2842477969 | 2842475841 | Bacteria | 6603183 |
| 437 | 2842482863 | 2842482326 | Bacteria | 7212537 |
| 438 | 2842504778 | 2842502639 | Bacteria | 6604161 |
| 439 | 2842509738 | 2842509118 | Bacteria | 6850950 |
| 440 | 2842924808 | 2842922631 | Bacteria | 5824079 |
| 441 | 2844005766 | 2844002411 | Bacteria | 7168230 |
| 442 | 2844015444 | 2844009547 | Bacteria | 6728125 |
| 443 | 2844533647 | 2844533157 | Bacteria | 7517899 |
| 444 | 2846955880 | 2846952575 | Bacteria | 6587527 |
| 445 | 2847671814 | 2847670302 | Bacteria | 6165597 |
| 446 | 2847688045 | 2847686936 | Bacteria | 6278406 |
| 447 | 2848862299 | 2848858292 | Bacteria | 7391279 |
| 448 | 2854683558 | 2854681122 | Bacteria | 4548679 |
| 449 | 2854897195 | 2854896431 | Bacteria | 5869725 |
| 450 | 2854918185 | 2854916844 | Bacteria | 5725939 |
| 451 | 2856318456 | 2856314179 | Bacteria | 6477897 |
| 452 | 2856324408 | 2856320880 | Bacteria | 7263508 |
| 453 | 2856333387 | 2856328259 | Bacteria | 6528202 |
| 454 | 2856335712 | 2856334872 | Bacteria | 7037011 |
| 455 | 2856345456 | 2856342000 | Bacteria | 7176905 |
| 456 | 2856350409 | 2856349417 | Bacteria | 6230045 |
| 457 | 2856362074 | 2856356410 | Bacteria | 6297484 |
| 458 | 2856364609 | 2856364286 | Bacteria | 6939991 |
| 459 | 2857355865 | 2857349434 | Bacteria | 7926032 |
| 460 | 2857375518 | 2857367948 | Bacteria | 6965560 |
| 461 | 2857531877 | 2857531043 | Bacteria | 6754041 |
| 462 | 2869165012 | 2869162929 | Bacteria | 6399702 |
| 463 | 2869175763 | 2869169390 | Bacteria | 6659796 |
| 464 | 2869240244 | 2869234852 | Bacteria | 6654993 |
| 465 | 2869248585 | 2869242130 | Bacteria | 6609239 |
| 466 | 2869256484 | 2869249662 | Bacteria | 6868783 |
| 467 | 2869260184 | 2869256925 | Bacteria | 6981691 |
| 468 | 2869264435 | 2869264136 | Bacteria | 6880765 |
| 469 | 2869276513 | 2869271264 | Bacteria | 6908218 |
| 470 | 2869281594 | 2869278585 | Bacteria | 7077053 |
| 471 | 2869292718 | 2869285874 | Bacteria | 6901219 |
| 472 | 2871429531 | 2871429161 | Bacteria | 6547891 |
| 473 | 2871456680 | 2871451962 | Bacteria | 7336357 |
| 474 | 2871462212 | 2871459585 | Bacteria | 6866887 |
| 475 | 2871470002 | 2871466892 | Bacteria | 6923287 |
| 476 | 2871478512 | 2871474448 | Bacteria | 6806570 |
| 477 | 2871488446 | 2871481445 | Bacteria | 6700002 |
| 478 | 2871493934 | 2871488783 | Bacteria | 6929816 |
| 479 | 2871498448 | 2871495908 | Bacteria | 6935695 |
| 480 | 2874103817 | 2874102143 | Bacteria | 6342645 |
| 481 | 2874111271 | 2874109183 | Bacteria | 6517025 |
| 482 | 2874120114 | 2874116593 | Bacteria | 6674494 |
| 483 | 2874127563 | 2874123672 | Bacteria | 7238285 |
| 484 | 2874132698 | 2874131515 | Bacteria | 6820270 |
| 485 | 2874140742 | 2874139085 | Bacteria | 7021506 |
| 486 | 2874146994 | 2874146452 | Bacteria | 7533118 |
| 487 | 2874157026 | 2874155637 | Bacteria | 6724144 |
| 488 | 2874163468 | 2874162495 | Bacteria | 6174670 |
| 489 | 2874175451 | 2874168670 | Bacteria | 8062617 |
| 490 | 2876366620 | 2876363079 | Bacteria | 6544991 |
| 491 | 2876372266 | 2876369609 | Bacteria | 6807521 |
| 492 | 2876379667 | 2876377896 | Bacteria | 6565995 |
| 493 | 2876388113 | 2876386047 | Bacteria | 6698674 |
| 494 | 2876399477 | 2876392853 | Bacteria | 6660880 |
| 495 | 2876406245 | 2876399893 | Bacteria | 6927900 |
| 496 | 2876411932 | 2876406927 | Bacteria | 6191900 |
| 497 | 2876414465 | 2876413966 | Bacteria | 6831344 |
| 498 | 2876424469 | 2876420981 | Bacteria | 6687741 |
| 499 | 2878037792 | 2878035449 | Bacteria | 6555736 |
| 500 | 2878742523 | 2878738818 | Bacteria | 7136951 |
| 501 | 2878746297 | 2878745973 | Bacteria | 6867388 |
| 502 | 2878756510 | 2878753008 | Bacteria | 6922523 |
| 503 | 2878762667 | 2878760144 | Bacteria | 6823465 |
| 504 | 2878769633 | 2878767105 | Bacteria | 6898628 |
| 505 | 2878775917 | 2878774303 | Bacteria | 6108671 |
| 506 | 2878783626 | 2878781027 | Bacteria | 6834456 |
| 507 | 2878793530 | 2878788777 | Bacteria | 6567085 |
| 508 | 2881153654 | 2881147464 | Bacteria | 7779814 |
| 509 | 2881157451 | 2881155292 | Bacteria | 6461656 |
| 510 | 2881162809 | 2881161766 | Bacteria | 7127907 |
| 511 | 2881847017 | 2881845957 | Bacteria | 6611900 |
| 512 | 2881857060 | 2881853255 | Bacteria | 6698367 |
| 513 | 2881867287 | 2881861095 | Bacteria | 7128710 |
| 514 | 2882634377 | 2882632389 | Bacteria | 8154593 |
| 515 | 2882915271 | 2882912400 | Bacteria | 6801539 |
| 516 | 2885311559 | 2885305155 | Bacteria | 7348390 |
| 517 | 2885316396 | 2885312484 | Bacteria | 6415165 |
| 518 | 2885321161 | 2885318864 | Bacteria | 6729568 |
| 519 | 2885327065 | 2885326080 | Bacteria | 7134805 |
| 520 | 2885349999 | 2885342637 | Bacteria | 7011821 |
| 521 | 2885356052 | 2885350715 | Bacteria | 6787678 |
| 522 | 2888341306 | 2888337043 | Bacteria | 6629336 |
| 523 | 2888348490 | 2888343758 | Bacteria | 6611049 |
| 524 | 2889012970 | 2889010040 | Bacteria | 6749192 |
| 525 | 2889022162 | 2889016732 | Bacteria | 6700763 |
| 526 | 2891051624 | 2891048133 | Bacteria | 4447501 |
| 527 | 2899261802 | 2899259804 | Bacteria | 3320927 |
| 528 | 2899803788 | 2899803654 | Bacteria | 5577784 |
| 529 | 2903452796 | 2903448605 | Bacteria | 7357801 |
| 530 | 2903500639 | 2903492973 | Bacteria | 13473544 |
| 531 | 2903502562 | 2903492973 | Bacteria | 13473544 |
| 532 | 2903518240 | 2903513507 | Bacteria | 6344008 |
| 533 | 2903524487 | 2903521522 | Bacteria | 6525694 |
| 534 | 2903530118 | 2903528002 | Bacteria | 6586099 |
| 535 | 2903543246 | 2903540706 | Bacteria | 7062119 |
| 536 | 2904581381 | 2904578770 | Bacteria | 5302906 |
| 537 | 2904666004 | 2904659560 | Bacteria | 6685615 |
| 538 | 2906308430 | 2906308376 | Bacteria | 6841989 |
| 539 | 2906321978 | 2906321335 | Bacteria | 6579571 |
| 540 | 2906331212 | 2906328253 | Bacteria | 6585166 |
| 541 | 2906355772 | 2906354277 | Bacteria | 6991324 |
| 542 | 2906375479 | 2906370794 | Bacteria | 6881062 |
| 543 | 2906386883 | 2906386501 | Bacteria | 5977019 |
| 544 | 2906411685 | 2906408224 | Bacteria | 6162342 |
| 545 | 2906418493 | 2906414383 | Bacteria | 6580790 |
| 546 | 2913310947 | 2913308742 | Bacteria | 5350706 |
| 547 | 2919122617 | 2919119836 | Bacteria | 5208557 |
| 548 | 2919167379 | 2919166419 | Bacteria | 4952238 |
| 549 | 2919171408 | 2919171160 | Bacteria | 6499771 |
| 550 | 2919409318 | 2919408235 | Bacteria | 6149349 |
| 551 | 2922137674 | 2922130491 | Bacteria | 7173936 |
| 552 | 2922154110 | 2922151315 | Bacteria | 6902399 |
| 553 | 2922165445 | 2922158528 | Bacteria | 6573167 |
| 554 | 2922176873 | 2922172374 | Bacteria | 6167644 |
| 555 | 2922193034 | 2922185730 | Bacteria | 7113964 |
| 556 | 2924735385 | 2924733363 | Bacteria | 7574837 |
| 557 | 2924743055 | 2924741084 | Bacteria | 6661321 |
| 558 | 2924751453 | 2924748358 | Bacteria | 6154725 |
| 559 | 2924756390 | 2924754689 | Bacteria | 6774424 |
| 560 | 2924764629 | 2924762789 | Bacteria | 6561353 |
| 561 | 2924780323 | 2924776078 | Bacteria | 7492003 |
| 562 | 2924788095 | 2924784321 | Bacteria | 7416538 |
| 563 | 2933595079 | 2933594066 | Bacteria | 5594265 |
| 564 | 2937814357 | 2937813078 | Bacteria | 7783518 |
| 565 | 2937829281 | 2937822353 | Bacteria | 7290551 |
| 566 | 2937840500 | 2937836603 | Bacteria | 6811263 |
| 567 | 2937852405 | 2937848649 | Bacteria | 6983481 |
| 568 | 2937862744 | 2937861824 | Bacteria | 6660327 |
| 569 | 2937882845 | 2937877337 | Bacteria | 7246526 |
| 570 | 2937891484 | 2937891427 | Bacteria | 6357007 |
| 571 | 2937973182 | 2937972304 | Bacteria | 7532020 |
| 572 | 2937986440 | 2937980651 | Bacteria | 6517427 |
| 573 | 2937997095 | 2937994558 | Bacteria | 7036190 |
| 574 | 2938015505 | 2938014810 | Bacteria | 6700592 |
| 575 | 2958037555 | 2958034702 | Bacteria | 6989922 |
| 576 | 2958046732 | 2958041894 | Bacteria | 13082850 |
| 577 | 2958047266 | 2958041894 | Bacteria | 13082850 |
| 578 | 2958068678 | 2958064165 | Bacteria | 7158582 |
| 579 | 2958071375 | 2958071322 | Bacteria | 6815895 |
| 580 | 2958089970 | 2958084443 | Bacteria | 7312792 |
| 581 | 2958105461 | 2958100919 | Bacteria | 6800575 |
| 582 | 2958112382 | 2958108152 | Bacteria | 6681128 |
| 583 | 2958116990 | 2958115193 | Bacteria | 6923548 |
| 584 | 2958126408 | 2958122699 | Bacteria | 7280457 |
| 585 | 2958137389 | 2958130278 | Bacteria | 6897202 |
| 586 | 2958148992 | 2958144490 | Bacteria | 6677056 |
| 587 | 2958167565 | 2958165035 | Bacteria | 6906348 |
| 588 | 2958177389 | 2958172287 | Bacteria | 6716688 |
| 589 | 2958180234 | 2958179912 | Bacteria | 6874908 |
| 590 | 2961078066 | 2961077736 | Bacteria | 7079850 |
| 591 | 2961121348 | 2961114664 | Bacteria | 6680456 |
| 592 | 2961135143 | 2961127735 | Bacteria | 7196641 |
| 593 | 2961143484 | 2961136820 | Bacteria | 6775228 |
| 594 | 2961166037 | 2961163497 | Bacteria | 6901077 |
| 595 | 2961172799 | 2961170736 | Bacteria | 7072258 |
| 596 | 2961190646 | 2961183825 | Bacteria | 6688536 |
| 597 | 2963649414 | 2963644680 | Bacteria | 6530403 |
| 598 | 2965020856 | 2965018300 | Bacteria | 6883036 |
| 599 | 2965030659 | 2965025482 | Bacteria | 6532201 |
| 600 | 2965046029 | 2965040258 | Bacteria | 6855979 |
| 601 | 2965053313 | 2965047637 | Bacteria | 6623551 |
| 602 | 2965062816 | 2965062239 | Bacteria | 7412989 |
| 603 | 2965095116 | 2965089291 | Bacteria | 6866420 |
| 604 | 2965107272 | 2965102966 | Bacteria | 6800987 |
| 605 | 2965120111 | 2965119406 | Bacteria | 6956431 |
| 606 | 2967998011 | 2967996073 | Bacteria | 6787468 |
| 607 | 2968008662 | 2968003550 | Bacteria | 6929263 |
| 608 | 2968019611 | 2968016561 | Bacteria | 7022047 |
| 609 | 2968084577 | 2968083720 | Bacteria | 7351627 |
| 610 | 2968096905 | 2968091066 | Bacteria | 6052692 |
| 611 | 2968102384 | 2968097103 | Bacteria | 6107094 |
| 612 | 2968117501 | 2968110612 | Bacteria | 6814636 |
| 613 | 2968118284 | 2968117919 | Bacteria | 6536078 |
| 614 | 2968131096 | 2968128360 | Bacteria | 6270294 |
| 615 | 2968146102 | 2968138860 | Bacteria | 6605449 |
| 616 | 2968174434 | 2968171901 | Bacteria | 6894245 |
| 617 | 2970472932 | 2970469710 | Bacteria | 6969209 |
| 618 | 2970492078 | 2970489779 | Bacteria | 6517260 |
| 619 | 2970505393 | 2970503327 | Bacteria | 7099517 |
| 620 | 2970512514 | 2970510686 | Bacteria | 7006402 |
| 621 | 2970529707 | 2970524798 | Bacteria | 6840927 |
| 622 | 2970535252 | 2970532167 | Bacteria | 6553173 |
| 623 | 2970545087 | 2970540015 | Bacteria | 6977556 |
| 624 | 2970551110 | 2970547951 | Bacteria | 6931819 |
| 625 | 2970557525 | 2970554993 | Bacteria | 6814252 |
| 626 | 2970596197 | 2970593180 | Bacteria | 7073582 |
| 627 | 2970624992 | 2970619444 | Bacteria | 6986144 |
| 628 | 2970627372 | 2970627176 | Bacteria | 6680862 |
| 629 | 2977825691 | 2977821940 | Bacteria | 6906439 |
| 630 | 2977832260 | 2977828996 | Bacteria | 7007971 |
| 631 | 2977844864 | 2977843712 | Bacteria | 6753583 |
| 632 | 2977862824 | 2977858184 | Bacteria | 6215359 |
| 633 | 2977869569 | 2977864932 | Bacteria | 7534097 |
| 634 | 2977873749 | 2977872689 | Bacteria | 7270173 |
| 635 | 2977914993 | 2977907340 | Bacteria | 6577984 |
| 636 | 2977915314 | 2977915119 | Bacteria | 6829656 |
| 637 | 2977927225 | 2977922695 | Bacteria | 6956781 |
| 638 | 2977937007 | 2977935797 | Bacteria | 6252826 |
| 639 | 2977943844 | 2977942078 | Bacteria | 7570577 |
| 640 | 2977954377 | 2977950692 | Bacteria | 6893264 |
| 641 | 2977960054 | 2977957713 | Bacteria | 6877875 |
| 642 | 2977972511 | 2977971508 | Bacteria | 7472917 |
| 643 | 2977989923 | 2977986579 | Bacteria | 6581278 |
| 644 | 2979751392 | 2979742915 | Bacteria | 7301278 |
| 645 | 2979770064 | 2979764755 | Bacteria | 6610066 |
| 646 | 2979779447 | 2979772303 | Bacteria | 6618277 |
| 647 | 2979785945 | 2979779861 | Bacteria | 6219781 |
| 648 | 2979794270 | 2979793036 | Bacteria | 6808957 |
| 649 | 2979810114 | 2979808191 | Bacteria | 7179355 |
| 650 | 2987639679 | 2987636660 | Bacteria | 8088555 |
| 651 | 2987648775 | 2987645492 | Bacteria | 6117018 |
| 652 | 2987658667 | 2987652177 | Bacteria | 6969023 |
| 653 | 2987662044 | 2987659509 | Bacteria | 6966464 |
| 654 | 2987667433 | 2987666974 | Bacteria | 6509233 |
| 655 | 2987674016 | 2987673487 | Bacteria | 6884027 |
| 656 | 2995393784 | 2995392953 | Bacteria | 4539380 |
| 657 | 2996313323 | 2996310559 | Bacteria | 6357320 |
| 658 | 2996342532 | 2996341866 | Bacteria | 6643098 |
| 659 | 2996351948 | 2996348954 | Bacteria | 7239054 |
| 660 | 2996392344 | 2996386984 | Bacteria | 6978667 |
| 661 | 3000018631 | 3000017691 | Bacteria | 3772574 |
| 662 | 3000141853 | 3000135777 | Bacteria | 6891109 |
| 663 | 3004170901 | 3004167301 | Bacteria | 8330599 |
| 664 | 3004191095 | 3004188549 | Bacteria | 6952365 |
| 665 | 3004199916 | 3004195979 | Bacteria | 6776956 |
| 666 | 3004207252 | 3004203850 | Bacteria | 7307914 |
| 667 | 3004214644 | 3004211236 | Bacteria | 7417683 |
| 668 | 3004219327 | 3004218560 | Bacteria | 7421728 |
| 669 | 3004238116 | 3004232784 | Bacteria | 6662140 |
| 670 | 3004240345 | 3004239961 | Bacteria | 6892290 |
| 671 | 3004252837 | 3004248173 | Bacteria | 6563236 |
| 672 | 3004273132 | 3004268573 | Bacteria | 7043476 |
| 673 | 3004278646 | 3004275668 | Bacteria | 7114440 |
| 674 | 3004295124 | 3004289098 | Bacteria | 6135450 |
| 675 | 3004339398 | 3004334049 | Bacteria | 8449246 |
| 676 | 637079561 | 637000159 | Bacteria | 7596297 |
| 677 | 649874609 | 649633066 | Bacteria | 6690028 |
| 678 | 8004301768 | 8004300914 | Bacteria | 6132239 |
| 679 | 8004321170 | 8004312739 | Bacteria | 7444653 |
| 680 | 8004365565 | 8004361976 | Bacteria | 6858373 |
| 681 | 8004378099 | 8004374579 | Bacteria | 6898112 |
| 682 | 8004388462 | 8004387939 | Bacteria | 7049250 |
| 683 | 8004401866 | 8004395343 | Bacteria | 6620908 |
| 684 | 8004450704 | 8004445564 | Bacteria | 6322258 |
| 685 | 8004634181 | 8004633249 | Bacteria | 6723080 |
| 686 | 8004641754 | 8004640170 | Bacteria | 6723001 |
| 687 | 8004700628 | 8004695233 | Bacteria | 6731676 |
| 688 | 8004710872 | 8004703790 | Bacteria | 8006957 |
| 689 | 8004714686 | 8004714634 | Bacteria | 6776161 |
| 690 | 8004731419 | 8004727605 | Bacteria | 6643904 |
| 691 | 8005684559 | 8005682033 | Bacteria | 6726518 |
| 692 | 8018152543 | 8018150411 | Bacteria | 5549903 |
| 693 | 8055434205 | 8055431914 | Bacteria | 4551896 |
| 694 | 8055622703 | 8055617313 | Bacteria | 7548464 |
| 695 | Ga0500637_0009988 | |||
| 696 | JGI24740J21852_10001214 | |||
| 697 | JGI24740J21852_10004386 | |||
| 698 | JGI24740J21852_10052704 | |||
| 699 | JGI25155J39150_1000032 | |||
| 700 | JGI25156J39149_1000129 | |||
| 701 | JGI25162J39368_1000676 | |||
| 702 | JGI25162J39368_1001230 | |||
| 703 | JGI25154J39366_1000324 | |||
| 704 | JGI25154J39366_1001340 | |||
| 705 | JGI25157J39369_1000061 | |||
| 706 | JGI25151J46595_10000192 | |||
| 707 | JGI25406J46586_10006486 | |||
| 708 | JGI25165J46597_1000028 | |||
| 709 | JGI25165J46597_1001649 | |||
| 710 | JGI25165J46597_1001657 | |||
| 711 | JGI25153J46596_10016299 | |||
| 712 | rootH1_10095545 | |||
| 713 | Ga0055542_1001417 | |||
| 714 | Ga0055536_1001177 | |||
| 715 | Ga0055540_1001974 | |||
| 716 | Ga0055531_10003014 | |||
| 717 | Ga0058692_1001868 | |||
| 718 | Ga0065165_1002531 | |||
| 719 | Ga0070683_100183995 | |||
| 720 | Ga0070670_100001700 | |||
| 721 | Ga0070670_100080028 | |||
| 722 | Ga0068869_100052973 | |||
| 723 | Ga0070680_100172908 | |||
| 724 | Ga0070660_100019894 | |||
| 725 | Ga0070660_100474035 | |||
| 726 | Ga0070661_100159659 | |||
| 727 | Ga0070668_100008467 | |||
| 728 | Ga0070669_100046389 | |||
| 729 | Ga0070675_100093086 | |||
| 730 | Ga0070674_100006650 | |||
| 731 | Ga0070667_100023391 | |||
| 732 | Ga0070681_10006925 | |||
| 733 | Ga0070681_10007314 | |||
| 734 | Ga0068867_100138010 | |||
| 735 | Ga0068867_100181272 | |||
| 736 | Ga0068853_100256899 | |||
| 737 | Ga0068853_100314655 | |||
| 738 | Ga0070672_100083788 | |||
| 739 | Ga0070696_100057745 | |||
| 740 | Ga0070665_100029356 | |||
| 741 | Ga0068855_100029275 | |||
| 742 | Ga0068855_100514237 | |||
| 743 | Ga0068856_100241901 | |||
| 744 | Ga0068856_100278244 | |||
| 745 | Ga0068852_100065931 | |||
| 746 | Ga0068852_100089570 | |||
| 747 | Ga0068864_100101980 | |||
| 748 | Ga0068861_100395306 | |||
| 749 | Ga0068860_100035203 | |||
| 750 | Ga0068862_100007560 | |||
| 751 | Ga0068862_100026297 | |||
| 752 | Ga0081539_10001131 | |||
| 753 | Ga0075365_10005167 | |||
| 754 | Ga0075368_10023034 | |||
| 755 | Ga0075363_100022794 | |||
| 756 | Ga0075363_100290793 | |||
| 757 | Ga0075364_10003667 | |||
| 758 | Ga0075364_10025065 | |||
| 759 | Ga0075364_10066637 | |||
| 760 | Ga0075364_10238721 | |||
| 761 | Ga0075367_10034225 | |||
| 762 | Ga0075367_10051599 | |||
| 763 | Ga0075367_10067879 | |||
| 764 | Ga0075367_10110435 | |||
| 765 | Ga0075369_10074628 | |||
| 766 | Ga0075369_10175854 | |||
| 767 | Ga0075370_10025852 | |||
| 768 | Ga0075370_10097326 | |||
| 769 | Ga0075428_100416352 | |||
| 770 | Ga0075430_100183521 | |||
| 771 | Ga0075430_100185697 | |||
| 772 | Ga0075431_100206251 | |||
| 773 | Ga0075433_10252023 | |||
| 774 | Ga0075429_100560990 | |||
| 775 | Ga0079104_1000032 | |||
| 776 | Ga0099826_10001725 | |||
| 777 | Ga0105240_10000032 | |||
| 778 | Ga0105240_10013259 | |||
| 779 | Ga0105240_10142359 | |||
| 780 | Ga0105240_10250849 | |||
| 781 | Ga0111539_10119641 | |||
| 782 | Ga0114129_10312268 | |||
| 783 | Ga0105241_10093597 | |||
| 784 | Ga0105241_10476011 | |||
| 785 | Ga0105242_10546590 | |||
| 786 | Ga0105248_10360355 | |||
| 787 | Ga0105237_10000754 | |||
| 788 | Ga0105237_10697015 | |||
| 789 | Ga0105238_10321139 | |||
| 790 | Ga0105238_10553860 | |||
| 791 | Ga0105249_10212467 | |||
| 792 | Ga0105239_10058313 | |||
| 793 | Ga0105239_10067623 | |||
| 794 | Ga0105239_10199662 | |||
| 795 | Ga0105239_10393531 | |||
| 796 | Ga0105239_10554858 | |||
| 797 | Ga0157373_10012663 | |||
| 798 | Ga0157371_10017171 | |||
| 799 | Ga0157370_10000972 | |||
| 800 | Ga0157370_10068924 | |||
| 801 | Ga0157370_10425196 | |||
| 802 | Ga0157369_10057945 | |||
| 803 | Ga0157374_10226926 | |||
| 804 | Ga0157372_10220544 | |||
| 805 | Ga0182008_10029256 | |||
| 806 | Ga0182007_10019077 | |||
| 807 | Ga0182005_1005393 | |||
| 808 | Ga0213872_10000693 | |||
| 809 | Ga0213872_10008428 | |||
| 810 | Ga0213874_10029116 | |||
| 811 | Ga0213876_10000134 | |||
| 812 | Ga0209435_100042 | |||
| 813 | Ga0209437_100033 | |||
| 814 | Ga0209437_100075 | |||
| 815 | Ga0209437_107205 | |||
| 816 | Ga0209646_1000145 | |||
| 817 | Ga0209026_1000120 | |||
| 818 | Ga0209026_1000160 | |||
| 819 | Ga0209677_101323 | |||
| 820 | Ga0209148_1000056 | |||
| 821 | Ga0209759_1000177 | |||
| 822 | Ga0209759_1000368 | |||
| 823 | Ga0209233_1000056 | |||
| 824 | Ga0209233_1000064 | |||
| 825 | Ga0209233_1000087 | |||
| 826 | Ga0209233_1000209 | |||
| 827 | Ga0209233_1009458 | |||
| 828 | Ga0209455_1000137 | |||
| 829 | Ga0209676_1002466 | |||
| 830 | Ga0209025_1000077 | |||
| 831 | Ga0209758_1000554 | |||
| 832 | Ga0209758_1003923 | |||
| 833 | Ga0209758_1004764 | |||
| 834 | Ga0209050_1010473 | |||
| 835 | Ga0209051_1000459 | |||
| 836 | Ga0209257_1002585 | |||
| 837 | Ga0207707_10010344 | |||
| 838 | Ga0207707_10028728 | |||
| 839 | Ga0207695_10000024 | |||
| 840 | Ga0207695_10003143 | |||
| 841 | Ga0207695_10015043 | |||
| 842 | Ga0207671_10000718 | |||
| 843 | Ga0207671_10064787 | |||
| 844 | Ga0207660_10077156 | |||
| 845 | Ga0207660_10110648 | |||
| 846 | Ga0207657_10090293 | |||
| 847 | Ga0207681_10140543 | |||
| 848 | Ga0207650_10025936 | |||
| 849 | Ga0207659_10044372 | |||
| 850 | Ga0207711_10262745 | |||
| 851 | Ga0207689_10065924 | |||
| 852 | Ga0207667_10020984 | |||
| 853 | Ga0207667_10222472 | |||
| 854 | Ga0207712_10059712 | |||
| 855 | Ga0207668_10001888 | |||
| 856 | Ga0207640_10043430 | |||
| 857 | Ga0207658_10016989 | |||
| 858 | Ga0207639_10092724 | |||
| 859 | Ga0207639_10387256 | |||
| 860 | Ga0207702_10145723 | |||
| 861 | Ga0207648_10079288 | |||
| 862 | Ga0207648_10083342 | |||
| 863 | Ga0207648_10092376 | |||
| 864 | Ga0209281_1000053 | |||
| 865 | Ga0209371_1001029 | |||
| 866 | Ga0209282_1000102 | |||
| 867 | Ga0209813_10028846 | |||
| 868 | Ga0207428_10142070 | |||
| 869 | Ga0268266_10044390 | |||
| 870 | Ga0268266_10241232 | |||
| 871 | Ga0268266_10246104 | |||
| 872 | Ga0268265_10048603 | |||
| 873 | Ga0268264_10021248 | |||
| 874 | Ga0307515_10000070 | |||
| 875 | Ga0265338_10030725 | |||
| 876 | Ga0268256_1001309 | |||
| 877 | Ga0265331_10002627 | |||
| 878 | Ga0265331_10028764 | |||
| 879 | Ga0265327_10000190 | |||
| 880 | Ga0265316_10027899 | |||
| 881 | Ga0265316_10057177 | |||
| 882 | Ga0307513_10008189 | |||
| 883 | Ga0307516_10000004 | |||
| 884 | Ga0307413_10128578 | |||
| 885 | Ga0307410_10120870 | |||
| 886 | Ga0307407_10194377 | |||
| 887 | Ga0307416_100227722 | |||
| 888 | Ga0395899_0000213 | |||
| 889 | Ga0395899_0141708 | |||
| 890 | Ga0395899_0511327 | |||
| 891 | Ga0395900_0000121 | |||
| 892 | Ga0395900_0011881 | |||
| 893 | Ga0395900_0217756 | |||
| 894 | Ga0395900_0246857 | |||
| 895 | Ga0395900_0280327 | |||
| 896 | Ga0395898_0000247 | |||
| 897 | Ga0395898_0085187 | |||
| 898 | Ga0395898_0603117 | |||
| 899 | Ga0395905_0000112 | |||
| 900 | Ga0395905_0018071 | |||
| 901 | Ga0395905_0055874 | |||
| 902 | Ga0436364_1313619 | |||
| 903 | Ga0395901_0000078 | |||
| 904 | Ga0395901_0007884 | |||
| 905 | Ga0395901_0030144 | |||
| 906 | Ga0395901_0064543 | |||
| 907 | Ga0400483_138427 | |||
| 908 | Ga0400483_157157 | |||
| 909 | Ga0400483_178012 | |||
| 910 | Ga0436365_0881464 | |||
| 911 | Ga0436365_1830840 | |||
| 912 | Ga0436361_0187236 | |||
| 913 | Ga0436361_0206950 | |||
| 914 | Ga0436363_1297661 | |||
| 915 | Ga0451855_1869378 | |||
| 916 | Ga0466972_0168153 | |||
| 917 | Ga0453684_0061971 | |||
| 918 | Ga0466968_0060343 | |||
| 919 | Ga0466960_0114492 | |||
| 920 | Ga0451576_0002273 | |||
| 921 | Ga0495638_0002756 | |||
| 922 | Ga0495607_0102276 | |||
| 923 | Ga0495607_0105419 | |||
| 924 | Ga0495583_0004487 | |||
| 925 | Ga0495606_0011595 | |||
| 926 | Ga0495606_0076436 | |||
| 927 | Ga0495610_0021290 | |||
| 928 | Ga0495637_0066954 | |||
| 929 | Ga0495643_0048138 | |||
| 930 | Ga0495648_0165350 | |||
| 931 | Ga0495654_0000092 | |||
| 932 | Ga0495597_0032202 | |||
| 933 | Ga0495633_0009132 | |||
| 934 | Ga0495633_0126357 | |||
| 935 | Ga0495656_0161522 | |||
| 936 | Ga0495668_0046834 | |||
| 937 | Ga0495625_0051172 | |||
| 938 | Ga0495669_0000001 | |||
| 939 | Ga0495613_0000964 | |||
| 940 | Ga0495670_0203564 | |||
| 941 | Ga0495660_0067953 | |||
| 942 | Ga0495673_0137288 | |||
| 943 | Ga0496102_0020221 | |||
| 944 | Ga0496107_0173742 | |||
| 945 | Ga0496110_0370540 | |||
| 946 | Ga0496111_0000236 | |||
| 947 | Ga0496111_0431528 | |||
| 948 | Ga0496112_0010289 | |||
| 949 | Ga0496113_0090953 | |||
| 950 | Ga0496116_0000036 | |||
| 951 | Ga0496116_0000123 | |||
| 952 | Ga0496116_0055212 | |||
| 953 | Ga0496117_0005581 | |||
| 954 | Ga0496117_0013040 | |||
| 955 | Ga0496118_0002790 | |||
| 956 | Ga0496118_0003518 | |||
| 957 | Ga0496118_0013692 | |||
| 958 | Ga0496118_0052275 | |||
| 959 | Ga0496119_0000208 | |||
| 960 | Ga0496119_0018528 | |||
| 961 | Ga0496119_0030665 | |||
| 962 | Ga0496120_0000781 | |||
| 963 | Ga0496121_0001948 | |||
| 964 | Ga0496121_0004987 | |||
| 965 | Ga0496121_0096399 | |||
| 966 | Ga0496121_0340326 | |||
| 967 | Ga0496122_0000160 | |||
| 968 | Ga0496122_0004196 | |||
| 969 | Ga0496122_0006797 | |||
| 970 | Ga0496122_0019960 | |||
| 971 | Ga0496122_0030419 | |||
| 972 | Ga0496122_0041368 | |||
| 973 | Ga0496122_0078027 | |||
| 974 | Ga0496123_0000034 | |||
| 975 | Ga0496123_0004429 | |||
| 976 | Ga0496123_0009397 | |||
| 977 | Ga0496124_0000349 | |||
| 978 | Ga0496124_0006016 | |||
| 979 | Ga0496124_0008594 | |||
| 980 | Ga0496124_0037757 | |||
| 981 | Ga0496124_0072319 | |||
| 982 | Ga0496124_0282378 | |||
| 983 | Ga0496124_0316671 | |||
| 984 | Ga0496125_0025328 | |||
| 985 | Ga0496126_0000156 | |||
| 986 | Ga0496126_0036343 | |||
| 987 | Ga0496126_0233016 | |||
| 988 | Ga0496126_0253397 | |||
| 989 | Ga0496126_0403878 | |||
| 990 | Ga0501031_0002553 | |||
| 991 | Ga0501032_0000025 | |||
| 992 | Ga0501032_0206680 | |||
| 993 | Ga0501033_0000229 | |||
| 994 | Ga0501033_0000742 | |||
| 995 | Ga0501033_0330678 | |||
| 996 | Ga0501034_0000189 | |||
| 997 | Ga0501034_0001654 | |||
| 998 | Ga0501034_0024556 | |||
| 999 | Ga0501034_0150335 | |||
| 1000 | Ga0501034_0435433 | |||
| 1001 | Ga0501036_0001402 | |||
| 1002 | Ga0501037_0000176 | |||
| 1003 | Ga0501038_0000862 | |||
| 1004 | Ga0501039_0000003 | |||
| 1005 | Ga0501043_0000051 | |||
| 1006 | Ga0501043_0168340 | |||
| 1007 | Ga0501043_0185702 | |||
| 1008 | Ga0501046_0042431 | |||
| 1009 | Ga0501047_0018334 | |||
| 1010 | Ga0501047_0025612 | |||
| 1011 | Ga0501047_0029991 | |||
| 1012 | Ga0501047_0050464 | |||
| 1013 | Ga0501047_0180447 | |||
| 1014 | Ga0501067_0168292 | |||
| 1015 | Ga0501071_0144515 | |||
| 1016 | Ga0501072_0133088 | |||
| 1017 | Ga0501080_0011665 | |||
| 1018 | Ga0501083_0016175 | |||
| 1019 | Ga0501035_0000102 | |||
| 1020 | Ga0501035_0000950 | |||
| 1021 | Ga0501044_0020712 | |||
| 1022 | Ga0501044_0105376 | |||
| 1023 | Ga0501044_0282309 | |||
| 1024 | nmdc:mga03n38_106237_c1 | |||
| 1025 | nmdc:mga00v17_206289_c1 | |||
| 1026 | nmdc:mga00v17_21259_c1 | |||
| 1027 | nmdc:mga00v17_261276_c1 | |||
| 1028 | nmdc:mga00v17_556_c1 | |||
| 1029 | nmdc:mga0yw44_19023_c1 | |||
| 1030 | nmdc:mga0yw44_26440_c1 | |||
| 1031 | nmdc:mga0k408_49705_c1 | |||
| 1032 | nmdc:mga06z11_24472_c1 | |||
| 1033 | nmdc:mga07m45_24675_c1 | |||
| 1034 | nmdc:mga05p37_100388_c1 | |||
| 1035 | nmdc:mga09592_564724_c1 | |||
| 1036 | nmdc:mga0qj67_84686_c1 | |||
| 1037 | nmdc:mga08y16_62367_c1 | |||
| 1038 | nmdc:mga0n895_8900_c1 | |||
| 1039 | nmdc:mga0a205_336780_c1 | |||
| 1040 | Ga0495655_0018261 | |||
| 1041 | Ga0500643_021878 | |||
| 1042 | Ga0500562_000800 | |||
| 1043 | Ga0500572_001733 | |||
| 1044 | Ga0500595_004093 | |||
| 1045 | Ga0500607_159938 | |||
| 1046 | Ga0500608_067653 | |||
| 1047 | Ga0500618_000227 | |||
| 1048 | Ga0500618_007584 | |||
| 1049 | Ga0500652_006919 | |||
| 1050 | Ga0500573_0001776 | |||
| 1051 | Ga0500573_0012488 | |||
| 1052 | Ga0500616_0001544 | |||
| 1053 | Ga0500616_0006086 | |||
| 1054 | Ga0500620_000690 | |||
| 1055 | Ga0500627_0163785 | |||
| 1056 | Ga0500633_0075135 | |||
| 1057 | Ga0500634_0000112 | |||
| 1058 | Ga0500634_0068617 | |||
| 1059 | Ga0500636_0067626 | |||
| 1060 | Ga0501082_0000811 | |||
| 1061 | 2503203294 | |||
| 1062 | 2509116056 | |||
| 1063 | 2509141470 | |||
| 1064 | 2509371832 | |||
| 1065 | 2509397725 | |||
| 1066 | 2510318981 | |||
| 1067 | 2510839677 | |||
| 1068 | 2511174517 | |||
| 1069 | 2512929817 | |||
| 1070 | 2512964586 | |||
| 1071 | 2513590219 | |||
| 1072 | 2513609081 | |||
| 1073 | 2514033300 | |||
| 1074 | 2514420483 | |||
| 1075 | 2514588177 | |||
| 1076 | 2523102558 | |||
| 1077 | 2585231481 | |||
| 1078 | 2585278917 | |||
| 1079 | 2585325469 | |||
| 1080 | 2585329626 | |||
| 1081 | 2585530714 | |||
| 1082 | 2585554894 | |||
| 1083 | 2585995130 | |||
| 1084 | 2585999677 | |||
| 1085 | 2588515409 | |||
| 1086 | 2597815013 | |||
| 1087 | 2599106086 | |||
| 1088 | 2599333754 | |||
| 1089 | 2599602583 | |||
| 1090 | 2599722027 | |||
| 1091 | 2599937998 | |||
| 1092 | 2600375279 | |||
| 1093 | 2601608664 | |||
| 1094 | 2601745438 | |||
| 1095 | 2616305810 | |||
| 1096 | 2616553948 | |||
| 1097 | 2643773604 | |||
| 1098 | 2643775444 | |||
| 1099 | 2643793890 | |||
| 1100 | 2643809994 | |||
| 1101 | 2643837779 | |||
| 1102 | 2643985341 | |||
| 1103 | 2644155023 | |||
| 1104 | 2644196528 | |||
| 1105 | 2644242896 | |||
| 1106 | 2671115297 | |||
| 1107 | 2671692764 | |||
| 1108 | 2688600132 | |||
| 1109 | 2694633679 | |||
| 1110 | 2694639982 | |||
| 1111 | 2723577412 | |||
| 1112 | 2738946530 | |||
| 1113 | 2756673305 | |||
| 1114 | 2765465211 | |||
| 1115 | 2770197357 | |||
| 1116 | 2776912788 | |||
| 1117 | 2792749115 | |||
| 1118 | 2793353582 | |||
| 1119 | 2819639239 | |||
| 1120 | 2819684102 | |||
| 1121 | 2821124297 | |||
| 1122 | 2821449371 | |||
| 1123 | 2837681212 | |||
| 1124 | 2838031436 | |||
| 1125 | 2838741210 | |||
| 1126 | 2841741125 | |||
| 1127 | 2841844893 | |||
| 1128 | 2842144615 | |||
| 1129 | 2842333655 | |||
| 1130 | 2842477969 | |||
| 1131 | 2842482863 | |||
| 1132 | 2842504778 | |||
| 1133 | 2842509738 | |||
| 1134 | 2842924808 | |||
| 1135 | 2844005766 | |||
| 1136 | 2844015444 | |||
| 1137 | 2844533647 | |||
| 1138 | 2846955880 | |||
| 1139 | 2847671814 | |||
| 1140 | 2847688045 | |||
| 1141 | 2848862299 | |||
| 1142 | 2854683558 | |||
| 1143 | 2854897195 | |||
| 1144 | 2854918185 | |||
| 1145 | 2856318456 | |||
| 1146 | 2856324408 | |||
| 1147 | 2856333387 | |||
| 1148 | 2856335712 | |||
| 1149 | 2856345456 | |||
| 1150 | 2856350409 | |||
| 1151 | 2856362074 | |||
| 1152 | 2856364609 | |||
| 1153 | 2857355865 | |||
| 1154 | 2857375518 | |||
| 1155 | 2857531877 | |||
| 1156 | 2869165012 | |||
| 1157 | 2869175763 | |||
| 1158 | 2869240244 | |||
| 1159 | 2869248585 | |||
| 1160 | 2869256484 | |||
| 1161 | 2869260184 | |||
| 1162 | 2869264435 | |||
| 1163 | 2869276513 | |||
| 1164 | 2869281594 | |||
| 1165 | 2869292718 | |||
| 1166 | 2871429531 | |||
| 1167 | 2871456680 | |||
| 1168 | 2871462212 | |||
| 1169 | 2871470002 | |||
| 1170 | 2871478512 | |||
| 1171 | 2871488446 | |||
| 1172 | 2871493934 | |||
| 1173 | 2871498448 | |||
| 1174 | 2874103817 | |||
| 1175 | 2874111271 | |||
| 1176 | 2874120114 | |||
| 1177 | 2874127563 | |||
| 1178 | 2874132698 | |||
| 1179 | 2874140742 | |||
| 1180 | 2874146994 | |||
| 1181 | 2874157026 | |||
| 1182 | 2874163468 | |||
| 1183 | 2874175451 | |||
| 1184 | 2876366620 | |||
| 1185 | 2876372266 | |||
| 1186 | 2876379667 | |||
| 1187 | 2876388113 | |||
| 1188 | 2876399477 | |||
| 1189 | 2876406245 | |||
| 1190 | 2876411932 | |||
| 1191 | 2876414465 | |||
| 1192 | 2876424469 | |||
| 1193 | 2878037792 | |||
| 1194 | 2878742523 | |||
| 1195 | 2878746297 | |||
| 1196 | 2878756510 | |||
| 1197 | 2878762667 | |||
| 1198 | 2878769633 | |||
| 1199 | 2878775917 | |||
| 1200 | 2878783626 | |||
| 1201 | 2878793530 | |||
| 1202 | 2881153654 | |||
| 1203 | 2881157451 | |||
| 1204 | 2881162809 | |||
| 1205 | 2881847017 | |||
| 1206 | 2881857060 | |||
| 1207 | 2881867287 | |||
| 1208 | 2882634377 | |||
| 1209 | 2882915271 | |||
| 1210 | 2885311559 | |||
| 1211 | 2885316396 | |||
| 1212 | 2885321161 | |||
| 1213 | 2885327065 | |||
| 1214 | 2885349999 | |||
| 1215 | 2885356052 | |||
| 1216 | 2888341306 | |||
| 1217 | 2888348490 | |||
| 1218 | 2889012970 | |||
| 1219 | 2889022162 | |||
| 1220 | 2891051624 | |||
| 1221 | 2899261802 | |||
| 1222 | 2899803788 | |||
| 1223 | 2903452796 | |||
| 1224 | 2903500639 | |||
| 1225 | 2903502562 | |||
| 1226 | 2903518240 | |||
| 1227 | 2903524487 | |||
| 1228 | 2903530118 | |||
| 1229 | 2903543246 | |||
| 1230 | 2904581381 | |||
| 1231 | 2904666004 | |||
| 1232 | 2906308430 | |||
| 1233 | 2906321978 | |||
| 1234 | 2906331212 | |||
| 1235 | 2906355772 | |||
| 1236 | 2906375479 | |||
| 1237 | 2906386883 | |||
| 1238 | 2906411685 | |||
| 1239 | 2906418493 | |||
| 1240 | 2913310947 | |||
| 1241 | 2919122617 | |||
| 1242 | 2919167379 | |||
| 1243 | 2919171408 | |||
| 1244 | 2919409318 | |||
| 1245 | 2922137674 | |||
| 1246 | 2922154110 | |||
| 1247 | 2922165445 | |||
| 1248 | 2922176873 | |||
| 1249 | 2922193034 | |||
| 1250 | 2924735385 | |||
| 1251 | 2924743055 | |||
| 1252 | 2924751453 | |||
| 1253 | 2924756390 | |||
| 1254 | 2924764629 | |||
| 1255 | 2924780323 | |||
| 1256 | 2924788095 | |||
| 1257 | 2933595079 | |||
| 1258 | 2937814357 | |||
| 1259 | 2937829281 | |||
| 1260 | 2937840500 | |||
| 1261 | 2937852405 | |||
| 1262 | 2937862744 | |||
| 1263 | 2937882845 | |||
| 1264 | 2937891484 | |||
| 1265 | 2937973182 | |||
| 1266 | 2937986440 | |||
| 1267 | 2937997095 | |||
| 1268 | 2938015505 | |||
| 1269 | 2958037555 | |||
| 1270 | 2958046732 | |||
| 1271 | 2958047266 | |||
| 1272 | 2958068678 | |||
| 1273 | 2958071375 | |||
| 1274 | 2958089970 | |||
| 1275 | 2958105461 | |||
| 1276 | 2958112382 | |||
| 1277 | 2958116990 | |||
| 1278 | 2958126408 | |||
| 1279 | 2958137389 | |||
| 1280 | 2958148992 | |||
| 1281 | 2958167565 | |||
| 1282 | 2958177389 | |||
| 1283 | 2958180234 | |||
| 1284 | 2961078066 | |||
| 1285 | 2961121348 | |||
| 1286 | 2961135143 | |||
| 1287 | 2961143484 | |||
| 1288 | 2961166037 | |||
| 1289 | 2961172799 | |||
| 1290 | 2961190646 | |||
| 1291 | 2963649414 | |||
| 1292 | 2965020856 | |||
| 1293 | 2965030659 | |||
| 1294 | 2965046029 | |||
| 1295 | 2965053313 | |||
| 1296 | 2965062816 | |||
| 1297 | 2965095116 | |||
| 1298 | 2965107272 | |||
| 1299 | 2965120111 | |||
| 1300 | 2967998011 | |||
| 1301 | 2968008662 | |||
| 1302 | 2968019611 | |||
| 1303 | 2968084577 | |||
| 1304 | 2968096905 | |||
| 1305 | 2968102384 | |||
| 1306 | 2968117501 | |||
| 1307 | 2968118284 | |||
| 1308 | 2968131096 | |||
| 1309 | 2968146102 | |||
| 1310 | 2968174434 | |||
| 1311 | 2970472932 | |||
| 1312 | 2970492078 | |||
| 1313 | 2970505393 | |||
| 1314 | 2970512514 | |||
| 1315 | 2970529707 | |||
| 1316 | 2970535252 | |||
| 1317 | 2970545087 | |||
| 1318 | 2970551110 | |||
| 1319 | 2970557525 | |||
| 1320 | 2970596197 | |||
| 1321 | 2970624992 | |||
| 1322 | 2970627372 | |||
| 1323 | 2977825691 | |||
| 1324 | 2977832260 | |||
| 1325 | 2977844864 | |||
| 1326 | 2977862824 | |||
| 1327 | 2977869569 | |||
| 1328 | 2977873749 | |||
| 1329 | 2977914993 | |||
| 1330 | 2977915314 | |||
| 1331 | 2977927225 | |||
| 1332 | 2977937007 | |||
| 1333 | 2977943844 | |||
| 1334 | 2977954377 | |||
| 1335 | 2977960054 | |||
| 1336 | 2977972511 | |||
| 1337 | 2977989923 | |||
| 1338 | 2979751392 | |||
| 1339 | 2979770064 | |||
| 1340 | 2979779447 | |||
| 1341 | 2979785945 | |||
| 1342 | 2979794270 | |||
| 1343 | 2979810114 | |||
| 1344 | 2987639679 | |||
| 1345 | 2987648775 | |||
| 1346 | 2987658667 | |||
| 1347 | 2987662044 | |||
| 1348 | 2987667433 | |||
| 1349 | 2987674016 | |||
| 1350 | 2995393784 | |||
| 1351 | 2996313323 | |||
| 1352 | 2996342532 | |||
| 1353 | 2996351948 | |||
| 1354 | 2996392344 | |||
| 1355 | 3000018631 | |||
| 1356 | 3000141853 | |||
| 1357 | 3004170901 | |||
| 1358 | 3004191095 | |||
| 1359 | 3004199916 | |||
| 1360 | 3004207252 | |||
| 1361 | 3004214644 | |||
| 1362 | 3004219327 | |||
| 1363 | 3004238116 | |||
| 1364 | 3004240345 | |||
| 1365 | 3004252837 | |||
| 1366 | 3004273132 | |||
| 1367 | 3004278646 | |||
| 1368 | 3004295124 | |||
| 1369 | 3004339398 | |||
| 1370 | 637079561 | |||
| 1371 | 649874609 | |||
| 1372 | 8004301768 | |||
| 1373 | 8004321170 | |||
| 1374 | 8004365565 | |||
| 1375 | 8004378099 | |||
| 1376 | 8004388462 | |||
| 1377 | 8004401866 | |||
| 1378 | 8004450704 | |||
| 1379 | 8004634181 | |||
| 1380 | 8004641754 | |||
| 1381 | 8004700628 | |||
| 1382 | 8004710872 | |||
| 1383 | 8004714686 | |||
| 1384 | 8004731419 | |||
| 1385 | 8005684559 | |||
| 1386 | 8018152543 | |||
| 1387 | 8055434205 | |||
| 1388 | 8055622703 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.9383 | 27 | 273 |
| 4jxj-assembly1.cif.gz_A | crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing | 0.9379 | 28 | 275 |
| 4jxj-assembly1.cif.gz_A | crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing | 0.9342 | 28 | 275 |
| 7pnt-assembly1.cif.gz_c | assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa and tfb1m | 0.9288 | 27 | 274 |
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.9237 | 27 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jxjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9637 | 28 | 212 | 3.40.50.150 |
| af_Q54M56_2_236_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9559 | 7 | 214 | 3.40.50.150 |
| 4jxjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9533 | 28 | 212 | 3.40.50.150 |
| af_Q58435_1_185_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9496 | 20 | 212 | 3.40.50.150 |
| af_Q58435_1_185_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9347 | 20 | 212 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436BH90-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase | 0.9937 | 165 | 275 |
GO:0000179
GO:0003723 GO:0005829 |
| AF-A0A351T7M2-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase | 0.9863 | 27 | 204 |
GO:0000179
GO:0003723 GO:0005829 |
| AF-A0A539CV97-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9848 | 1 | 274 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A659YI97-F1-model_v4 | deleted | 0.9818 | 90 | 249 |
|
| AF-A0A539CV97-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9777 | 1 | 274 |
GO:0003723
GO:0005829 GO:0052908 |