F475780

General Info

Members Datasets Scaffolds Average Seq Length
695 225 1390 205

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100084738|Ga0068853_1000847383
Length 216
Sequence MLAPFPPVRAARYDGCMKLYYAPGACSQAPHIILNETGLPYEKVRVDLETKRTENGADYLAIAPKGAVPALELDDGSLLTENAVVLQYIADQAPGWHLIPPYGTLERYRVLEWLNYIATELHKGFGPLFHPTGELRAHAMDAIAAKFDYVESQLGLGPWLVGDDFGIADAYLFVILGWARVFHFDFARWPGLKAFRQRVGERPSVRAALHDEGLAP

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
219 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
225 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.14
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 3.17
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100084738 3300005539 Bacteria 2777
2 JGI24747J21853_1003431 3300001978 Bacteria 1371
3 JGI24740J21852_10021320 3300001979 Bacteria 2248
4 JGI24740J21852_10030622 3300001979 Bacteria 1748
5 JGI24737J22298_10015324 3300001990 Bacteria 2481
6 JGI24737J22298_10138561 3300001990 Unclassified 719
7 JGI24735J21928_10004299 3300002067 Bacteria 4793
8 JGI24738J21930_10022873 3300002075 Bacteria 1291
9 JGI24744J21845_10000072 3300002077 Bacteria 12527
10 rootH2_10127439 3300003320 Bacteria 4228
11 rootH1_10057932 3300003323 Bacteria 1617
12 Ga0070658_10000002 3300005327 Bacteria 637290
13 Ga0070658_10058000 3300005327 Bacteria 3150
14 Ga0070658_10070957 3300005327 Bacteria 2852
15 Ga0070658_10084954 3300005327 Bacteria 2603
16 Ga0070658_10135033 3300005327 Bacteria 2058
17 Ga0070658_10160526 3300005327 Bacteria 1886
18 Ga0070658_10192454 3300005327 Bacteria 1719
19 Ga0070658_10760385 3300005327 Bacteria 841
20 Ga0070658_11033970 3300005327 Bacteria 714
21 Ga0070676_10076926 3300005328 Bacteria 2016
22 Ga0070683_100018072 3300005329 Bacteria 6238
23 Ga0070683_100018814 3300005329 Bacteria 6126
24 Ga0070683_100066413 3300005329 Bacteria 3360
25 Ga0070683_100285054 3300005329 Bacteria 1571
26 Ga0070683_100450699 3300005329 Bacteria 1228
27 Ga0070690_100007843 3300005330 Bacteria 6123
28 Ga0070670_100127512 3300005331 Bacteria 2197
29 Ga0070670_100326271 3300005331 Bacteria 1346
30 Ga0070677_10023755 3300005333 Bacteria 2273
31 Ga0070666_10000415 3300005335 Bacteria 26514
32 Ga0070666_10122566 3300005335 Bacteria 1803
33 Ga0070680_100003815 3300005336 Bacteria 11272
34 Ga0070680_100115622 3300005336 Bacteria 2235
35 Ga0070680_100225635 3300005336 Bacteria 1581
36 Ga0070682_100066347 3300005337 Bacteria 2296
37 Ga0070682_100211573 3300005337 Bacteria 1374
38 Ga0068868_100000164 3300005338 Bacteria 43406
39 Ga0068868_100010517 3300005338 Bacteria 6706
40 Ga0070660_100001508 3300005339 Bacteria 15962
41 Ga0070660_100009468 3300005339 Bacteria 6854
42 Ga0070660_100015222 3300005339 Bacteria 5549
43 Ga0070660_100037557 3300005339 Bacteria 3671
44 Ga0070660_100075592 3300005339 Bacteria 2637
45 Ga0070660_100108372 3300005339 Bacteria 2208
46 Ga0070660_100137165 3300005339 Bacteria 1960
47 Ga0070660_100171865 3300005339 Bacteria 1750
48 Ga0070660_100206398 3300005339 Bacteria 1594
49 Ga0070660_100220177 3300005339 Bacteria 1542
50 Ga0070660_100236074 3300005339 Bacteria 1488
51 Ga0070660_100284463 3300005339 Bacteria 1353
52 Ga0070660_100347803 3300005339 Bacteria 1220
53 Ga0070660_100473977 3300005339 Bacteria 1040
54 Ga0070689_100513467 3300005340 Bacteria 1028
55 Ga0070691_10019332 3300005341 Bacteria 3143
56 Ga0070691_10032392 3300005341 Bacteria 2456
57 Ga0070661_100000042 3300005344 Bacteria 99327
58 Ga0070661_100080463 3300005344 Bacteria 2405
59 Ga0070661_100125025 3300005344 Bacteria 1929
60 Ga0070661_100152323 3300005344 Bacteria 1748
61 Ga0070661_100154339 3300005344 Bacteria 1737
62 Ga0070661_100166787 3300005344 Bacteria 1671
63 Ga0070661_100171049 3300005344 Bacteria 1650
64 Ga0070692_10100912 3300005345 Bacteria 1582
65 Ga0070692_10175606 3300005345 Unclassified 1238
66 Ga0070668_100095043 3300005347 Bacteria 2354
67 Ga0070668_100108286 3300005347 Bacteria 2210
68 Ga0070668_100656854 3300005347 Bacteria 922
69 Ga0070669_100113854 3300005353 Bacteria 2056
70 Ga0070669_100158766 3300005353 Bacteria 1755
71 Ga0070675_100100094 3300005354 Bacteria 2441
72 Ga0070671_100000676 3300005355 Bacteria 24424
73 Ga0070671_100000793 3300005355 Bacteria 22759
74 Ga0070671_100023977 3300005355 Bacteria 4993
75 Ga0070671_100058773 3300005355 Bacteria 3200
76 Ga0070671_100483135 3300005355 Bacteria 1064
77 Ga0070674_100009545 3300005356 Bacteria 5811
78 Ga0070674_100040396 3300005356 Bacteria 3156
79 Ga0070674_100104292 3300005356 Bacteria 2072
80 Ga0070673_100005512 3300005364 Bacteria 8107
81 Ga0070688_100554936 3300005365 Bacteria 874
82 Ga0070659_100000826 3300005366 Bacteria 22574
83 Ga0070659_100016329 3300005366 Bacteria 5573
84 Ga0070659_100036495 3300005366 Bacteria 3832
85 Ga0070659_100039117 3300005366 Bacteria 3701
86 Ga0070659_100072316 3300005366 Bacteria 2744
87 Ga0070659_100181110 3300005366 Bacteria 1729
88 Ga0070659_100190601 3300005366 Bacteria 1685
89 Ga0070659_100253913 3300005366 Bacteria 1458
90 Ga0070659_100458813 3300005366 Bacteria 1082
91 Ga0070659_100620681 3300005366 Bacteria 930
92 Ga0070659_100652422 3300005366 Bacteria 907
93 Ga0070659_100892619 3300005366 Unclassified 776
94 Ga0070667_100000839 3300005367 Bacteria 28510
95 Ga0070714_100077952 3300005435 Bacteria 2879
96 Ga0070714_100186818 3300005435 Bacteria 1889
97 Ga0070714_100383761 3300005435 Bacteria 1325
98 Ga0070714_100524492 3300005435 Bacteria 1132
99 Ga0070714_100895138 3300005435 Bacteria 862
100 Ga0070710_10350562 3300005437 Bacteria 977
101 Ga0070663_100104051 3300005455 Bacteria 2123
102 Ga0070663_100105947 3300005455 Bacteria 2105
103 Ga0070663_100122254 3300005455 Bacteria 1968
104 Ga0070663_100144707 3300005455 Bacteria 1818
105 Ga0070663_100184777 3300005455 Bacteria 1619
106 Ga0070663_100258924 3300005455 Bacteria 1379
107 Ga0070663_100427080 3300005455 Bacteria 1088
108 Ga0070663_101080542 3300005455 Bacteria 701
109 Ga0070678_100062996 3300005456 Bacteria 2741
110 Ga0070678_100096525 3300005456 Bacteria 2280
111 Ga0070662_100045689 3300005457 Bacteria 3144
112 Ga0070662_100059950 3300005457 Bacteria 2773
113 Ga0070662_100060966 3300005457 Bacteria 2753
114 Ga0070662_100308048 3300005457 Bacteria 1288
115 Ga0070662_100432005 3300005457 Bacteria 1091
116 Ga0070662_100444785 3300005457 Bacteria 1075
117 Ga0070681_10568929 3300005458 Bacteria 1047
118 Ga0068867_100043753 3300005459 Bacteria 3279
119 Ga0070685_10383323 3300005466 Bacteria 969
120 Ga0070679_100000002 3300005530 Bacteria 312066
121 Ga0070679_100116181 3300005530 Bacteria 2661
122 Ga0070679_100156730 3300005530 Bacteria 2252
123 Ga0070679_100167483 3300005530 Bacteria 2170
124 Ga0070679_100177141 3300005530 Bacteria 2105
125 Ga0070679_100286793 3300005530 Bacteria 1598
126 Ga0070684_100016150 3300005535 Bacteria 6099
127 Ga0070684_100079645 3300005535 Bacteria 2896
128 Ga0070684_100098538 3300005535 Bacteria 2608
129 Ga0070684_100204806 3300005535 Bacteria 1798
130 Ga0068853_100010841 3300005539 Bacteria 7384
131 Ga0068853_100082252 3300005539 Bacteria 2820
132 Ga0068853_100125523 3300005539 Bacteria 2292
133 Ga0068853_100143898 3300005539 Bacteria 2141
134 Ga0068853_100320905 3300005539 Bacteria 1436
135 Ga0068853_100713604 3300005539 Bacteria 957
136 Ga0068853_100806976 3300005539 Bacteria 899
137 Ga0068853_101069849 3300005539 Unclassified 777
138 Ga0070672_100596351 3300005543 Bacteria 962
139 Ga0070686_100002016 3300005544 Bacteria 11266
140 Ga0070686_100096216 3300005544 Bacteria 1991
141 Ga0070696_100192593 3300005546 Bacteria 1518
142 Ga0070693_100017801 3300005547 Bacteria 3701
143 Ga0070693_100304261 3300005547 Bacteria 1076
144 Ga0070665_100000011 3300005548 Bacteria 525539
145 Ga0070665_100089413 3300005548 Bacteria 3085
146 Ga0070665_100392579 3300005548 Bacteria 1395
147 Ga0068855_100007322 3300005563 Bacteria 13372
148 Ga0068855_100098373 3300005563 Bacteria 3371
149 Ga0068855_100200949 3300005563 Bacteria 2243
150 Ga0068855_100218789 3300005563 Bacteria 2137
151 Ga0068855_100388885 3300005563 Bacteria 1530
152 Ga0068855_100428021 3300005563 Bacteria 1447
153 Ga0068855_100538080 3300005563 Bacteria 1266
154 Ga0070664_100021250 3300005564 Bacteria 5347
155 Ga0070664_100212644 3300005564 Bacteria 1728
156 Ga0070664_100266901 3300005564 Bacteria 1541
157 Ga0070664_100319935 3300005564 Bacteria 1405
158 Ga0070664_100328458 3300005564 Bacteria 1387
159 Ga0070664_100357673 3300005564 Bacteria 1329
160 Ga0070664_100359527 3300005564 Bacteria 1326
161 Ga0070664_100649882 3300005564 Bacteria 980
162 Ga0068857_100000797 3300005577 Bacteria 23561
163 Ga0068857_100014379 3300005577 Bacteria 6900
164 Ga0068857_100043024 3300005577 Bacteria 4007
165 Ga0068857_100107520 3300005577 Bacteria 2505
166 Ga0068857_100122882 3300005577 Bacteria 2339
167 Ga0068857_100168602 3300005577 Bacteria 1989
168 Ga0068857_100297145 3300005577 Bacteria 1488
169 Ga0068857_101077090 3300005577 Unclassified 775
170 Ga0068857_101167645 3300005577 Bacteria 745
171 Ga0068854_100005860 3300005578 Bacteria 7783
172 Ga0068854_100019650 3300005578 Bacteria 4556
173 Ga0068854_100058230 3300005578 Bacteria 2788
174 Ga0068854_100097756 3300005578 Bacteria 2195
175 Ga0068854_100612965 3300005578 Bacteria 930
176 Ga0068854_100692234 3300005578 Bacteria 879
177 Ga0068856_100003729 3300005614 Bacteria 15279
178 Ga0068856_100023905 3300005614 Bacteria 5944
179 Ga0068856_100399898 3300005614 Bacteria 1393
180 Ga0068856_100719160 3300005614 Bacteria 1019
181 Ga0068856_100823244 3300005614 Bacteria 948
182 Ga0068852_100113434 3300005616 Bacteria 2468
183 Ga0068852_100257475 3300005616 Bacteria 1674
184 Ga0068852_100575586 3300005616 Bacteria 1128
185 Ga0068852_100845777 3300005616 Bacteria 930
186 Ga0068859_100111552 3300005617 Bacteria 2798
187 Ga0068859_100214298 3300005617 Bacteria 2013
188 Ga0068859_100235505 3300005617 Bacteria 1919
189 Ga0068864_100003490 3300005618 Bacteria 12996
190 Ga0068866_10037119 3300005718 Bacteria 2391
191 Ga0068866_10270203 3300005718 Unclassified 1049
192 Ga0068861_100083633 3300005719 Bacteria 2504
193 Ga0068851_10013471 3300005834 Bacteria 3870
194 Ga0068851_10173875 3300005834 Bacteria 1190
195 Ga0068851_10413092 3300005834 Bacteria 796
196 Ga0068870_10032800 3300005840 Bacteria 2644
197 Ga0068863_100027005 3300005841 Bacteria 5474
198 Ga0068863_100123688 3300005841 Bacteria 2468
199 Ga0068863_100276577 3300005841 Bacteria 1626
200 Ga0068858_100002249 3300005842 Bacteria 19508
201 Ga0068860_100035734 3300005843 Bacteria 4764
202 Ga0068860_100120456 3300005843 Bacteria 2513
203 Ga0068862_100319185 3300005844 Bacteria 1433
204 Ga0070715_10094936 3300006163 Bacteria 1380
205 Ga0068871_100931803 3300006358 Bacteria 806
206 Ga0068865_100025155 3300006881 Bacteria 3913
207 Ga0097620_100111547 3300006931 Bacteria 2798
208 Ga0097620_100214298 3300006931 Bacteria 2013
209 Ga0097620_100235514 3300006931 Bacteria 1919
210 Ga0105240_10050753 3300009093 Bacteria 5227
211 Ga0105240_10179195 3300009093 Bacteria 2503
212 Ga0105245_10065377 3300009098 Bacteria 3289
213 Ga0105245_10097844 3300009098 Bacteria 2710
214 Ga0105245_10257398 3300009098 Bacteria 1698
215 Ga0105245_10533063 3300009098 Bacteria 1194
216 Ga0105245_11416495 3300009098 Bacteria 745
217 Ga0105243_10029912 3300009148 Bacteria 4191
218 Ga0105243_10924026 3300009148 Unclassified 870
219 Ga0105241_10015362 3300009174 Bacteria 5607
220 Ga0105241_10038121 3300009174 Bacteria 3624
221 Ga0105241_10056262 3300009174 Bacteria 3016
222 Ga0105248_10001057 3300009177 Bacteria 30519
223 Ga0105248_10112134 3300009177 Bacteria 3076
224 Ga0105248_10350951 3300009177 Bacteria 1661
225 Ga0105248_10565544 3300009177 Bacteria 1283
226 Ga0105248_10607330 3300009177 Bacteria 1234
227 Ga0105248_11305619 3300009177 Unclassified 821
228 Ga0105237_10202720 3300009545 Unclassified 1984
229 Ga0105237_10486499 3300009545 Bacteria 1240
230 Ga0105238_10014901 3300009551 Bacteria 7866
231 Ga0105238_10031483 3300009551 Bacteria 5401
232 Ga0105238_10044445 3300009551 Bacteria 4490
233 Ga0105238_10089725 3300009551 Bacteria 3061
234 Ga0105238_10302942 3300009551 Bacteria 1582
235 Ga0105249_10632365 3300009553 Bacteria 1127
236 Ga0105239_10235991 3300010375 Bacteria 2052
237 Ga0105239_11165767 3300010375 Bacteria 888
238 Ga0105246_10043210 3300011119 Bacteria 3057
239 Ga0157373_10094680 3300013100 Bacteria 2103
240 Ga0157373_10100642 3300013100 Bacteria 2034
241 Ga0157373_10120966 3300013100 Bacteria 1840
242 Ga0157371_10019368 3300013102 Bacteria 5021
243 Ga0157371_10042682 3300013102 Bacteria 3233
244 Ga0157371_10050547 3300013102 Bacteria 2954
245 Ga0157371_10072228 3300013102 Bacteria 2443
246 Ga0157371_10092252 3300013102 Bacteria 2145
247 Ga0157371_10097585 3300013102 Bacteria 2083
248 Ga0157371_10109495 3300013102 Bacteria 1961
249 Ga0157371_10110181 3300013102 Bacteria 1954
250 Ga0157371_10241715 3300013102 Bacteria 1299
251 Ga0157371_10275687 3300013102 Bacteria 1214
252 Ga0157371_10291335 3300013102 Bacteria 1180
253 Ga0157371_10555756 3300013102 Unclassified 851
254 Ga0157370_10001875 3300013104 Bacteria 25926
255 Ga0157370_10042083 3300013104 Bacteria 4404
256 Ga0157370_10062421 3300013104 Bacteria 3534
257 Ga0157370_10072290 3300013104 Bacteria 3255
258 Ga0157370_10101103 3300013104 Bacteria 2700
259 Ga0157370_10167771 3300013104 Bacteria 2041
260 Ga0157370_10453121 3300013104 Bacteria 1179
261 Ga0157370_10700348 3300013104 Bacteria 925
262 Ga0157370_11114848 3300013104 Bacteria 713
263 Ga0157369_10009817 3300013105 Bacteria 10947
264 Ga0157369_10023362 3300013105 Bacteria 6886
265 Ga0157369_10048442 3300013105 Bacteria 4611
266 Ga0157369_10202462 3300013105 Bacteria 2083
267 Ga0157369_10242390 3300013105 Bacteria 1883
268 Ga0157369_10377219 3300013105 Bacteria 1472
269 Ga0157369_10646170 3300013105 Bacteria 1091
270 Ga0157369_10691961 3300013105 Bacteria 1050
271 Ga0157369_11096494 3300013105 Bacteria 814
272 Ga0157374_10127141 3300013296 Bacteria 2464
273 Ga0157374_10150520 3300013296 Bacteria 2262
274 Ga0157374_10362773 3300013296 Bacteria 1441
275 Ga0157378_10020899 3300013297 Bacteria 5758
276 Ga0157378_10079104 3300013297 Bacteria 2968
277 Ga0157378_10490477 3300013297 Unclassified 1226
278 Ga0163162_10462635 3300013306 Bacteria 1400
279 Ga0163162_10476410 3300013306 Bacteria 1380
280 Ga0157372_10002368 3300013307 Bacteria 20400
281 Ga0157372_10043021 3300013307 Bacteria 4999
282 Ga0157372_10201761 3300013307 Bacteria 2304
283 Ga0157372_10455202 3300013307 Bacteria 1491
284 Ga0157372_10488132 3300013307 Bacteria 1436
285 Ga0157372_10733251 3300013307 Bacteria 1149
286 Ga0157372_11759417 3300013307 Unclassified 713
287 Ga0157372_11759418 3300013307 Bacteria 713
288 Ga0157375_10041720 3300013308 Bacteria 4433
289 Ga0157375_10315199 3300013308 Bacteria 1729
290 Ga0157375_10539420 3300013308 Bacteria 1329
291 Ga0157380_10609967 3300014326 Bacteria 1081
292 Ga0157377_10014703 3300014745 Bacteria 3987
293 Ga0157379_10077529 3300014968 Bacteria 2975
294 Ga0163161_10385953 3300017792 Bacteria 1120
295 Ga0206352_11098469 3300020078 Bacteria 918
296 Ga0213873_10000013 3300021358 Bacteria 206227
297 Ga0213876_10000128 3300021384 Bacteria 82771
298 Ga0213876_10002562 3300021384 Bacteria 10624
299 Ga0213876_10002796 3300021384 Bacteria 10164
300 Ga0213875_10001704 3300021388 Bacteria 13833
301 Ga0207697_10222234 3300025315 Bacteria 833
302 Ga0207656_10025039 3300025321 Bacteria 2420
303 Ga0207656_10136403 3300025321 Bacteria 1153
304 Ga0207656_10252159 3300025321 Bacteria 865
305 Ga0207682_10014554 3300025893 Bacteria 3066
306 Ga0207692_10348158 3300025898 Bacteria 913
307 Ga0207642_10046327 3300025899 Bacteria 1937
308 Ga0207642_10092982 3300025899 Bacteria 1494
309 Ga0207688_10012845 3300025901 Bacteria 4553
310 Ga0207680_10137412 3300025903 Bacteria 1617
311 Ga0207647_10004293 3300025904 Bacteria 10574
312 Ga0207647_10029288 3300025904 Bacteria 3565
313 Ga0207647_10087032 3300025904 Bacteria 1867
314 Ga0207645_10316147 3300025907 Bacteria 1041
315 Ga0207643_10052106 3300025908 Bacteria 2324
316 Ga0207705_10000008 3300025909 Bacteria 589717
317 Ga0207705_10001458 3300025909 Bacteria 18853
318 Ga0207705_10002640 3300025909 Bacteria 13741
319 Ga0207705_10004116 3300025909 Bacteria 11023
320 Ga0207705_10034945 3300025909 Bacteria 3595
321 Ga0207705_10053127 3300025909 Bacteria 2918
322 Ga0207705_10054518 3300025909 Bacteria 2881
323 Ga0207705_10070759 3300025909 Bacteria 2528
324 Ga0207705_10125669 3300025909 Unclassified 1906
325 Ga0207705_10417225 3300025909 Bacteria 1039
326 Ga0207705_10454071 3300025909 Bacteria 994
327 Ga0207654_10046105 3300025911 Bacteria 2484
328 Ga0207654_10137693 3300025911 Bacteria 1553
329 Ga0207707_10075256 3300025912 Bacteria 2945
330 Ga0207707_10077958 3300025912 Bacteria 2893
331 Ga0207707_10321035 3300025912 Bacteria 1337
332 Ga0207695_10003427 3300025913 Bacteria 22376
333 Ga0207695_10211062 3300025913 Bacteria 1852
334 Ga0207660_10000199 3300025917 Bacteria 38427
335 Ga0207660_10003491 3300025917 Bacteria 10250
336 Ga0207660_10196222 3300025917 Bacteria 1575
337 Ga0207660_10342953 3300025917 Bacteria 1196
338 Ga0207662_10312023 3300025918 Unclassified 1048
339 Ga0207662_10696202 3300025918 Unclassified 712
340 Ga0207657_10000757 3300025919 Bacteria 34331
341 Ga0207657_10005882 3300025919 Bacteria 12778
342 Ga0207657_10012647 3300025919 Bacteria 8320
343 Ga0207657_10016330 3300025919 Bacteria 7163
344 Ga0207657_10022716 3300025919 Bacteria 5860
345 Ga0207657_10031437 3300025919 Bacteria 4808
346 Ga0207657_10047069 3300025919 Bacteria 3774
347 Ga0207657_10050253 3300025919 Bacteria 3629
348 Ga0207657_10050936 3300025919 Bacteria 3600
349 Ga0207657_10064311 3300025919 Bacteria 3131
350 Ga0207657_10084546 3300025919 Bacteria 2659
351 Ga0207657_10106316 3300025919 Bacteria 2322
352 Ga0207657_10145128 3300025919 Bacteria 1936
353 Ga0207657_10196659 3300025919 Bacteria 1624
354 Ga0207657_10215953 3300025919 Bacteria 1538
355 Ga0207657_10221070 3300025919 Bacteria 1517
356 Ga0207649_10000047 3300025920 Bacteria 110856
357 Ga0207649_10007270 3300025920 Bacteria 6020
358 Ga0207649_10063829 3300025920 Bacteria 2326
359 Ga0207649_10091487 3300025920 Bacteria 1992
360 Ga0207649_10105277 3300025920 Bacteria 1875
361 Ga0207649_10115567 3300025920 Bacteria 1800
362 Ga0207649_10124563 3300025920 Bacteria 1742
363 Ga0207649_10230289 3300025920 Bacteria 1325
364 Ga0207649_10482446 3300025920 Bacteria 940
365 Ga0207652_10000001 3300025921 Bacteria 1006643
366 Ga0207652_10000002 3300025921 Bacteria 878035
367 Ga0207652_10133045 3300025921 Bacteria 2219
368 Ga0207652_10142595 3300025921 Bacteria 2143
369 Ga0207652_10174561 3300025921 Bacteria 1930
370 Ga0207652_10191548 3300025921 Bacteria 1839
371 Ga0207652_10672859 3300025921 Bacteria 925
372 Ga0207694_10012209 3300025924 Bacteria 6478
373 Ga0207694_10096012 3300025924 Bacteria 2344
374 Ga0207694_10270352 3300025924 Bacteria 1394
375 Ga0207650_10266278 3300025925 Bacteria 1392
376 Ga0207659_10076335 3300025926 Bacteria 2462
377 Ga0207659_10206090 3300025926 Unclassified 1573
378 Ga0207687_10077085 3300025927 Bacteria 2396
379 Ga0207664_10078793 3300025929 Bacteria 2673
380 Ga0207664_10096568 3300025929 Bacteria 2433
381 Ga0207664_10194774 3300025929 Bacteria 1746
382 Ga0207664_10455732 3300025929 Bacteria 1142
383 Ga0207644_10001701 3300025931 Bacteria 14200
384 Ga0207644_10002053 3300025931 Bacteria 13049
385 Ga0207644_10467027 3300025931 Bacteria 1038
386 Ga0207690_10001674 3300025932 Bacteria 13692
387 Ga0207690_10008223 3300025932 Bacteria 6188
388 Ga0207690_10023196 3300025932 Bacteria 3871
389 Ga0207690_10048294 3300025932 Bacteria 2829
390 Ga0207690_10054884 3300025932 Bacteria 2681
391 Ga0207690_10085263 3300025932 Bacteria 2217
392 Ga0207690_10183688 3300025932 Bacteria 1576
393 Ga0207690_10243236 3300025932 Bacteria 1387
394 Ga0207690_10315920 3300025932 Bacteria 1227
395 Ga0207690_10872270 3300025932 Bacteria 746
396 Ga0207690_10999272 3300025932 Unclassified 696
397 Ga0207706_10020981 3300025933 Bacteria 5867
398 Ga0207706_10037361 3300025933 Bacteria 4313
399 Ga0207706_10123902 3300025933 Bacteria 2273
400 Ga0207706_10253129 3300025933 Bacteria 1538
401 Ga0207706_10433984 3300025933 Bacteria 1137
402 Ga0207709_10039866 3300025935 Bacteria 2808
403 Ga0207670_10255852 3300025936 Bacteria 1355
404 Ga0207669_10001507 3300025937 Bacteria 9927
405 Ga0207669_10007586 3300025937 Bacteria 5031
406 Ga0207669_10150286 3300025937 Bacteria 1630
407 Ga0207669_10438408 3300025937 Bacteria 1032
408 Ga0207691_10102326 3300025940 Bacteria 2555
409 Ga0207691_10105953 3300025940 Bacteria 2504
410 Ga0207711_10000372 3300025941 Bacteria 47656
411 Ga0207711_10018653 3300025941 Bacteria 5768
412 Ga0207711_10205379 3300025941 Bacteria 1799
413 Ga0207711_10911752 3300025941 Unclassified 817
414 Ga0207661_10011306 3300025944 Bacteria 6461
415 Ga0207661_10015725 3300025944 Bacteria 5574
416 Ga0207661_10049282 3300025944 Bacteria 3352
417 Ga0207661_10242130 3300025944 Bacteria 1601
418 Ga0207661_10657160 3300025944 Bacteria 964
419 Ga0207661_11189596 3300025944 Bacteria 701
420 Ga0207679_10011569 3300025945 Bacteria 5723
421 Ga0207679_10176898 3300025945 Bacteria 1762
422 Ga0207679_10218049 3300025945 Bacteria 1604
423 Ga0207679_10241451 3300025945 Bacteria 1531
424 Ga0207679_10258442 3300025945 Bacteria 1484
425 Ga0207667_10005379 3300025949 Bacteria 15609
426 Ga0207667_10045507 3300025949 Bacteria 4647
427 Ga0207667_10057341 3300025949 Bacteria 4088
428 Ga0207667_10131914 3300025949 Bacteria 2573
429 Ga0207667_10196072 3300025949 Bacteria 2072
430 Ga0207667_10213609 3300025949 Bacteria 1977
431 Ga0207667_10255692 3300025949 Bacteria 1792
432 Ga0207651_10008478 3300025960 Bacteria 5557
433 Ga0207651_10098505 3300025960 Bacteria 2162
434 Ga0207651_10639090 3300025960 Bacteria 933
435 Ga0207668_10072232 3300025972 Bacteria 2468
436 Ga0207668_10081279 3300025972 Bacteria 2350
437 Ga0207668_10789019 3300025972 Bacteria 840
438 Ga0207640_10030387 3300025981 Bacteria 3326
439 Ga0207640_10050660 3300025981 Bacteria 2696
440 Ga0207640_10060352 3300025981 Bacteria 2506
441 Ga0207640_10073820 3300025981 Bacteria 2306
442 Ga0207640_10288792 3300025981 Bacteria 1292
443 Ga0207658_10001814 3300025986 Bacteria 15968
444 Ga0207658_10153527 3300025986 Bacteria 1879
445 Ga0207677_10000892 3300026023 Bacteria 16759
446 Ga0207703_10001293 3300026035 Bacteria 23178
447 Ga0207703_10429735 3300026035 Bacteria 1230
448 Ga0207639_10000332 3300026041 Bacteria 32793
449 Ga0207639_10002075 3300026041 Bacteria 13498
450 Ga0207639_10007650 3300026041 Bacteria 7374
451 Ga0207639_10112208 3300026041 Bacteria 2224
452 Ga0207639_10118156 3300026041 Bacteria 2174
453 Ga0207639_10201180 3300026041 Bacteria 1708
454 Ga0207639_10280681 3300026041 Bacteria 1465
455 Ga0207639_10552390 3300026041 Bacteria 1057
456 Ga0207639_10591033 3300026041 Bacteria 1023
457 Ga0207639_11283548 3300026041 Unclassified 687
458 Ga0207678_10020592 3300026067 Bacteria 5783
459 Ga0207678_10021227 3300026067 Bacteria 5692
460 Ga0207678_10038779 3300026067 Bacteria 4137
461 Ga0207678_10100934 3300026067 Bacteria 2465
462 Ga0207678_10154306 3300026067 Bacteria 1961
463 Ga0207678_10215094 3300026067 Bacteria 1644
464 Ga0207678_10230012 3300026067 Bacteria 1587
465 Ga0207678_10346073 3300026067 Bacteria 1282
466 Ga0207678_10538286 3300026067 Bacteria 1021
467 Ga0207708_10050775 3300026075 Bacteria 3158
468 Ga0207702_10074886 3300026078 Bacteria 2923
469 Ga0207702_10111652 3300026078 Bacteria 2431
470 Ga0207702_10276316 3300026078 Bacteria 1586
471 Ga0207702_10287640 3300026078 Bacteria 1556
472 Ga0207702_10409391 3300026078 Bacteria 1309
473 Ga0207702_10491906 3300026078 Bacteria 1195
474 Ga0207702_10722321 3300026078 Bacteria 982
475 Ga0207641_10096519 3300026088 Bacteria 2596
476 Ga0207641_10219512 3300026088 Bacteria 1762
477 Ga0207648_10003806 3300026089 Bacteria 15770
478 Ga0207648_10094711 3300026089 Bacteria 2611
479 Ga0207676_10449233 3300026095 Bacteria 1215
480 Ga0207674_10000020 3300026116 Bacteria 162474
481 Ga0207674_10004321 3300026116 Bacteria 17130
482 Ga0207674_10033484 3300026116 Bacteria 5379
483 Ga0207674_10039779 3300026116 Bacteria 4873
484 Ga0207674_10042454 3300026116 Bacteria 4696
485 Ga0207674_10231629 3300026116 Bacteria 1795
486 Ga0207674_10479871 3300026116 Bacteria 1202
487 Ga0207675_100117600 3300026118 Bacteria 2513
488 Ga0207683_10001756 3300026121 Bacteria 19187
489 Ga0207698_10017222 3300026142 Bacteria 4896
490 Ga0207698_10021498 3300026142 Bacteria 4464
491 Ga0207698_10021927 3300026142 Bacteria 4427
492 Ga0207698_10031997 3300026142 Bacteria 3805
493 Ga0207698_10053003 3300026142 Bacteria 3111
494 Ga0207698_10060789 3300026142 Bacteria 2940
495 Ga0207698_10158161 3300026142 Bacteria 1977
496 Ga0207698_10222569 3300026142 Bacteria 1706
497 Ga0207698_10671113 3300026142 Bacteria 1029
498 Ga0268266_10000058 3300028379 Bacteria 277346
499 Ga0268266_10055642 3300028379 Bacteria 3401
500 Ga0268266_10095669 3300028379 Bacteria 2609
501 Ga0268265_10783971 3300028380 Bacteria 928
502 Ga0268264_10416827 3300028381 Bacteria 1294
503 Ga0307408_100004305 3300031548 Bacteria 9661
504 Ga0307408_100191779 3300031548 Bacteria 1647
505 Ga0307413_10200836 3300031824 Bacteria 1440
506 Ga0307410_10019043 3300031852 Bacteria 4165
507 Ga0307410_10041574 3300031852 Bacteria 3032
508 Ga0307410_10370164 3300031852 Bacteria 1150
509 Ga0307406_10052245 3300031901 Bacteria 2598
510 Ga0307409_100070747 3300031995 Bacteria 2770
511 Ga0307416_100321549 3300032002 Bacteria 1549
512 Ga0307416_100377364 3300032002 Bacteria 1446
513 Ga0307416_101635476 3300032002 Bacteria 749
514 Ga0307414_10420553 3300032004 Bacteria 1165
515 Ga0307411_10104639 3300032005 Bacteria 2010
516 Ga0307415_100139254 3300032126 Bacteria 1850
517 Ga0307415_100275090 3300032126 Bacteria 1381
518 Ga0373956_0076141 3300035119 Bacteria 1535
519 Ga0373943_0012542 3300035170 Bacteria 3819
520 Ga0373946_0022658 3300035171 Bacteria 2447
521 Ga0373935_0575949 3300035692 Bacteria 822
522 Ga0373933_0041399 3300035724 Bacteria 2719
523 Ga0373937_0975089 3300036401 Bacteria 796
524 Ga0373925_0176695 3300037068 Bacteria 1688
525 Ga0395899_0000224 3300037312 Bacteria 76706
526 Ga0395899_0001939 3300037312 Bacteria 17035
527 Ga0395899_0005782 3300037312 Bacteria 9597
528 Ga0395899_0010408 3300037312 Bacteria 7127
529 Ga0395899_0024209 3300037312 Bacteria 4592
530 Ga0395899_0034427 3300037312 Bacteria 3804
531 Ga0395899_0048675 3300037312 Bacteria 3153
532 Ga0395899_0095294 3300037312 Bacteria 2153
533 Ga0395899_0140707 3300037312 Bacteria 1717
534 Ga0395899_0174853 3300037312 Bacteria 1510
535 Ga0395899_0220773 3300037312 Bacteria 1313
536 Ga0395900_0000294 3300037418 Bacteria 75260
537 Ga0395900_0024016 3300037418 Bacteria 6238
538 Ga0395900_0034799 3300037418 Bacteria 5189
539 Ga0395900_0047138 3300037418 Bacteria 4437
540 Ga0395900_0047883 3300037418 Bacteria 4403
541 Ga0395900_0050717 3300037418 Bacteria 4274
542 Ga0395900_0053235 3300037418 Bacteria 4165
543 Ga0395900_0119234 3300037418 Bacteria 2708
544 Ga0395900_0147016 3300037418 Bacteria 2409
545 Ga0395900_0170469 3300037418 Bacteria 2216
546 Ga0395900_0627179 3300037418 Bacteria 1013
547 Ga0395900_0641189 3300037418 Bacteria 1000
548 Ga0395900_0669367 3300037418 Bacteria 973
549 Ga0395898_0000192 3300037466 Bacteria 156121
550 Ga0395898_0021649 3300037466 Bacteria 6517
551 Ga0395898_0022475 3300037466 Bacteria 6387
552 Ga0395898_0071014 3300037466 Bacteria 3365
553 Ga0395898_0075748 3300037466 Bacteria 3250
554 Ga0395898_0189126 3300037466 Bacteria 1967
555 Ga0395898_0245479 3300037466 Bacteria 1707
556 Ga0395905_0000066 3300037471 Bacteria 183121
557 Ga0395905_0001888 3300037471 Bacteria 24158
558 Ga0395905_0023593 3300037471 Bacteria 5811
559 Ga0395905_0027314 3300037471 Bacteria 5382
560 Ga0395905_0036399 3300037471 Bacteria 4622
561 Ga0395905_0051127 3300037471 Bacteria 3870
562 Ga0395905_0069550 3300037471 Bacteria 3297
563 Ga0395905_0078877 3300037471 Bacteria 3086
564 Ga0395905_0097825 3300037471 Bacteria 2756
565 Ga0395905_0105903 3300037471 Bacteria 2641
566 Ga0395905_0251304 3300037471 Bacteria 1651
567 Ga0395905_0289325 3300037471 Unclassified 1525
568 Ga0395905_0338719 3300037471 Bacteria 1395
569 Ga0395905_0651416 3300037471 Unclassified 955
570 Ga0436364_1038812 3300037853 Bacteria 24190
571 Ga0395901_0000973 3300038443 Bacteria 31117
572 Ga0395901_0001005 3300038443 Bacteria 30513
573 Ga0395901_0054242 3300038443 Bacteria 4165
574 Ga0395901_0058639 3300038443 Bacteria 4004
575 Ga0395901_0087852 3300038443 Bacteria 3250
576 Ga0395901_0135527 3300038443 Bacteria 2588
577 Ga0395901_0139343 3300038443 Bacteria 2549
578 Ga0395901_0317569 3300038443 Unclassified 1612
579 Ga0395901_0390408 3300038443 Bacteria 1431
580 Ga0395901_0392671 3300038443 Bacteria 1426
581 Ga0395901_0444733 3300038443 Bacteria 1326
582 Ga0395901_0460820 3300038443 Bacteria 1299
583 Ga0395901_0545784 3300038443 Bacteria 1175
584 Ga0436365_0567701 3300039437 Bacteria 13379
585 Ga0436365_0573908 3300039437 Bacteria 15643
586 Ga0436365_1054672 3300039437 Bacteria 19456
587 Ga0436362_0111190 3300039453 Bacteria 1235
588 Ga0436362_1287140 3300039453 Bacteria 68344
589 Ga0439465_0132648 3300041413 Bacteria 880
590 Ga0451851_0508993 3300041507 Bacteria 960
591 Ga0439432_120223 3300042006 Bacteria 778
592 Ga0450898_029523 3300042134 Bacteria 1000
593 Ga0466972_0024754 3300044658 Bacteria 2979
594 Ga0466965_0029267 3300044683 Bacteria 2680
595 Ga0466965_0255663 3300044683 Bacteria 941
596 Ga0466965_0449596 3300044683 Unclassified 717
597 Ga0466966_0029528 3300044684 Bacteria 3566
598 Ga0466966_0388197 3300044684 Bacteria 839
599 Ga0466961_0037771 3300044693 Bacteria 3098
600 Ga0466961_0045902 3300044693 Bacteria 2795
601 Ga0466961_0112338 3300044693 Bacteria 1713
602 Ga0466961_0223042 3300044693 Bacteria 1161
603 Ga0466963_0011975 3300044694 Bacteria 5297
604 Ga0466963_0029416 3300044694 Bacteria 3536
605 Ga0466963_0064084 3300044694 Bacteria 2461
606 Ga0466963_0203100 3300044694 Bacteria 1386
607 Ga0466963_0221731 3300044694 Bacteria 1324
608 Ga0466963_0240147 3300044694 Bacteria 1270
609 Ga0466964_0002516 3300044706 Bacteria 6519
610 Ga0466964_0175980 3300044706 Bacteria 1011
611 Ga0466971_0010659 3300044719 Bacteria 4020
612 Ga0466971_0013632 3300044719 Bacteria 3572
613 Ga0466971_0038971 3300044719 Unclassified 2133
614 Ga0466971_0057712 3300044719 Bacteria 1752
615 Ga0466971_0069215 3300044719 Bacteria 1601
616 Ga0466968_0014372 3300044735 Bacteria 3128
617 Ga0466970_0028517 3300044765 Bacteria 2934
618 Ga0466970_0043821 3300044765 Bacteria 2382
619 Ga0466957_0008015 3300044842 Bacteria 5992
620 Ga0466957_0023324 3300044842 Bacteria 3658
621 Ga0466957_0033558 3300044842 Bacteria 3079
622 Ga0466957_0088869 3300044842 Bacteria 1933
623 Ga0466957_0217102 3300044842 Bacteria 1261
624 Ga0466957_0259362 3300044842 Bacteria 1158
625 Ga0466957_0406602 3300044842 Bacteria 932
626 Ga0466960_0169187 3300044901 Bacteria 1178
627 Ga0466959_0269704 3300045049 Bacteria 1170
628 Ga0466959_0278828 3300045049 Bacteria 1147
629 Ga0466959_0512335 3300045049 Bacteria 810
630 Ga0466958_0013696 3300045836 Bacteria 4621
631 Ga0466958_0046256 3300045836 Bacteria 2626
632 Ga0466958_0054218 3300045836 Bacteria 2431
633 Ga0466958_0064128 3300045836 Bacteria 2240
634 Ga0466958_0091956 3300045836 Bacteria 1878
635 Ga0466958_0099386 3300045836 Bacteria 1808
636 Ga0466958_0148273 3300045836 Bacteria 1479
637 Ga0466967_0015458 3300045976 Bacteria 5983
638 Ga0466967_0034356 3300045976 Bacteria 4303
639 Ga0466967_0042060 3300045976 Bacteria 3946
640 Ga0466967_0067318 3300045976 Bacteria 3194
641 Ga0466967_0075718 3300045976 Bacteria 3025
642 Ga0466967_0075733 3300045976 Bacteria 3025
643 Ga0466967_0089089 3300045976 Bacteria 2801
644 Ga0466967_0142311 3300045976 Bacteria 2235
645 Ga0466967_0170284 3300045976 Bacteria 2048
646 Ga0466967_0371989 3300045976 Bacteria 1386
647 Ga0466967_0848398 3300045976 Bacteria 908
648 Ga0495584_0156786 3300046491 Bacteria 1157
649 Ga0495607_0072646 3300046501 Bacteria 1915
650 Ga0495583_0045377 3300046506 Bacteria 2033
651 Ga0495663_0016162 3300046525 Bacteria 2109
652 Ga0495642_0048446 3300046528 Bacteria 1743
653 Ga0495621_0065172 3300046539 Bacteria 1330
654 Ga0495659_0115599 3300046664 Bacteria 1052
655 Ga0495669_0004679 3300046684 Bacteria 5673
656 Ga0495669_0065432 3300046684 Bacteria 1650
657 Ga0495636_0010495 3300047318 Bacteria 3658
658 Ga0495677_0008645 3300047445 Bacteria 3780
659 Ga0495602_0004945 3300048088 Bacteria 13964
660 Ga0496101_0206836 3300048904 Bacteria 1519
661 Ga0496102_0030005 3300048905 Bacteria 4866
662 Ga0496102_0426180 3300048905 Bacteria 1246
663 Ga0496103_0050974 3300048906 Bacteria 2561
664 Ga0496106_0006171 3300048909 Bacteria 8861
665 Ga0496106_0185425 3300048909 Bacteria 1653
666 Ga0496107_0023740 3300048910 Bacteria 4334
667 Ga0496108_0382484 3300048911 Bacteria 1229
668 Ga0496108_0882728 3300048911 Unclassified 768
669 Ga0496109_0005102 3300048912 Bacteria 10966
670 Ga0496110_0005678 3300048913 Bacteria 9796
671 Ga0496111_0003922 3300048914 Bacteria 9325
672 Ga0496112_0006215 3300048915 Bacteria 10459
673 Ga0496112_0016969 3300048915 Bacteria 6833
674 Ga0496112_0028727 3300048915 Bacteria 5372
675 Ga0496112_0033885 3300048915 Bacteria 4967
676 Ga0496112_0690074 3300048915 Bacteria 949
677 Ga0496112_0705161 3300048915 Bacteria 937
678 Ga0496113_0146912 3300048916 Bacteria 1858
679 Ga0496113_0241865 3300048916 Bacteria 1440
680 Ga0496113_0706272 3300048916 Bacteria 804
681 Ga0496114_0000006 3300048917 Bacteria 472921
682 Ga0501209_032726 3300049656 Bacteria 1330
683 Ga0501235_013105 3300049669 Bacteria 1824
684 Ga0501253_042727 3300049683 Bacteria 920
685 Ga0501268_001600 3300049765 Bacteria 2852
686 nmdc:mga08y16_793476_c1 3300050511 Bacteria 940
687 nmdc:mga0n895_243530_c1 3300050512 Bacteria 1825
688 Ga0500595_052023 3300053119 Bacteria 1266
689 Ga0466962_0015600 3300061719 Bacteria 3663
690 Ga0466962_0024085 3300061719 Bacteria 2925
691 Ga0466962_0054921 3300061719 Bacteria 1903
692 Ga0466962_0140336 3300061719 Bacteria 1170
693 Ga0466962_0421809 3300061719 Bacteria 670
694 2848860842 2848858292 Bacteria 7391279
695 2896429742 2896429255 Bacteria 2557483
696 Ga0068853_100084738
697 JGI24747J21853_1003431
698 JGI24740J21852_10021320
699 JGI24740J21852_10030622
700 JGI24737J22298_10015324
701 JGI24737J22298_10138561
702 JGI24735J21928_10004299
703 JGI24738J21930_10022873
704 JGI24744J21845_10000072
705 rootH2_10127439
706 rootH1_10057932
707 Ga0070658_10000002
708 Ga0070658_10058000
709 Ga0070658_10070957
710 Ga0070658_10084954
711 Ga0070658_10135033
712 Ga0070658_10160526
713 Ga0070658_10192454
714 Ga0070658_10760385
715 Ga0070658_11033970
716 Ga0070676_10076926
717 Ga0070683_100018072
718 Ga0070683_100018814
719 Ga0070683_100066413
720 Ga0070683_100285054
721 Ga0070683_100450699
722 Ga0070690_100007843
723 Ga0070670_100127512
724 Ga0070670_100326271
725 Ga0070677_10023755
726 Ga0070666_10000415
727 Ga0070666_10122566
728 Ga0070680_100003815
729 Ga0070680_100115622
730 Ga0070680_100225635
731 Ga0070682_100066347
732 Ga0070682_100211573
733 Ga0068868_100000164
734 Ga0068868_100010517
735 Ga0070660_100001508
736 Ga0070660_100009468
737 Ga0070660_100015222
738 Ga0070660_100037557
739 Ga0070660_100075592
740 Ga0070660_100108372
741 Ga0070660_100137165
742 Ga0070660_100171865
743 Ga0070660_100206398
744 Ga0070660_100220177
745 Ga0070660_100236074
746 Ga0070660_100284463
747 Ga0070660_100347803
748 Ga0070660_100473977
749 Ga0070689_100513467
750 Ga0070691_10019332
751 Ga0070691_10032392
752 Ga0070661_100000042
753 Ga0070661_100080463
754 Ga0070661_100125025
755 Ga0070661_100152323
756 Ga0070661_100154339
757 Ga0070661_100166787
758 Ga0070661_100171049
759 Ga0070692_10100912
760 Ga0070692_10175606
761 Ga0070668_100095043
762 Ga0070668_100108286
763 Ga0070668_100656854
764 Ga0070669_100113854
765 Ga0070669_100158766
766 Ga0070675_100100094
767 Ga0070671_100000676
768 Ga0070671_100000793
769 Ga0070671_100023977
770 Ga0070671_100058773
771 Ga0070671_100483135
772 Ga0070674_100009545
773 Ga0070674_100040396
774 Ga0070674_100104292
775 Ga0070673_100005512
776 Ga0070688_100554936
777 Ga0070659_100000826
778 Ga0070659_100016329
779 Ga0070659_100036495
780 Ga0070659_100039117
781 Ga0070659_100072316
782 Ga0070659_100181110
783 Ga0070659_100190601
784 Ga0070659_100253913
785 Ga0070659_100458813
786 Ga0070659_100620681
787 Ga0070659_100652422
788 Ga0070659_100892619
789 Ga0070667_100000839
790 Ga0070714_100077952
791 Ga0070714_100186818
792 Ga0070714_100383761
793 Ga0070714_100524492
794 Ga0070714_100895138
795 Ga0070710_10350562
796 Ga0070663_100104051
797 Ga0070663_100105947
798 Ga0070663_100122254
799 Ga0070663_100144707
800 Ga0070663_100184777
801 Ga0070663_100258924
802 Ga0070663_100427080
803 Ga0070663_101080542
804 Ga0070678_100062996
805 Ga0070678_100096525
806 Ga0070662_100045689
807 Ga0070662_100059950
808 Ga0070662_100060966
809 Ga0070662_100308048
810 Ga0070662_100432005
811 Ga0070662_100444785
812 Ga0070681_10568929
813 Ga0068867_100043753
814 Ga0070685_10383323
815 Ga0070679_100000002
816 Ga0070679_100116181
817 Ga0070679_100156730
818 Ga0070679_100167483
819 Ga0070679_100177141
820 Ga0070679_100286793
821 Ga0070684_100016150
822 Ga0070684_100079645
823 Ga0070684_100098538
824 Ga0070684_100204806
825 Ga0068853_100010841
826 Ga0068853_100082252
827 Ga0068853_100125523
828 Ga0068853_100143898
829 Ga0068853_100320905
830 Ga0068853_100713604
831 Ga0068853_100806976
832 Ga0068853_101069849
833 Ga0070672_100596351
834 Ga0070686_100002016
835 Ga0070686_100096216
836 Ga0070696_100192593
837 Ga0070693_100017801
838 Ga0070693_100304261
839 Ga0070665_100000011
840 Ga0070665_100089413
841 Ga0070665_100392579
842 Ga0068855_100007322
843 Ga0068855_100098373
844 Ga0068855_100200949
845 Ga0068855_100218789
846 Ga0068855_100388885
847 Ga0068855_100428021
848 Ga0068855_100538080
849 Ga0070664_100021250
850 Ga0070664_100212644
851 Ga0070664_100266901
852 Ga0070664_100319935
853 Ga0070664_100328458
854 Ga0070664_100357673
855 Ga0070664_100359527
856 Ga0070664_100649882
857 Ga0068857_100000797
858 Ga0068857_100014379
859 Ga0068857_100043024
860 Ga0068857_100107520
861 Ga0068857_100122882
862 Ga0068857_100168602
863 Ga0068857_100297145
864 Ga0068857_101077090
865 Ga0068857_101167645
866 Ga0068854_100005860
867 Ga0068854_100019650
868 Ga0068854_100058230
869 Ga0068854_100097756
870 Ga0068854_100612965
871 Ga0068854_100692234
872 Ga0068856_100003729
873 Ga0068856_100023905
874 Ga0068856_100399898
875 Ga0068856_100719160
876 Ga0068856_100823244
877 Ga0068852_100113434
878 Ga0068852_100257475
879 Ga0068852_100575586
880 Ga0068852_100845777
881 Ga0068859_100111552
882 Ga0068859_100214298
883 Ga0068859_100235505
884 Ga0068864_100003490
885 Ga0068866_10037119
886 Ga0068866_10270203
887 Ga0068861_100083633
888 Ga0068851_10013471
889 Ga0068851_10173875
890 Ga0068851_10413092
891 Ga0068870_10032800
892 Ga0068863_100027005
893 Ga0068863_100123688
894 Ga0068863_100276577
895 Ga0068858_100002249
896 Ga0068860_100035734
897 Ga0068860_100120456
898 Ga0068862_100319185
899 Ga0070715_10094936
900 Ga0068871_100931803
901 Ga0068865_100025155
902 Ga0097620_100111547
903 Ga0097620_100214298
904 Ga0097620_100235514
905 Ga0105240_10050753
906 Ga0105240_10179195
907 Ga0105245_10065377
908 Ga0105245_10097844
909 Ga0105245_10257398
910 Ga0105245_10533063
911 Ga0105245_11416495
912 Ga0105243_10029912
913 Ga0105243_10924026
914 Ga0105241_10015362
915 Ga0105241_10038121
916 Ga0105241_10056262
917 Ga0105248_10001057
918 Ga0105248_10112134
919 Ga0105248_10350951
920 Ga0105248_10565544
921 Ga0105248_10607330
922 Ga0105248_11305619
923 Ga0105237_10202720
924 Ga0105237_10486499
925 Ga0105238_10014901
926 Ga0105238_10031483
927 Ga0105238_10044445
928 Ga0105238_10089725
929 Ga0105238_10302942
930 Ga0105249_10632365
931 Ga0105239_10235991
932 Ga0105239_11165767
933 Ga0105246_10043210
934 Ga0157373_10094680
935 Ga0157373_10100642
936 Ga0157373_10120966
937 Ga0157371_10019368
938 Ga0157371_10042682
939 Ga0157371_10050547
940 Ga0157371_10072228
941 Ga0157371_10092252
942 Ga0157371_10097585
943 Ga0157371_10109495
944 Ga0157371_10110181
945 Ga0157371_10241715
946 Ga0157371_10275687
947 Ga0157371_10291335
948 Ga0157371_10555756
949 Ga0157370_10001875
950 Ga0157370_10042083
951 Ga0157370_10062421
952 Ga0157370_10072290
953 Ga0157370_10101103
954 Ga0157370_10167771
955 Ga0157370_10453121
956 Ga0157370_10700348
957 Ga0157370_11114848
958 Ga0157369_10009817
959 Ga0157369_10023362
960 Ga0157369_10048442
961 Ga0157369_10202462
962 Ga0157369_10242390
963 Ga0157369_10377219
964 Ga0157369_10646170
965 Ga0157369_10691961
966 Ga0157369_11096494
967 Ga0157374_10127141
968 Ga0157374_10150520
969 Ga0157374_10362773
970 Ga0157378_10020899
971 Ga0157378_10079104
972 Ga0157378_10490477
973 Ga0163162_10462635
974 Ga0163162_10476410
975 Ga0157372_10002368
976 Ga0157372_10043021
977 Ga0157372_10201761
978 Ga0157372_10455202
979 Ga0157372_10488132
980 Ga0157372_10733251
981 Ga0157372_11759417
982 Ga0157372_11759418
983 Ga0157375_10041720
984 Ga0157375_10315199
985 Ga0157375_10539420
986 Ga0157380_10609967
987 Ga0157377_10014703
988 Ga0157379_10077529
989 Ga0163161_10385953
990 Ga0206352_11098469
991 Ga0213873_10000013
992 Ga0213876_10000128
993 Ga0213876_10002562
994 Ga0213876_10002796
995 Ga0213875_10001704
996 Ga0207697_10222234
997 Ga0207656_10025039
998 Ga0207656_10136403
999 Ga0207656_10252159
1000 Ga0207682_10014554
1001 Ga0207692_10348158
1002 Ga0207642_10046327
1003 Ga0207642_10092982
1004 Ga0207688_10012845
1005 Ga0207680_10137412
1006 Ga0207647_10004293
1007 Ga0207647_10029288
1008 Ga0207647_10087032
1009 Ga0207645_10316147
1010 Ga0207643_10052106
1011 Ga0207705_10000008
1012 Ga0207705_10001458
1013 Ga0207705_10002640
1014 Ga0207705_10004116
1015 Ga0207705_10034945
1016 Ga0207705_10053127
1017 Ga0207705_10054518
1018 Ga0207705_10070759
1019 Ga0207705_10125669
1020 Ga0207705_10417225
1021 Ga0207705_10454071
1022 Ga0207654_10046105
1023 Ga0207654_10137693
1024 Ga0207707_10075256
1025 Ga0207707_10077958
1026 Ga0207707_10321035
1027 Ga0207695_10003427
1028 Ga0207695_10211062
1029 Ga0207660_10000199
1030 Ga0207660_10003491
1031 Ga0207660_10196222
1032 Ga0207660_10342953
1033 Ga0207662_10312023
1034 Ga0207662_10696202
1035 Ga0207657_10000757
1036 Ga0207657_10005882
1037 Ga0207657_10012647
1038 Ga0207657_10016330
1039 Ga0207657_10022716
1040 Ga0207657_10031437
1041 Ga0207657_10047069
1042 Ga0207657_10050253
1043 Ga0207657_10050936
1044 Ga0207657_10064311
1045 Ga0207657_10084546
1046 Ga0207657_10106316
1047 Ga0207657_10145128
1048 Ga0207657_10196659
1049 Ga0207657_10215953
1050 Ga0207657_10221070
1051 Ga0207649_10000047
1052 Ga0207649_10007270
1053 Ga0207649_10063829
1054 Ga0207649_10091487
1055 Ga0207649_10105277
1056 Ga0207649_10115567
1057 Ga0207649_10124563
1058 Ga0207649_10230289
1059 Ga0207649_10482446
1060 Ga0207652_10000001
1061 Ga0207652_10000002
1062 Ga0207652_10133045
1063 Ga0207652_10142595
1064 Ga0207652_10174561
1065 Ga0207652_10191548
1066 Ga0207652_10672859
1067 Ga0207694_10012209
1068 Ga0207694_10096012
1069 Ga0207694_10270352
1070 Ga0207650_10266278
1071 Ga0207659_10076335
1072 Ga0207659_10206090
1073 Ga0207687_10077085
1074 Ga0207664_10078793
1075 Ga0207664_10096568
1076 Ga0207664_10194774
1077 Ga0207664_10455732
1078 Ga0207644_10001701
1079 Ga0207644_10002053
1080 Ga0207644_10467027
1081 Ga0207690_10001674
1082 Ga0207690_10008223
1083 Ga0207690_10023196
1084 Ga0207690_10048294
1085 Ga0207690_10054884
1086 Ga0207690_10085263
1087 Ga0207690_10183688
1088 Ga0207690_10243236
1089 Ga0207690_10315920
1090 Ga0207690_10872270
1091 Ga0207690_10999272
1092 Ga0207706_10020981
1093 Ga0207706_10037361
1094 Ga0207706_10123902
1095 Ga0207706_10253129
1096 Ga0207706_10433984
1097 Ga0207709_10039866
1098 Ga0207670_10255852
1099 Ga0207669_10001507
1100 Ga0207669_10007586
1101 Ga0207669_10150286
1102 Ga0207669_10438408
1103 Ga0207691_10102326
1104 Ga0207691_10105953
1105 Ga0207711_10000372
1106 Ga0207711_10018653
1107 Ga0207711_10205379
1108 Ga0207711_10911752
1109 Ga0207661_10011306
1110 Ga0207661_10015725
1111 Ga0207661_10049282
1112 Ga0207661_10242130
1113 Ga0207661_10657160
1114 Ga0207661_11189596
1115 Ga0207679_10011569
1116 Ga0207679_10176898
1117 Ga0207679_10218049
1118 Ga0207679_10241451
1119 Ga0207679_10258442
1120 Ga0207667_10005379
1121 Ga0207667_10045507
1122 Ga0207667_10057341
1123 Ga0207667_10131914
1124 Ga0207667_10196072
1125 Ga0207667_10213609
1126 Ga0207667_10255692
1127 Ga0207651_10008478
1128 Ga0207651_10098505
1129 Ga0207651_10639090
1130 Ga0207668_10072232
1131 Ga0207668_10081279
1132 Ga0207668_10789019
1133 Ga0207640_10030387
1134 Ga0207640_10050660
1135 Ga0207640_10060352
1136 Ga0207640_10073820
1137 Ga0207640_10288792
1138 Ga0207658_10001814
1139 Ga0207658_10153527
1140 Ga0207677_10000892
1141 Ga0207703_10001293
1142 Ga0207703_10429735
1143 Ga0207639_10000332
1144 Ga0207639_10002075
1145 Ga0207639_10007650
1146 Ga0207639_10112208
1147 Ga0207639_10118156
1148 Ga0207639_10201180
1149 Ga0207639_10280681
1150 Ga0207639_10552390
1151 Ga0207639_10591033
1152 Ga0207639_11283548
1153 Ga0207678_10020592
1154 Ga0207678_10021227
1155 Ga0207678_10038779
1156 Ga0207678_10100934
1157 Ga0207678_10154306
1158 Ga0207678_10215094
1159 Ga0207678_10230012
1160 Ga0207678_10346073
1161 Ga0207678_10538286
1162 Ga0207708_10050775
1163 Ga0207702_10074886
1164 Ga0207702_10111652
1165 Ga0207702_10276316
1166 Ga0207702_10287640
1167 Ga0207702_10409391
1168 Ga0207702_10491906
1169 Ga0207702_10722321
1170 Ga0207641_10096519
1171 Ga0207641_10219512
1172 Ga0207648_10003806
1173 Ga0207648_10094711
1174 Ga0207676_10449233
1175 Ga0207674_10000020
1176 Ga0207674_10004321
1177 Ga0207674_10033484
1178 Ga0207674_10039779
1179 Ga0207674_10042454
1180 Ga0207674_10231629
1181 Ga0207674_10479871
1182 Ga0207675_100117600
1183 Ga0207683_10001756
1184 Ga0207698_10017222
1185 Ga0207698_10021498
1186 Ga0207698_10021927
1187 Ga0207698_10031997
1188 Ga0207698_10053003
1189 Ga0207698_10060789
1190 Ga0207698_10158161
1191 Ga0207698_10222569
1192 Ga0207698_10671113
1193 Ga0268266_10000058
1194 Ga0268266_10055642
1195 Ga0268266_10095669
1196 Ga0268265_10783971
1197 Ga0268264_10416827
1198 Ga0307408_100004305
1199 Ga0307408_100191779
1200 Ga0307413_10200836
1201 Ga0307410_10019043
1202 Ga0307410_10041574
1203 Ga0307410_10370164
1204 Ga0307406_10052245
1205 Ga0307409_100070747
1206 Ga0307416_100321549
1207 Ga0307416_100377364
1208 Ga0307416_101635476
1209 Ga0307414_10420553
1210 Ga0307411_10104639
1211 Ga0307415_100139254
1212 Ga0307415_100275090
1213 Ga0373956_0076141
1214 Ga0373943_0012542
1215 Ga0373946_0022658
1216 Ga0373935_0575949
1217 Ga0373933_0041399
1218 Ga0373937_0975089
1219 Ga0373925_0176695
1220 Ga0395899_0000224
1221 Ga0395899_0001939
1222 Ga0395899_0005782
1223 Ga0395899_0010408
1224 Ga0395899_0024209
1225 Ga0395899_0034427
1226 Ga0395899_0048675
1227 Ga0395899_0095294
1228 Ga0395899_0140707
1229 Ga0395899_0174853
1230 Ga0395899_0220773
1231 Ga0395900_0000294
1232 Ga0395900_0024016
1233 Ga0395900_0034799
1234 Ga0395900_0047138
1235 Ga0395900_0047883
1236 Ga0395900_0050717
1237 Ga0395900_0053235
1238 Ga0395900_0119234
1239 Ga0395900_0147016
1240 Ga0395900_0170469
1241 Ga0395900_0627179
1242 Ga0395900_0641189
1243 Ga0395900_0669367
1244 Ga0395898_0000192
1245 Ga0395898_0021649
1246 Ga0395898_0022475
1247 Ga0395898_0071014
1248 Ga0395898_0075748
1249 Ga0395898_0189126
1250 Ga0395898_0245479
1251 Ga0395905_0000066
1252 Ga0395905_0001888
1253 Ga0395905_0023593
1254 Ga0395905_0027314
1255 Ga0395905_0036399
1256 Ga0395905_0051127
1257 Ga0395905_0069550
1258 Ga0395905_0078877
1259 Ga0395905_0097825
1260 Ga0395905_0105903
1261 Ga0395905_0251304
1262 Ga0395905_0289325
1263 Ga0395905_0338719
1264 Ga0395905_0651416
1265 Ga0436364_1038812
1266 Ga0395901_0000973
1267 Ga0395901_0001005
1268 Ga0395901_0054242
1269 Ga0395901_0058639
1270 Ga0395901_0087852
1271 Ga0395901_0135527
1272 Ga0395901_0139343
1273 Ga0395901_0317569
1274 Ga0395901_0390408
1275 Ga0395901_0392671
1276 Ga0395901_0444733
1277 Ga0395901_0460820
1278 Ga0395901_0545784
1279 Ga0436365_0567701
1280 Ga0436365_0573908
1281 Ga0436365_1054672
1282 Ga0436362_0111190
1283 Ga0436362_1287140
1284 Ga0439465_0132648
1285 Ga0451851_0508993
1286 Ga0439432_120223
1287 Ga0450898_029523
1288 Ga0466972_0024754
1289 Ga0466965_0029267
1290 Ga0466965_0255663
1291 Ga0466965_0449596
1292 Ga0466966_0029528
1293 Ga0466966_0388197
1294 Ga0466961_0037771
1295 Ga0466961_0045902
1296 Ga0466961_0112338
1297 Ga0466961_0223042
1298 Ga0466963_0011975
1299 Ga0466963_0029416
1300 Ga0466963_0064084
1301 Ga0466963_0203100
1302 Ga0466963_0221731
1303 Ga0466963_0240147
1304 Ga0466964_0002516
1305 Ga0466964_0175980
1306 Ga0466971_0010659
1307 Ga0466971_0013632
1308 Ga0466971_0038971
1309 Ga0466971_0057712
1310 Ga0466971_0069215
1311 Ga0466968_0014372
1312 Ga0466970_0028517
1313 Ga0466970_0043821
1314 Ga0466957_0008015
1315 Ga0466957_0023324
1316 Ga0466957_0033558
1317 Ga0466957_0088869
1318 Ga0466957_0217102
1319 Ga0466957_0259362
1320 Ga0466957_0406602
1321 Ga0466960_0169187
1322 Ga0466959_0269704
1323 Ga0466959_0278828
1324 Ga0466959_0512335
1325 Ga0466958_0013696
1326 Ga0466958_0046256
1327 Ga0466958_0054218
1328 Ga0466958_0064128
1329 Ga0466958_0091956
1330 Ga0466958_0099386
1331 Ga0466958_0148273
1332 Ga0466967_0015458
1333 Ga0466967_0034356
1334 Ga0466967_0042060
1335 Ga0466967_0067318
1336 Ga0466967_0075718
1337 Ga0466967_0075733
1338 Ga0466967_0089089
1339 Ga0466967_0142311
1340 Ga0466967_0170284
1341 Ga0466967_0371989
1342 Ga0466967_0848398
1343 Ga0495584_0156786
1344 Ga0495607_0072646
1345 Ga0495583_0045377
1346 Ga0495663_0016162
1347 Ga0495642_0048446
1348 Ga0495621_0065172
1349 Ga0495659_0115599
1350 Ga0495669_0004679
1351 Ga0495669_0065432
1352 Ga0495636_0010495
1353 Ga0495677_0008645
1354 Ga0495602_0004945
1355 Ga0496101_0206836
1356 Ga0496102_0030005
1357 Ga0496102_0426180
1358 Ga0496103_0050974
1359 Ga0496106_0006171
1360 Ga0496106_0185425
1361 Ga0496107_0023740
1362 Ga0496108_0382484
1363 Ga0496108_0882728
1364 Ga0496109_0005102
1365 Ga0496110_0005678
1366 Ga0496111_0003922
1367 Ga0496112_0006215
1368 Ga0496112_0016969
1369 Ga0496112_0028727
1370 Ga0496112_0033885
1371 Ga0496112_0690074
1372 Ga0496112_0705161
1373 Ga0496113_0146912
1374 Ga0496113_0241865
1375 Ga0496113_0706272
1376 Ga0496114_0000006
1377 Ga0501209_032726
1378 Ga0501235_013105
1379 Ga0501253_042727
1380 Ga0501268_001600
1381 nmdc:mga08y16_793476_c1
1382 nmdc:mga0n895_243530_c1
1383 Ga0500595_052023
1384 Ga0466962_0015600
1385 Ga0466962_0024085
1386 Ga0466962_0054921
1387 Ga0466962_0140336
1388 Ga0466962_0421809
1389 2848860842
1390 2896429742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

16

91

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

24

92

0.96

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

116

203

0.95

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

133

198

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

19

97

0.85

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

119

212

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.9675 2 201
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.963 1 200
4kgi-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site 0.9609 1 200
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9583 1 200
4kgi-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site 0.9563 1 200
ID Description Score Start End Superfamily
2dsaC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9866 1 77 3.40.30.10
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.986 1 77 3.40.30.10
af_P0A9D2_2_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9663 3 199 3.50.50.60
1n2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.964 1 77 3.40.30.10
af_P0A9D2_2_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9568 3 199 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2J4QS22-F1-model_v4 Glutathione transferase GstA 0.9904 1 69 GO:0016740
AF-A0A6G7ZM79-F1-model_v4 Glutathione transferase GstA (EC 2.5.1.18) 0.9842 1 207 GO:0004364
AF-A0A3S4FJ08-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.983 1 77 GO:0004364
AF-A0A4Q5Y0N2-F1-model_v4 deleted 0.9803 1 73
AF-A0A6G7ZM79-F1-model_v4 Glutathione transferase GstA (EC 2.5.1.18) 0.9795 1 207 GO:0004364

Map