F475830

General Info

Members Datasets Scaffolds Average Seq Length
696 379 680 193

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10187701|Ga0081455_101877013
Length 227
Sequence MTSRIVSSTPNGSMAASRRHEARDVFSFDDGEFFMSIADRIRVKDIRLLSDNRYTLKTTTFEWRRNDGTWQTQHRETYDRGNGAVLLPYNLAPRTVLLVRQFRYPAYVNGHDELLIEAAAGLLDDAAPEERIRAEAEEETGYRLHDVTKVFEAFMSPGAVTEKLHFFVAEYEPSMKIGSGGGNADEGEEIEVLEISIDEALAMIADGRIVDAKTIMLLQHAALKIFR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
4 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
5 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
6 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
7 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
8 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
9 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
10 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
11 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
12 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
13 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
14 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
17 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
179 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
180 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
181 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
357 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
358 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
359 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
360 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
364 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
365 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
366 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
372 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
377 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
378 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.22
Nodule 2.87
Rhizoplane 8.05
Rhizosphere 66.81
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9108740 2162886012 Bacteria 1052
2 JGI24740J21852_10083413 3300001979 Bacteria 834
3 JGI24737J22298_10075821 3300001990 Bacteria 1003
4 JGI24738J21930_10075007 3300002075 Bacteria 704
5 JGI25151J46595_10002752 3300003187 Bacteria 10217
6 JGI25153J46596_10002018 3300003215 Bacteria 11982
7 JGI25153J46596_10010038 3300003215 Bacteria 4321
8 JGI25404J52841_10009670 3300003659 Bacteria 2064
9 JGI25404J52841_10058593 3300003659 Bacteria 808
10 Ga0055539_1011873 3300003752 Bacteria 1071
11 Ga0055526_1047477 3300003771 Bacteria 1007
12 Ga0055531_10004117 3300003794 Bacteria 8988
13 JGI25405J52794_10060247 3300003911 Bacteria 820
14 Ga0065165_1002741 3300005262 Bacteria 14058
15 Ga0065165_1004574 3300005262 Bacteria 8441
16 Ga0065165_1011498 3300005262 Bacteria 3684
17 Ga0070676_10775333 3300005328 Bacteria 706
18 Ga0070683_100066232 3300005329 Bacteria 3364
19 Ga0070670_100087921 3300005331 Bacteria 2671
20 Ga0070670_100571223 3300005331 Bacteria 1010
21 Ga0068869_101015382 3300005334 Bacteria 723
22 Ga0070666_10363602 3300005335 Bacteria 1037
23 Ga0070666_10380804 3300005335 Bacteria 1013
24 Ga0070666_10618792 3300005335 Bacteria 791
25 Ga0068868_100287972 3300005338 Bacteria 1392
26 Ga0070691_10269331 3300005341 Bacteria 920
27 Ga0070668_100167673 3300005347 Bacteria 1786
28 Ga0070668_100805696 3300005347 Bacteria 835
29 Ga0070673_100470901 3300005364 Bacteria 1133
30 Ga0070673_101533867 3300005364 Bacteria 629
31 Ga0070659_100122307 3300005366 Bacteria 2109
32 Ga0070667_100217226 3300005367 Bacteria 1701
33 Ga0070667_100768056 3300005367 Bacteria 894
34 Ga0070709_10028973 3300005434 Bacteria 3307
35 Ga0070709_10132862 3300005434 Bacteria 1701
36 Ga0070709_10320911 3300005434 Bacteria 1137
37 Ga0070714_100008712 3300005435 Bacteria 7933
38 Ga0070714_100211969 3300005435 Bacteria 1776
39 Ga0070714_100308489 3300005435 Bacteria 1477
40 Ga0070714_100355431 3300005435 Bacteria 1376
41 Ga0070713_100001936 3300005436 Bacteria 13367
42 Ga0070713_100007442 3300005436 Bacteria 7686
43 Ga0070710_10000534 3300005437 Bacteria 17971
44 Ga0070710_10006878 3300005437 Bacteria 5489
45 Ga0070701_10379997 3300005438 Bacteria 890
46 Ga0070711_100000548 3300005439 Bacteria 19604
47 Ga0070711_100004958 3300005439 Bacteria 7906
48 Ga0070711_100010548 3300005439 Bacteria 5720
49 Ga0070711_100373276 3300005439 Bacteria 1151
50 Ga0070663_100087429 3300005455 Bacteria 2304
51 Ga0070663_100165706 3300005455 Bacteria 1704
52 Ga0070663_100995476 3300005455 Bacteria 729
53 Ga0070678_100028290 3300005456 Bacteria 3821
54 Ga0070678_100853981 3300005456 Bacteria 830
55 Ga0070678_100985890 3300005456 Bacteria 774
56 Ga0070681_10335052 3300005458 Bacteria 1422
57 Ga0070685_10073379 3300005466 Bacteria 2034
58 Ga0070706_100268703 3300005467 Bacteria 1592
59 Ga0070698_100062802 3300005471 Bacteria 3747
60 Ga0070679_100114126 3300005530 Bacteria 2687
61 Ga0070684_100020644 3300005535 Bacteria 5464
62 Ga0070684_100416881 3300005535 Bacteria 1239
63 Ga0068853_100022057 3300005539 Bacteria 5313
64 Ga0068853_100093892 3300005539 Bacteria 2642
65 Ga0068853_100688287 3300005539 Bacteria 975
66 Ga0070693_100085329 3300005547 Bacteria 1892
67 Ga0070693_100089030 3300005547 Bacteria 1857
68 Ga0070665_100059266 3300005548 Bacteria 3838
69 Ga0070665_100212350 3300005548 Bacteria 1936
70 Ga0070665_100256214 3300005548 Bacteria 1751
71 Ga0068855_100257859 3300005563 Bacteria 1943
72 Ga0068855_100283236 3300005563 Bacteria 1840
73 Ga0068855_100411793 3300005563 Bacteria 1480
74 Ga0068855_100719613 3300005563 Bacteria 1067
75 Ga0068857_100002410 3300005577 Bacteria 15249
76 Ga0068857_100594282 3300005577 Bacteria 1046
77 Ga0068854_100842681 3300005578 Bacteria 802
78 Ga0068856_100039675 3300005614 Bacteria 4623
79 Ga0068856_100193562 3300005614 Bacteria 2047
80 Ga0068856_100510864 3300005614 Bacteria 1223
81 Ga0068852_100091790 3300005616 Bacteria 2718
82 Ga0068852_100182297 3300005616 Bacteria 1975
83 Ga0068852_100749211 3300005616 Bacteria 989
84 Ga0068859_100236483 3300005617 Bacteria 1915
85 Ga0068859_100914702 3300005617 Bacteria 962
86 Ga0068864_100014536 3300005618 Bacteria 6540
87 Ga0068864_100965907 3300005618 Bacteria 844
88 Ga0068866_10349597 3300005718 Bacteria 939
89 Ga0068866_10437937 3300005718 Bacteria 852
90 Ga0068861_100652057 3300005719 Bacteria 973
91 Ga0068851_10010327 3300005834 Bacteria 4355
92 Ga0068863_100023489 3300005841 Bacteria 5887
93 Ga0068858_100159709 3300005842 Bacteria 2122
94 Ga0068862_100252953 3300005844 Bacteria 1606
95 Ga0081455_10052485 3300005937 Bacteria 3490
96 Ga0081455_10129342 3300005937 Bacteria 1977
97 Ga0081455_10187701 3300005937 Bacteria 1560
98 Ga0081540_1014987 3300005983 Bacteria 4927
99 Ga0081540_1028617 3300005983 Bacteria 3125
100 Ga0081540_1033365 3300005983 Bacteria 2797
101 Ga0081540_1055731 3300005983 Bacteria 1924
102 Ga0081540_1067861 3300005983 Bacteria 1664
103 Ga0081540_1092780 3300005983 Bacteria 1324
104 Ga0081540_1097432 3300005983 Bacteria 1277
105 Ga0081539_10000199 3300005985 Bacteria 139305
106 Ga0081539_10099672 3300005985 Bacteria 1483
107 Ga0070717_10021101 3300006028 Bacteria 5131
108 Ga0070717_10734932 3300006028 Bacteria 897
109 Ga0075365_10038932 3300006038 Bacteria 3093
110 Ga0075365_10049468 3300006038 Bacteria 2770
111 Ga0075365_10082686 3300006038 Bacteria 2177
112 Ga0075365_10131245 3300006038 Bacteria 1734
113 Ga0075368_10279302 3300006042 Bacteria 717
114 Ga0075363_100505841 3300006048 Bacteria 718
115 Ga0075364_10020313 3300006051 Bacteria 4177
116 Ga0075364_10171814 3300006051 Bacteria 1465
117 Ga0070715_10294135 3300006163 Bacteria 866
118 Ga0070715_10387327 3300006163 Bacteria 773
119 Ga0070716_100001291 3300006173 Bacteria 11061
120 Ga0070716_100174356 3300006173 Bacteria 1406
121 Ga0070712_100015913 3300006175 Bacteria 4850
122 Ga0070712_100077833 3300006175 Bacteria 2392
123 Ga0075367_10171018 3300006178 Bacteria 1353
124 Ga0075367_10227638 3300006178 Bacteria 1167
125 Ga0075367_10351282 3300006178 Bacteria 930
126 Ga0075369_10024501 3300006186 Bacteria 2501
127 Ga0075366_10025166 3300006195 Bacteria 3474
128 Ga0097621_100313277 3300006237 Bacteria 1388
129 Ga0097621_100414142 3300006237 Bacteria 1208
130 Ga0097621_100717841 3300006237 Bacteria 921
131 Ga0075370_10032447 3300006353 Bacteria 2920
132 Ga0068871_100466435 3300006358 Bacteria 1134
133 Ga0068871_100841374 3300006358 Bacteria 848
134 Ga0097620_100236487 3300006931 Bacteria 1915
135 Ga0097620_100914748 3300006931 Bacteria 962
136 Ga0099824_1020733 3300006942 Bacteria 4755
137 Ga0099822_1004972 3300006943 Bacteria 17360
138 Ga0099823_1037283 3300006944 Bacteria 3685
139 Ga0075435_100174549 3300007076 Bacteria 1814
140 Ga0105240_10007546 3300009093 Bacteria 15763
141 Ga0105240_10226503 3300009093 Bacteria 2175
142 Ga0105240_10229058 3300009093 Bacteria 2161
143 Ga0105240_11075005 3300009093 Bacteria 857
144 Ga0105245_10040560 3300009098 Bacteria 4148
145 Ga0105247_10039497 3300009101 Bacteria 2883
146 Ga0105247_10175840 3300009101 Bacteria 1426
147 Ga0105247_10686631 3300009101 Bacteria 769
148 Ga0105243_10782028 3300009148 Bacteria 939
149 Ga0105241_10038457 3300009174 Bacteria 3606
150 Ga0105241_10247964 3300009174 Bacteria 1508
151 Ga0105242_10180231 3300009176 Bacteria 1863
152 Ga0105242_10385372 3300009176 Bacteria 1304
153 Ga0105242_10786369 3300009176 Bacteria 940
154 Ga0105248_10077058 3300009177 Bacteria 3748
155 Ga0105248_10238254 3300009177 Bacteria 2048
156 Ga0105248_10730725 3300009177 Bacteria 1117
157 Ga0105248_11426698 3300009177 Bacteria 783
158 Ga0105237_10024884 3300009545 Bacteria 6125
159 Ga0105237_10044111 3300009545 Bacteria 4490
160 Ga0105237_10395855 3300009545 Bacteria 1386
161 Ga0105238_10147951 3300009551 Bacteria 2325
162 Ga0105238_10191548 3300009551 Bacteria 2021
163 Ga0105238_10328745 3300009551 Bacteria 1515
164 Ga0105238_10426726 3300009551 Bacteria 1321
165 Ga0105249_10501156 3300009553 Bacteria 1259
166 Ga0105249_10751478 3300009553 Bacteria 1037
167 Ga0105249_11335731 3300009553 Bacteria 789
168 Ga0105239_10018405 3300010375 Bacteria 7719
169 Ga0105239_10107233 3300010375 Bacteria 3094
170 Ga0105239_10267222 3300010375 Bacteria 1923
171 Ga0105239_10357028 3300010375 Bacteria 1650
172 Ga0105239_10618358 3300010375 Bacteria 1236
173 Ga0105239_10806704 3300010375 Bacteria 1075
174 Ga0105239_12282700 3300010375 Bacteria 630
175 Ga0105246_10581535 3300011119 Bacteria 965
176 Ga0105246_10833270 3300011119 Bacteria 821
177 Ga0105246_11115419 3300011119 Bacteria 721
178 Ga0157370_10216002 3300013104 Bacteria 1777
179 Ga0157370_11203863 3300013104 Bacteria 683
180 Ga0157369_10000685 3300013105 Bacteria 43830
181 Ga0157369_10028615 3300013105 Bacteria 6166
182 Ga0157369_10193359 3300013105 Bacteria 2137
183 Ga0157374_10062849 3300013296 Bacteria 3481
184 Ga0157374_10533491 3300013296 Bacteria 1180
185 Ga0157374_11080953 3300013296 Bacteria 822
186 Ga0157378_10950192 3300013297 Bacteria 892
187 Ga0163162_10643872 3300013306 Bacteria 1184
188 Ga0163162_10784041 3300013306 Bacteria 1071
189 Ga0157372_10173650 3300013307 Bacteria 2494
190 Ga0157375_10243659 3300013308 Bacteria 1957
191 Ga0157375_11905208 3300013308 Bacteria 706
192 Ga0163163_10069406 3300014325 Bacteria 3508
193 Ga0163163_10138239 3300014325 Bacteria 2478
194 Ga0163163_10182217 3300014325 Bacteria 2147
195 Ga0163163_10458015 3300014325 Bacteria 1336
196 Ga0157379_10119558 3300014968 Bacteria 2370
197 Ga0157379_10363880 3300014968 Bacteria 1326
198 Ga0157379_10861408 3300014968 Bacteria 858
199 Ga0157376_10458093 3300014969 Bacteria 1245
200 Ga0157376_10468998 3300014969 Bacteria 1232
201 Ga0163161_10159918 3300017792 Bacteria 1717
202 Ga0213874_10022465 3300021377 Bacteria 1751
203 Ga0213876_10015743 3300021384 Bacteria 4003
204 Ga0213876_10030169 3300021384 Bacteria 2859
205 Ga0209563_106240 3300025230 Bacteria 2064
206 Ga0207425_1005559 3300025245 Bacteria 3575
207 Ga0209026_1022966 3300025250 Bacteria 952
208 Ga0209677_101482 3300025253 Bacteria 10093
209 Ga0209233_1001759 3300025261 Bacteria 8350
210 Ga0209233_1005057 3300025261 Bacteria 4415
211 Ga0209233_1029636 3300025261 Bacteria 1298
212 Ga0209455_1003430 3300025272 Bacteria 5615
213 Ga0209455_1005204 3300025272 Bacteria 4073
214 Ga0209025_1000283 3300025294 Bacteria 114855
215 Ga0209564_1001733 3300025295 Bacteria 20449
216 Ga0209564_1019308 3300025295 Bacteria 2554
217 Ga0209758_1000011 3300025297 Bacteria 1049685
218 Ga0209758_1000320 3300025297 Bacteria 92649
219 Ga0209758_1004056 3300025297 Bacteria 12618
220 Ga0209758_1011540 3300025297 Bacteria 5099
221 Ga0209758_1031721 3300025297 Bacteria 2161
222 Ga0209758_1065514 3300025297 Bacteria 1172
223 Ga0209256_1002277 3300025299 Bacteria 16219
224 Ga0209256_1035689 3300025299 Bacteria 1311
225 Ga0207426_1000902 3300025302 Bacteria 29899
226 Ga0207426_1001214 3300025302 Bacteria 22769
227 Ga0207426_1002913 3300025302 Bacteria 10090
228 Ga0207426_1006457 3300025302 Bacteria 5100
229 Ga0207426_1085627 3300025302 Bacteria 845
230 Ga0209257_1000811 3300025304 Bacteria 45378
231 Ga0207697_10023886 3300025315 Bacteria 2503
232 Ga0207656_10002937 3300025321 Bacteria 5815
233 Ga0207656_10162835 3300025321 Bacteria 1062
234 Ga0207656_10380169 3300025321 Bacteria 708
235 Ga0207692_10000091 3300025898 Bacteria 26705
236 Ga0207692_10012992 3300025898 Bacteria 3598
237 Ga0207692_10019595 3300025898 Bacteria 3061
238 Ga0207692_10124431 3300025898 Bacteria 1448
239 Ga0207642_10160008 3300025899 Bacteria 1208
240 Ga0207710_10313104 3300025900 Bacteria 795
241 Ga0207688_10095556 3300025901 Bacteria 1711
242 Ga0207688_10141403 3300025901 Bacteria 1417
243 Ga0207680_10085326 3300025903 Bacteria 1994
244 Ga0207647_10056880 3300025904 Bacteria 2399
245 Ga0207685_10244013 3300025905 Bacteria 866
246 Ga0207699_10000782 3300025906 Bacteria 15227
247 Ga0207699_10116843 3300025906 Bacteria 1719
248 Ga0207699_10192054 3300025906 Bacteria 1378
249 Ga0207645_10169074 3300025907 Bacteria 1432
250 Ga0207705_10117076 3300025909 Bacteria 1973
251 Ga0207684_10058685 3300025910 Bacteria 3266
252 Ga0207684_10185624 3300025910 Bacteria 1793
253 Ga0207654_10012455 3300025911 Bacteria 4357
254 Ga0207654_10048338 3300025911 Bacteria 2434
255 Ga0207707_10000126 3300025912 Bacteria 78954
256 Ga0207707_10047311 3300025912 Bacteria 3746
257 Ga0207695_10000503 3300025913 Bacteria 83026
258 Ga0207695_10080555 3300025913 Bacteria 3297
259 Ga0207671_10001399 3300025914 Bacteria 28067
260 Ga0207671_10039182 3300025914 Bacteria 3510
261 Ga0207671_10143653 3300025914 Bacteria 1840
262 Ga0207671_10146601 3300025914 Bacteria 1821
263 Ga0207671_10388212 3300025914 Bacteria 1110
264 Ga0207671_10864746 3300025914 Bacteria 716
265 Ga0207693_10008718 3300025915 Bacteria 8291
266 Ga0207693_10044833 3300025915 Bacteria 3475
267 Ga0207693_10049980 3300025915 Bacteria 3284
268 Ga0207693_10124219 3300025915 Bacteria 2028
269 Ga0207663_10013987 3300025916 Bacteria 4380
270 Ga0207663_10014963 3300025916 Bacteria 4267
271 Ga0207663_10105709 3300025916 Bacteria 1901
272 Ga0207663_10179624 3300025916 Bacteria 1510
273 Ga0207652_10042877 3300025921 Bacteria 3852
274 Ga0207652_10081529 3300025921 Bacteria 2830
275 Ga0207694_10040624 3300025924 Bacteria 3582
276 Ga0207694_10281796 3300025924 Bacteria 1365
277 Ga0207650_10659163 3300025925 Bacteria 882
278 Ga0207687_10021597 3300025927 Bacteria 4278
279 Ga0207700_10001432 3300025928 Bacteria 13527
280 Ga0207700_10015439 3300025928 Bacteria 5039
281 Ga0207700_10090054 3300025928 Bacteria 2420
282 Ga0207664_10027757 3300025929 Bacteria 4296
283 Ga0207664_10087881 3300025929 Bacteria 2542
284 Ga0207664_10124175 3300025929 Bacteria 2165
285 Ga0207664_10591993 3300025929 Bacteria 996
286 Ga0207690_10213535 3300025932 Bacteria 1472
287 Ga0207686_10050913 3300025934 Bacteria 2578
288 Ga0207686_10084586 3300025934 Bacteria 2079
289 Ga0207686_10169374 3300025934 Bacteria 1539
290 Ga0207686_10396847 3300025934 Bacteria 1050
291 Ga0207709_10586103 3300025935 Bacteria 881
292 Ga0207670_10104254 3300025936 Bacteria 2031
293 Ga0207669_10377349 3300025937 Bacteria 1104
294 Ga0207669_10794847 3300025937 Bacteria 784
295 Ga0207665_10006928 3300025939 Bacteria 7498
296 Ga0207665_10087703 3300025939 Bacteria 2151
297 Ga0207711_10112304 3300025941 Bacteria 2425
298 Ga0207711_10428263 3300025941 Bacteria 1231
299 Ga0207711_10494103 3300025941 Bacteria 1140
300 Ga0207689_10398595 3300025942 Bacteria 1147
301 Ga0207689_10419368 3300025942 Bacteria 1117
302 Ga0207689_10668738 3300025942 Bacteria 875
303 Ga0207679_10526957 3300025945 Bacteria 1057
304 Ga0207667_10007456 3300025949 Bacteria 13143
305 Ga0207667_10129822 3300025949 Bacteria 2595
306 Ga0207667_10404371 3300025949 Bacteria 1390
307 Ga0207667_10693322 3300025949 Bacteria 1021
308 Ga0207668_10351624 3300025972 Bacteria 1232
309 Ga0207668_11018720 3300025972 Bacteria 740
310 Ga0207640_10094034 3300025981 Bacteria 2084
311 Ga0207658_10032042 3300025986 Bacteria 3738
312 Ga0207658_10108732 3300025986 Bacteria 2188
313 Ga0207658_10404845 3300025986 Bacteria 1200
314 Ga0207677_10111275 3300026023 Bacteria 2040
315 Ga0207703_10066172 3300026035 Bacteria 2972
316 Ga0207639_10352059 3300026041 Bacteria 1315
317 Ga0207639_10430425 3300026041 Bacteria 1195
318 Ga0207678_10083040 3300026067 Bacteria 2740
319 Ga0207678_10092881 3300026067 Bacteria 2579
320 Ga0207678_10166393 3300026067 Bacteria 1883
321 Ga0207702_10029716 3300026078 Bacteria 4549
322 Ga0207702_10345124 3300026078 Bacteria 1423
323 Ga0207648_10266867 3300026089 Bacteria 1528
324 Ga0207676_10011745 3300026095 Bacteria 6262
325 Ga0207676_10304702 3300026095 Bacteria 1456
326 Ga0207676_11436312 3300026095 Bacteria 686
327 Ga0207674_10008743 3300026116 Bacteria 11659
328 Ga0207674_10185558 3300026116 Bacteria 2030
329 Ga0207674_10480690 3300026116 Bacteria 1201
330 Ga0207674_11183430 3300026116 Bacteria 734
331 Ga0207675_100242820 3300026118 Bacteria 1741
332 Ga0207675_100621785 3300026118 Bacteria 1084
333 Ga0207683_10059644 3300026121 Bacteria 3352
334 Ga0207683_10116740 3300026121 Bacteria 2393
335 Ga0207683_10860030 3300026121 Bacteria 842
336 Ga0207698_10011877 3300026142 Bacteria 5670
337 Ga0207698_10235696 3300026142 Bacteria 1664
338 Ga0207698_10610127 3300026142 Bacteria 1077
339 Ga0207698_11551253 3300026142 Bacteria 678
340 Ga0207698_11746783 3300026142 Bacteria 637
341 Ga0209389_1000009 3300027296 Bacteria 226873
342 Ga0209589_1000007 3300027357 Bacteria 425699
343 Ga0209489_100008 3300027361 Bacteria 425699
344 Ga0209489_100671 3300027361 Bacteria 66550
345 Ga0209700_100009 3300027363 Bacteria 425699
346 Ga0209700_100016 3300027363 Bacteria 252567
347 Ga0268266_10014260 3300028379 Bacteria 6835
348 Ga0268266_10044273 3300028379 Bacteria 3805
349 Ga0268266_11428724 3300028379 Bacteria 667
350 Ga0268265_10265605 3300028380 Bacteria 1528
351 Ga0268264_10023033 3300028381 Bacteria 5082
352 Ga0268264_10673709 3300028381 Bacteria 1025
353 Ga0307517_10040637 3300028786 Bacteria 5056
354 Ga0307517_10073704 3300028786 Bacteria 3022
355 Ga0265330_10045051 3300031235 Bacteria 1945
356 Ga0265325_10203463 3300031241 Bacteria 912
357 Ga0265339_10264285 3300031249 Bacteria 829
358 Ga0265331_10150577 3300031250 Bacteria 1057
359 Ga0307513_10071688 3300031456 Bacteria 3614
360 Ga0265313_10061525 3300031595 Bacteria 1757
361 Ga0307508_10234721 3300031616 Bacteria 1432
362 Ga0265314_10200587 3300031711 Bacteria 1180
363 Ga0307516_10048316 3300031730 Bacteria 4187
364 Ga0307406_10000719 3300031901 Bacteria 18679
365 Ga0307412_10662295 3300031911 Bacteria 892
366 Ga0307416_100204999 3300032002 Bacteria 1875
367 Ga0307416_101379324 3300032002 Bacteria 811
368 Ga0307510_10032634 3300033180 Bacteria 5863
369 Ga0307510_10199868 3300033180 Bacteria 1535
370 Ga0315911_1000004 3300033442 Bacteria 472637
371 Ga0373934_0003635 3300035086 Bacteria 5667
372 Ga0373923_0083746 3300035111 Bacteria 1386
373 Ga0373936_0176351 3300035113 Bacteria 936
374 Ga0373939_0064276 3300035114 Bacteria 1178
375 Ga0373941_0036503 3300035115 Bacteria 1495
376 Ga0373945_0202466 3300035116 Bacteria 825
377 Ga0373953_0000752 3300035117 Bacteria 8989
378 Ga0373954_0001286 3300035118 Bacteria 10089
379 Ga0373956_0021279 3300035119 Bacteria 2766
380 Ga0373957_0001582 3300035120 Bacteria 6212
381 Ga0373955_0001870 3300035172 Bacteria 9062
382 Ga0373924_0001741 3300035410 Bacteria 7183
383 Ga0373931_0127429 3300035691 Bacteria 1461
384 Ga0373927_0039982 3300035695 Bacteria 3043
385 Ga0373927_0168819 3300035695 Bacteria 1434
386 Ga0373933_0005956 3300035724 Bacteria 6634
387 Ga0373947_0402942 3300035725 Bacteria 923
388 Ga0373937_0027219 3300036401 Bacteria 5169
389 Ga0395900_0189155 3300037418 Bacteria 2089
390 Ga0395898_0178612 3300037466 Bacteria 2029
391 Ga0395898_0617546 3300037466 Bacteria 1027
392 Ga0395898_0821245 3300037466 Bacteria 869
393 Ga0395905_0002843 3300037471 Bacteria 18958
394 Ga0395905_0412230 3300037471 Bacteria 1246
395 Ga0436364_0198842 3300037853 Bacteria 2267
396 Ga0436364_0521266 3300037853 Bacteria 1341
397 Ga0436364_1331208 3300037853 Bacteria 853
398 Ga0395901_0166879 3300038443 Bacteria 2311
399 Ga0436365_0048824 3300039437 Bacteria 897
400 Ga0436365_0198529 3300039437 Bacteria 2869
401 Ga0436365_0365623 3300039437 Bacteria 31548
402 Ga0436365_0525473 3300039437 Bacteria 2886
403 Ga0436365_0575604 3300039437 Bacteria 1217
404 Ga0436365_1667378 3300039437 Bacteria 1469
405 Ga0436363_0108046 3300039450 Bacteria 1971
406 Ga0451845_0569045 3300041501 Bacteria 917
407 Ga0451853_1352546 3300041512 Bacteria 1271
408 Ga0466969_0270446 3300044656 Bacteria 770
409 Ga0466972_0002729 3300044658 Bacteria 8737
410 Ga0466966_0007745 3300044684 Bacteria 7114
411 Ga0466966_0087453 3300044684 Bacteria 1937
412 Ga0466966_0374157 3300044684 Bacteria 856
413 Ga0466961_0000090 3300044693 Bacteria 57757
414 Ga0466963_0768436 3300044694 Bacteria 680
415 Ga0466964_0225591 3300044706 Bacteria 912
416 Ga0466971_0114418 3300044719 Bacteria 1246
417 Ga0466970_0129648 3300044765 Bacteria 1385
418 Ga0466959_0015724 3300045049 Bacteria 5519
419 Ga0466959_0171575 3300045049 Bacteria 1521
420 Ga0466959_0729487 3300045049 Bacteria 664
421 Ga0466959_0770317 3300045049 Bacteria 644
422 Ga0466958_0080568 3300045836 Bacteria 2003
423 Ga0466967_0078087 3300045976 Bacteria 2982
424 Ga0466967_0869996 3300045976 Bacteria 896
425 Ga0495592_0025795 3300046454 Bacteria 4461
426 Ga0495592_0035268 3300046454 Bacteria 3770
427 Ga0495603_0062406 3300046455 Bacteria 2200
428 Ga0495590_0217196 3300046457 Bacteria 706
429 Ga0495629_0004290 3300046459 Bacteria 10688
430 Ga0495629_0007382 3300046459 Bacteria 8105
431 Ga0495638_0029336 3300046460 Bacteria 3547
432 Ga0495638_0048855 3300046460 Bacteria 2647
433 Ga0495651_0001583 3300046462 Bacteria 17578
434 Ga0495651_0018088 3300046462 Bacteria 5456
435 Ga0495651_0513038 3300046462 Bacteria 766
436 Ga0495653_0011022 3300046463 Bacteria 7392
437 Ga0495653_0015778 3300046463 Bacteria 6159
438 Ga0495650_0078064 3300046471 Bacteria 1283
439 Ga0495582_0353692 3300046473 Bacteria 846
440 Ga0495639_0267230 3300046475 Bacteria 848
441 Ga0495664_0001921 3300046477 Bacteria 11062
442 Ga0495664_0577499 3300046477 Bacteria 669
443 Ga0495584_0291973 3300046491 Bacteria 828
444 Ga0495584_0300071 3300046491 Bacteria 816
445 Ga0495585_0185516 3300046492 Bacteria 1067
446 Ga0495585_0275297 3300046492 Bacteria 833
447 Ga0495594_0112848 3300046499 Bacteria 1533
448 Ga0495583_0000399 3300046506 Bacteria 66020
449 Ga0495606_0123071 3300046507 Bacteria 1550
450 Ga0495608_0005405 3300046511 Bacteria 9133
451 Ga0495608_0018913 3300046511 Bacteria 4747
452 Ga0495610_0223442 3300046512 Bacteria 759
453 Ga0495618_0249318 3300046514 Bacteria 1114
454 Ga0495628_0003941 3300046516 Bacteria 13224
455 Ga0495628_0048683 3300046516 Bacteria 3359
456 Ga0495630_0040720 3300046517 Bacteria 3472
457 Ga0495631_0259246 3300046518 Bacteria 741
458 Ga0495632_0063502 3300046519 Bacteria 1788
459 Ga0495632_0264513 3300046519 Bacteria 769
460 Ga0495643_0020965 3300046522 Bacteria 3758
461 Ga0495644_0108415 3300046523 Bacteria 1053
462 Ga0495648_0005492 3300046524 Bacteria 10520
463 Ga0495666_0182381 3300046526 Bacteria 969
464 Ga0495652_0008159 3300046529 Bacteria 9575
465 Ga0495652_0018809 3300046529 Bacteria 6156
466 Ga0495652_0539986 3300046529 Bacteria 803
467 Ga0495640_0032777 3300046533 Bacteria 3697
468 Ga0495640_0151251 3300046533 Bacteria 1491
469 Ga0495587_0015615 3300046536 Bacteria 4737
470 Ga0495587_0028544 3300046536 Bacteria 3392
471 Ga0495598_0096113 3300046537 Bacteria 973
472 Ga0495621_0085226 3300046539 Bacteria 1184
473 Ga0495597_0186357 3300046542 Bacteria 836
474 Ga0495622_0025480 3300046557 Bacteria 2762
475 Ga0495667_0005627 3300046559 Bacteria 8469
476 Ga0495667_0135984 3300046559 Bacteria 1584
477 Ga0495668_0209826 3300046616 Bacteria 1066
478 Ga0495634_0009394 3300046642 Bacteria 7213
479 Ga0495634_0443650 3300046642 Bacteria 766
480 Ga0495611_0295145 3300046648 Bacteria 747
481 Ga0495625_0510395 3300046660 Bacteria 734
482 Ga0495625_0544127 3300046660 Bacteria 704
483 Ga0495635_0011234 3300046663 Bacteria 6278
484 Ga0495635_0017454 3300046663 Bacteria 5013
485 Ga0495635_0029429 3300046663 Bacteria 3819
486 Ga0495659_0129293 3300046664 Bacteria 1000
487 Ga0495588_0013209 3300046674 Bacteria 3929
488 Ga0495657_0005728 3300046675 Bacteria 9787
489 Ga0495657_0011375 3300046675 Bacteria 6657
490 Ga0495599_0006706 3300046678 Bacteria 6954
491 Ga0495599_0038367 3300046678 Bacteria 3010
492 Ga0495623_0013374 3300046679 Bacteria 5321
493 Ga0495623_0151330 3300046679 Bacteria 1371
494 Ga0495646_0007443 3300046680 Bacteria 6959
495 Ga0495646_0077229 3300046680 Bacteria 1948
496 Ga0495669_0134957 3300046684 Bacteria 1163
497 Ga0495669_0322398 3300046684 Bacteria 746
498 Ga0495613_0487293 3300046689 Bacteria 831
499 Ga0495624_0165812 3300046690 Bacteria 1348
500 Ga0495670_0413127 3300046691 Bacteria 730
501 Ga0495670_0439711 3300046691 Bacteria 706
502 Ga0495649_0128756 3300046694 Bacteria 1336
503 Ga0495589_0004447 3300046794 Bacteria 7455
504 Ga0495589_0117126 3300046794 Bacteria 1284
505 Ga0495589_0171273 3300046794 Bacteria 1032
506 Ga0495600_0003173 3300046809 Bacteria 9620
507 Ga0495600_0031143 3300046809 Bacteria 3454
508 Ga0495660_0064640 3300046810 Bacteria 1955
509 Ga0495660_0179841 3300046810 Bacteria 1024
510 Ga0495581_0091626 3300047315 Bacteria 1764
511 Ga0495604_0002451 3300047317 Bacteria 14835
512 Ga0495604_0024181 3300047317 Bacteria 4848
513 Ga0495604_0044801 3300047317 Bacteria 3454
514 Ga0495604_0329944 3300047317 Bacteria 1018
515 Ga0495636_0324399 3300047318 Bacteria 723
516 Ga0495674_0021952 3300047319 Bacteria 5894
517 Ga0495674_0024430 3300047319 Bacteria 5553
518 Ga0495672_0240676 3300047320 Bacteria 884
519 Ga0495676_0148688 3300047321 Bacteria 1670
520 Ga0495680_0004114 3300047322 Bacteria 13987
521 Ga0495683_0068140 3300047323 Bacteria 1751
522 Ga0495687_014614 3300047443 Bacteria 4030
523 Ga0495675_0007193 3300047444 Bacteria 6853
524 Ga0495675_0017754 3300047444 Bacteria 4511
525 Ga0495673_0000053 3300047469 Bacteria 254433
526 Ga0495684_0007358 3300047471 Bacteria 8533
527 Ga0495602_0007289 3300048088 Bacteria 11579
528 Ga0495602_0115238 3300048088 Bacteria 2174
529 Ga0495615_0143510 3300048090 Bacteria 706
530 Ga0496100_0018006 3300048903 Bacteria 4183
531 Ga0496100_0105859 3300048903 Bacteria 1946
532 Ga0496100_0252143 3300048903 Bacteria 1306
533 Ga0496100_0322330 3300048903 Bacteria 1161
534 Ga0496100_0346737 3300048903 Bacteria 1121
535 Ga0496100_0503307 3300048903 Bacteria 933
536 Ga0496100_0830206 3300048903 Bacteria 724
537 Ga0496101_0035808 3300048904 Bacteria 3512
538 Ga0496101_0194310 3300048904 Bacteria 1567
539 Ga0496101_0208750 3300048904 Bacteria 1512
540 Ga0496101_0707960 3300048904 Bacteria 795
541 Ga0496102_0013449 3300048905 Bacteria 7089
542 Ga0496102_0272614 3300048905 Bacteria 1595
543 Ga0496102_0333520 3300048905 Bacteria 1428
544 Ga0496103_0024819 3300048906 Bacteria 3618
545 Ga0496104_0049397 3300048907 Bacteria 3967
546 Ga0496105_0013759 3300048908 Bacteria 6424
547 Ga0496105_0064804 3300048908 Bacteria 3015
548 Ga0496106_0016081 3300048909 Bacteria 5533
549 Ga0496106_0031859 3300048909 Bacteria 3929
550 Ga0496106_0045461 3300048909 Bacteria 3298
551 Ga0496106_0155837 3300048909 Bacteria 1803
552 Ga0496106_0265384 3300048909 Bacteria 1374
553 Ga0496106_0451327 3300048909 Bacteria 1033
554 Ga0496107_0000191 3300048910 Bacteria 31847
555 Ga0496107_0136469 3300048910 Bacteria 1812
556 Ga0496107_0627607 3300048910 Bacteria 793
557 Ga0496108_0171300 3300048911 Bacteria 1878
558 Ga0496108_0185630 3300048911 Bacteria 1801
559 Ga0496108_0385645 3300048911 Bacteria 1223
560 Ga0496109_0074842 3300048912 Bacteria 3113
561 Ga0496109_0135872 3300048912 Bacteria 2297
562 Ga0496109_0161809 3300048912 Bacteria 2097
563 Ga0496109_0484664 3300048912 Bacteria 1167
564 Ga0496109_0552490 3300048912 Bacteria 1086
565 Ga0496109_0844607 3300048912 Bacteria 854
566 Ga0496110_0046154 3300048913 Bacteria 3811
567 Ga0496110_0094730 3300048913 Bacteria 2673
568 Ga0496110_0216332 3300048913 Bacteria 1742
569 Ga0496110_0463909 3300048913 Bacteria 1154
570 Ga0496110_0831339 3300048913 Bacteria 828
571 Ga0496111_0114133 3300048914 Bacteria 1991
572 Ga0496111_0120150 3300048914 Bacteria 1941
573 Ga0496111_0263810 3300048914 Bacteria 1278
574 Ga0496112_0000045 3300048915 Bacteria 85873
575 Ga0496112_0040796 3300048915 Bacteria 4539
576 Ga0496112_0051708 3300048915 Bacteria 4030
577 Ga0496112_0190082 3300048915 Bacteria 2015
578 Ga0496112_0366475 3300048915 Bacteria 1382
579 Ga0496112_0730263 3300048915 Bacteria 917
580 Ga0496113_0041112 3300048916 Bacteria 3409
581 Ga0496113_0471411 3300048916 Bacteria 1009
582 Ga0496114_0035171 3300048917 Bacteria 4136
583 Ga0496114_0589968 3300048917 Bacteria 980
584 Ga0496115_0106189 3300048918 Bacteria 2305
585 Ga0496115_0730753 3300048918 Bacteria 776
586 Ga0496117_0092093 3300048920 Bacteria 1948
587 Ga0496118_0047165 3300048921 Bacteria 3343
588 Ga0496118_0081442 3300048921 Bacteria 2273
589 Ga0496118_0436887 3300048921 Bacteria 668
590 Ga0496119_0146893 3300048922 Bacteria 1267
591 Ga0496120_0039541 3300048923 Bacteria 2781
592 Ga0496121_0001169 3300048924 Bacteria 46049
593 Ga0496121_0004381 3300048924 Bacteria 19069
594 Ga0496121_0047210 3300048924 Bacteria 3677
595 Ga0496121_0075894 3300048924 Bacteria 2683
596 Ga0496121_0111792 3300048924 Bacteria 2082
597 Ga0496121_0270433 3300048924 Bacteria 1168
598 Ga0496121_0394116 3300048924 Bacteria 909
599 Ga0496122_0181684 3300048925 Bacteria 1254
600 Ga0496123_0248670 3300048926 Bacteria 879
601 Ga0496124_0238269 3300048927 Bacteria 1355
602 Ga0496125_0082316 3300048928 Bacteria 2454
603 Ga0496125_0085529 3300048928 Bacteria 2389
604 Ga0496126_0005092 3300048929 Bacteria 15243
605 Ga0496126_0025891 3300048929 Bacteria 5634
606 Ga0496126_0071562 3300048929 Bacteria 3086
607 Ga0496126_0119596 3300048929 Bacteria 2286
608 Ga0496126_0122496 3300048929 Bacteria 2254
609 Ga0496126_0159699 3300048929 Bacteria 1927
610 Ga0496126_0205972 3300048929 Bacteria 1658
611 Ga0496126_0226326 3300048929 Bacteria 1569
612 Ga0496126_0333683 3300048929 Bacteria 1244
613 Ga0496126_0475226 3300048929 Bacteria 1002
614 Ga0495682_0147956 3300049460 Bacteria 838
615 Ga0501047_0089734 3300049581 Bacteria 2951
616 Ga0501070_0039101 3300049586 Bacteria 3958
617 Ga0501074_0112947 3300049590 Bacteria 1944
618 Ga0501076_0727512 3300049592 Bacteria 819
619 Ga0501080_0008826 3300049742 Bacteria 9162
620 nmdc:mga03n38_205736_c1 3300050490 Bacteria 1021
621 nmdc:mga00v17_120973_c1 3300050491 Bacteria 1667
622 nmdc:mga00v17_229841_c1 3300050491 Bacteria 1202
623 nmdc:mga0yw44_201939_c1 3300050492 Bacteria 1313
624 nmdc:mga0yw44_49041_c1 3300050492 Bacteria 2547
625 nmdc:mga0yw44_87026_c1 3300050492 Bacteria 1969
626 nmdc:mga0yw44_96688_c1 3300050492 Bacteria 1875
627 nmdc:mga0yw44_98668_c1 3300050492 Bacteria 1858
628 nmdc:mga0k408_122025_c1 3300050493 Bacteria 1544
629 nmdc:mga0k408_236724_c1 3300050493 Bacteria 1090
630 nmdc:mga06z11_61294_c1 3300050494 Bacteria 1962
631 nmdc:mga04h51_38503_c1 3300050495 Bacteria 1549
632 nmdc:mga07m45_18815_c1 3300050496 Bacteria 3736
633 nmdc:mga0n895_12280_c1 3300050512 Bacteria 7675
634 nmdc:mga0rr50_205675_c1 3300050513 Bacteria 1620
635 nmdc:mga0a205_591472_c1 3300050515 Bacteria 963
636 nmdc:mga0sz30_213032_c1 3300050516 Bacteria 858
637 Ga0495601_0095059 3300053077 Bacteria 1921
638 Ga0495601_0162070 3300053077 Bacteria 1462
639 Ga0495601_0225166 3300053077 Bacteria 1225
640 Ga0495595_0000665 3300053084 Bacteria 13109
641 Ga0495595_0193074 3300053084 Bacteria 1012
642 Ga0495619_0007310 3300053085 Bacteria 6995
643 Ga0500578_0400449 3300053086 Bacteria 791
644 Ga0500643_000047 3300053087 Bacteria 148938
645 Ga0500583_0083581 3300053092 Bacteria 1545
646 Ga0500566_0000003 3300053094 Bacteria 166820
647 Ga0500566_0002730 3300053094 Bacteria 10521
648 Ga0500566_0160147 3300053094 Bacteria 1174
649 Ga0500641_0144200 3300053096 Bacteria 1029
650 Ga0500555_002126 3300053103 Bacteria 5793
651 Ga0500556_0043709 3300053104 Bacteria 1591
652 Ga0500557_000115 3300053105 Bacteria 22643
653 Ga0500569_149115 3300053109 Bacteria 788
654 Ga0500572_000637 3300053111 Bacteria 11626
655 Ga0500594_0021143 3300053118 Bacteria 1629
656 Ga0500595_077137 3300053119 Bacteria 980
657 Ga0500607_062780 3300053121 Bacteria 1940
658 Ga0500614_034579 3300053123 Bacteria 1254
659 Ga0500642_0000141 3300053130 Bacteria 32052
660 Ga0500642_0009034 3300053130 Bacteria 3440
661 Ga0500658_0191254 3300053134 Bacteria 934
662 Ga0500559_0000226 3300053136 Bacteria 45182
663 Ga0500559_0007137 3300053136 Bacteria 4979
664 Ga0500559_0007393 3300053136 Bacteria 4871
665 Ga0500568_0014324 3300053139 Bacteria 3584
666 Ga0500577_0001229 3300053142 Bacteria 6556
667 Ga0500577_0139241 3300053142 Bacteria 1022
668 Ga0500622_0018031 3300053156 Bacteria 3753
669 Ga0500627_0011669 3300053158 Bacteria 3259
670 Ga0500639_118688 3300053163 Bacteria 1274
671 Ga0500636_0000024 3300053177 Bacteria 86744
672 Ga0500636_0007534 3300053177 Bacteria 6295
673 Ga0500637_0202640 3300053178 Bacteria 1129
674 Ga0500637_0284887 3300053178 Bacteria 908
675 Ga0500645_005912 3300053730 Bacteria 4434
676 Ga0500596_000691 3300053735 Bacteria 6570
677 Ga0500599_007639 3300053736 Bacteria 1395
678 Ga0500601_000728 3300053737 Bacteria 4321
679 Ga0500601_008085 3300053737 Bacteria 1168
680 Ga0466962_0183960 3300061719 Bacteria 1019

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0089734 Ga0501047_0089734_1662_2243 182
2 3300049586 Ga0501070_0039101 Ga0501070_0039101_148_729 182
3 3300049590 Ga0501074_0112947 Ga0501074_0112947_405_986 182
4 3300049742 Ga0501080_0008826 Ga0501080_0008826_4378_4959 182
5 3300046529 Ga0495652_0539986 Ga0495652_0539986_199_780 183
6 iso_pu_bacteria 2513237092 2513628722 188
7 iso_pu_bacteria 2513237139 2513876644 188
8 iso_pu_bacteria 2617270735 2617350333 188
9 iso_pu_bacteria 2791355196 2793061251 188
10 iso_pu_bacteria 2802429603 2805918624 188
11 iso_pu_bacteria 2824696289 2824703093 188
12 iso_pu_bacteria 2824773399 2824779666 188
13 iso_pu_bacteria 2841941048 2841947375 188
14 iso_pu_bacteria 2841974524 2841981009 188
15 iso_pu_bacteria 2847939898 2847948149 188
16 iso_pu_bacteria 2849076700 2849077940 188
17 iso_pu_bacteria 2874612657 2874618515 188
18 iso_pu_bacteria 2874628541 2874632935 188
19 iso_pu_bacteria 2879110137 2879110801 188
20 iso_pu_bacteria 2904541872 2904546716 189
21 iso_pu_bacteria 2929160207 2929166165 189
22 3300001979 JGI24740J21852_10083413 JGI24740J21852_100834131 192
23 3300001990 JGI24737J22298_10075821 JGI24737J22298_100758211 192
24 3300002075 JGI24738J21930_10075007 JGI24738J21930_100750071 192
25 3300003215 JGI25153J46596_10002018 JGI25153J46596_100020185 192
26 3300003215 JGI25153J46596_10010038 JGI25153J46596_100100384 192
27 3300003659 JGI25404J52841_10009670 JGI25404J52841_100096704 192
28 3300003659 JGI25404J52841_10058593 JGI25404J52841_100585931 192
29 3300003752 Ga0055539_1011873 Ga0055539_10118732 192
30 3300003771 Ga0055526_1047477 Ga0055526_10474771 192
31 3300003794 Ga0055531_10004117 Ga0055531_100041173 192
32 3300003911 JGI25405J52794_10060247 JGI25405J52794_100602471 192
33 3300005262 Ga0065165_1002741 Ga0065165_10027414 192
34 3300005262 Ga0065165_1004574 Ga0065165_10045747 192
35 3300005262 Ga0065165_1011498 Ga0065165_10114981 192
36 3300005328 Ga0070676_10775333 Ga0070676_107753331 192
37 3300005329 Ga0070683_100066232 Ga0070683_1000662323 192
38 3300005331 Ga0070670_100087921 Ga0070670_1000879212 192
39 3300005331 Ga0070670_100571223 Ga0070670_1005712231 192
40 3300005334 Ga0068869_101015382 Ga0068869_1010153821 192
41 3300005335 Ga0070666_10380804 Ga0070666_103808041 192
42 3300005335 Ga0070666_10618792 Ga0070666_106187921 192
43 3300005341 Ga0070691_10269331 Ga0070691_102693311 192
44 3300005347 Ga0070668_100167673 Ga0070668_1001676731 192
45 3300005347 Ga0070668_100805696 Ga0070668_1008056962 192
46 3300005364 Ga0070673_101533867 Ga0070673_1015338671 192
47 3300005366 Ga0070659_100122307 Ga0070659_1001223072 192
48 3300005367 Ga0070667_100217226 Ga0070667_1002172262 192
49 3300005367 Ga0070667_100768056 Ga0070667_1007680561 192
50 3300005434 Ga0070709_10028973 Ga0070709_100289733 192
51 3300005434 Ga0070709_10132862 Ga0070709_101328622 192
52 3300005434 Ga0070709_10320911 Ga0070709_103209111 192
53 3300005435 Ga0070714_100008712 Ga0070714_1000087123 192
54 3300005435 Ga0070714_100211969 Ga0070714_1002119691 192
55 3300005435 Ga0070714_100308489 Ga0070714_1003084891 192
56 3300005435 Ga0070714_100355431 Ga0070714_1003554312 192
57 3300005436 Ga0070713_100001936 Ga0070713_10000193615 192
58 3300005436 Ga0070713_100007442 Ga0070713_1000074429 192
59 3300005437 Ga0070710_10000534 Ga0070710_100005349 192
60 3300005437 Ga0070710_10006878 Ga0070710_100068784 192
61 3300005438 Ga0070701_10379997 Ga0070701_103799971 192
62 3300005439 Ga0070711_100000548 Ga0070711_10000054813 192
63 3300005439 Ga0070711_100004958 Ga0070711_1000049589 192
64 3300005439 Ga0070711_100010548 Ga0070711_1000105487 192
65 3300005439 Ga0070711_100373276 Ga0070711_1003732762 192
66 3300005455 Ga0070663_100087429 Ga0070663_1000874293 192
67 3300005455 Ga0070663_100165706 Ga0070663_1001657063 192
68 3300005455 Ga0070663_100995476 Ga0070663_1009954761 192
69 3300005456 Ga0070678_100853981 Ga0070678_1008539811 192
70 3300005456 Ga0070678_100985890 Ga0070678_1009858901 192
71 3300005458 Ga0070681_10335052 Ga0070681_103350522 192
72 3300005466 Ga0070685_10073379 Ga0070685_100733793 192
73 3300005467 Ga0070706_100268703 Ga0070706_1002687032 192
74 3300005471 Ga0070698_100062802 Ga0070698_1000628023 192
75 3300005530 Ga0070679_100114126 Ga0070679_1001141262 192
76 3300005535 Ga0070684_100020644 Ga0070684_1000206445 192
77 3300005535 Ga0070684_100416881 Ga0070684_1004168811 192
78 3300005539 Ga0068853_100022057 Ga0068853_1000220572 192
79 3300005539 Ga0068853_100093892 Ga0068853_1000938923 192
80 3300005539 Ga0068853_100688287 Ga0068853_1006882872 192
81 3300005547 Ga0070693_100085329 Ga0070693_1000853291 192
82 3300005547 Ga0070693_100089030 Ga0070693_1000890301 192
83 3300005548 Ga0070665_100059266 Ga0070665_1000592664 192
84 3300005548 Ga0070665_100212350 Ga0070665_1002123501 192
85 3300005548 Ga0070665_100256214 Ga0070665_1002562143 192
86 3300005563 Ga0068855_100257859 Ga0068855_1002578592 192
87 3300005563 Ga0068855_100283236 Ga0068855_1002832363 192
88 3300005563 Ga0068855_100411793 Ga0068855_1004117932 192
89 3300005563 Ga0068855_100719613 Ga0068855_1007196132 192
90 3300005577 Ga0068857_100002410 Ga0068857_10000241016 192
91 3300005577 Ga0068857_100594282 Ga0068857_1005942821 192
92 3300005578 Ga0068854_100842681 Ga0068854_1008426812 192
93 3300005614 Ga0068856_100039675 Ga0068856_1000396755 192
94 3300005614 Ga0068856_100193562 Ga0068856_1001935623 192
95 3300005614 Ga0068856_100510864 Ga0068856_1005108641 192
96 3300005616 Ga0068852_100091790 Ga0068852_1000917903 192
97 3300005616 Ga0068852_100182297 Ga0068852_1001822972 192
98 3300005616 Ga0068852_100749211 Ga0068852_1007492112 192
99 3300005617 Ga0068859_100236483 Ga0068859_1002364833 192
100 3300005617 Ga0068859_100914702 Ga0068859_1009147021 192
101 3300005618 Ga0068864_100965907 Ga0068864_1009659072 192
102 3300005718 Ga0068866_10349597 Ga0068866_103495972 192
103 3300005718 Ga0068866_10437937 Ga0068866_104379372 192
104 3300005719 Ga0068861_100652057 Ga0068861_1006520571 192
105 3300005834 Ga0068851_10010327 Ga0068851_100103273 192
106 3300005842 Ga0068858_100159709 Ga0068858_1001597092 192
107 3300005844 Ga0068862_100252953 Ga0068862_1002529533 192
108 3300005937 Ga0081455_10052485 Ga0081455_100524852 192
109 3300005937 Ga0081455_10129342 Ga0081455_101293423 192
110 3300005937 Ga0081455_10187701 Ga0081455_101877013 192
111 3300005983 Ga0081540_1014987 Ga0081540_10149874 192
112 3300005983 Ga0081540_1028617 Ga0081540_10286173 192
113 3300005983 Ga0081540_1033365 Ga0081540_10333652 192
114 3300005983 Ga0081540_1055731 Ga0081540_10557312 192
115 3300005983 Ga0081540_1067861 Ga0081540_10678611 192
116 3300005983 Ga0081540_1092780 Ga0081540_10927802 192
117 3300005983 Ga0081540_1097432 Ga0081540_10974322 192
118 3300005985 Ga0081539_10000199 Ga0081539_1000019912 192
119 3300005985 Ga0081539_10099672 Ga0081539_100996723 192
120 3300006028 Ga0070717_10021101 Ga0070717_100211014 192
121 3300006028 Ga0070717_10734932 Ga0070717_107349321 192
122 3300006038 Ga0075365_10038932 Ga0075365_100389323 192
123 3300006038 Ga0075365_10049468 Ga0075365_100494683 192
124 3300006038 Ga0075365_10082686 Ga0075365_100826863 192
125 3300006038 Ga0075365_10131245 Ga0075365_101312452 192
126 3300006042 Ga0075368_10279302 Ga0075368_102793022 192
127 3300006048 Ga0075363_100505841 Ga0075363_1005058411 192
128 3300006051 Ga0075364_10020313 Ga0075364_100203133 192
129 3300006051 Ga0075364_10171814 Ga0075364_101718142 192
130 3300006163 Ga0070715_10294135 Ga0070715_102941352 192
131 3300006163 Ga0070715_10387327 Ga0070715_103873272 192
132 3300006173 Ga0070716_100001291 Ga0070716_10000129112 192
133 3300006173 Ga0070716_100174356 Ga0070716_1001743563 192
134 3300006175 Ga0070712_100015913 Ga0070712_1000159135 192
135 3300006175 Ga0070712_100077833 Ga0070712_1000778333 192
136 3300006178 Ga0075367_10171018 Ga0075367_101710182 192
137 3300006178 Ga0075367_10227638 Ga0075367_102276381 192
138 3300006178 Ga0075367_10351282 Ga0075367_103512821 192
139 3300006186 Ga0075369_10024501 Ga0075369_100245012 192
140 3300006195 Ga0075366_10025166 Ga0075366_100251663 192
141 3300006237 Ga0097621_100313277 Ga0097621_1003132773 192
142 3300006237 Ga0097621_100414142 Ga0097621_1004141422 192
143 3300006353 Ga0075370_10032447 Ga0075370_100324474 192
144 3300006358 Ga0068871_100841374 Ga0068871_1008413742 192
145 3300006931 Ga0097620_100236487 Ga0097620_1002364872 192
146 3300006931 Ga0097620_100914748 Ga0097620_1009147481 192
147 3300006942 Ga0099824_1020733 Ga0099824_10207333 192
148 3300006943 Ga0099822_1004972 Ga0099822_100497215 192
149 3300006944 Ga0099823_1037283 Ga0099823_10372831 192
150 3300007076 Ga0075435_100174549 Ga0075435_1001745492 192
151 3300009093 Ga0105240_10007546 Ga0105240_100075462 192
152 3300009093 Ga0105240_10226503 Ga0105240_102265033 192
153 3300009093 Ga0105240_10229058 Ga0105240_102290582 192
154 3300009093 Ga0105240_11075005 Ga0105240_110750051 192
155 3300009098 Ga0105245_10040560 Ga0105245_100405604 192
156 3300009101 Ga0105247_10039497 Ga0105247_100394975 192
157 3300009101 Ga0105247_10175840 Ga0105247_101758401 192
158 3300009101 Ga0105247_10686631 Ga0105247_106866311 192
159 3300009148 Ga0105243_10782028 Ga0105243_107820281 192
160 3300009174 Ga0105241_10038457 Ga0105241_100384573 192
161 3300009174 Ga0105241_10247964 Ga0105241_102479641 192
162 3300009176 Ga0105242_10180231 Ga0105242_101802313 192
163 3300009176 Ga0105242_10385372 Ga0105242_103853722 192
164 3300009176 Ga0105242_10786369 Ga0105242_107863692 192
165 3300009177 Ga0105248_10077058 Ga0105248_100770582 192
166 3300009177 Ga0105248_10238254 Ga0105248_102382543 192
167 3300009177 Ga0105248_10730725 Ga0105248_107307251 192
168 3300009177 Ga0105248_11426698 Ga0105248_114266981 192
169 3300009545 Ga0105237_10024884 Ga0105237_100248842 192
170 3300009545 Ga0105237_10044111 Ga0105237_100441115 192
171 3300009545 Ga0105237_10395855 Ga0105237_103958552 192
172 3300009551 Ga0105238_10191548 Ga0105238_101915483 192
173 3300009551 Ga0105238_10328745 Ga0105238_103287453 192
174 3300009551 Ga0105238_10426726 Ga0105238_104267262 192
175 3300009553 Ga0105249_10501156 Ga0105249_105011562 192
176 3300009553 Ga0105249_10751478 Ga0105249_107514781 192
177 3300009553 Ga0105249_11335731 Ga0105249_113357311 192
178 3300010375 Ga0105239_10018405 Ga0105239_100184056 192
179 3300010375 Ga0105239_10107233 Ga0105239_101072334 192
180 3300010375 Ga0105239_10267222 Ga0105239_102672222 192
181 3300010375 Ga0105239_10357028 Ga0105239_103570282 192
182 3300010375 Ga0105239_10806704 Ga0105239_108067042 192
183 3300010375 Ga0105239_12282700 Ga0105239_122827001 192
184 3300011119 Ga0105246_10581535 Ga0105246_105815351 192
185 3300011119 Ga0105246_10833270 Ga0105246_108332701 192
186 3300011119 Ga0105246_11115419 Ga0105246_111154191 192
187 3300013104 Ga0157370_10216002 Ga0157370_102160022 192
188 3300013104 Ga0157370_11203863 Ga0157370_112038631 192
189 3300013105 Ga0157369_10000685 Ga0157369_1000068513 192
190 3300013105 Ga0157369_10028615 Ga0157369_100286156 192
191 3300013105 Ga0157369_10193359 Ga0157369_101933593 192
192 3300013296 Ga0157374_10533491 Ga0157374_105334912 192
193 3300013296 Ga0157374_11080953 Ga0157374_110809531 192
194 3300013297 Ga0157378_10950192 Ga0157378_109501921 192
195 3300013306 Ga0163162_10784041 Ga0163162_107840412 192
196 3300013307 Ga0157372_10173650 Ga0157372_101736503 192
197 3300013308 Ga0157375_10243659 Ga0157375_102436591 192
198 3300013308 Ga0157375_11905208 Ga0157375_119052081 192
199 3300014325 Ga0163163_10138239 Ga0163163_101382393 192
200 3300014325 Ga0163163_10182217 Ga0163163_101822173 192
201 3300014325 Ga0163163_10458015 Ga0163163_104580152 192
202 3300014968 Ga0157379_10363880 Ga0157379_103638802 192
203 3300014968 Ga0157379_10861408 Ga0157379_108614082 192
204 3300014969 Ga0157376_10458093 Ga0157376_104580932 192
205 3300014969 Ga0157376_10468998 Ga0157376_104689982 192
206 3300017792 Ga0163161_10159918 Ga0163161_101599182 192
207 3300021377 Ga0213874_10022465 Ga0213874_100224651 192
208 3300021384 Ga0213876_10015743 Ga0213876_100157432 192
209 3300021384 Ga0213876_10030169 Ga0213876_100301693 192
210 3300025230 Ga0209563_106240 Ga0209563_1062402 192
211 3300025245 Ga0207425_1005559 Ga0207425_10055592 192
212 3300025250 Ga0209026_1022966 Ga0209026_10229661 192
213 3300025253 Ga0209677_101482 Ga0209677_1014822 192
214 3300025261 Ga0209233_1001759 Ga0209233_10017597 192
215 3300025261 Ga0209233_1005057 Ga0209233_10050574 192
216 3300025261 Ga0209233_1029636 Ga0209233_10296362 192
217 3300025272 Ga0209455_1003430 Ga0209455_10034303 192
218 3300025272 Ga0209455_1005204 Ga0209455_10052042 192
219 3300025295 Ga0209564_1001733 Ga0209564_10017332 192
220 3300025295 Ga0209564_1019308 Ga0209564_10193082 192
221 3300025297 Ga0209758_1000011 Ga0209758_1000011750 192
222 3300025297 Ga0209758_1000320 Ga0209758_100032066 192
223 3300025297 Ga0209758_1004056 Ga0209758_10040565 192
224 3300025297 Ga0209758_1011540 Ga0209758_10115404 192
225 3300025297 Ga0209758_1031721 Ga0209758_10317213 192
226 3300025297 Ga0209758_1065514 Ga0209758_10655142 192
227 3300025299 Ga0209256_1002277 Ga0209256_10022774 192
228 3300025299 Ga0209256_1035689 Ga0209256_10356892 192
229 3300025302 Ga0207426_1000902 Ga0207426_10009021 192
230 3300025302 Ga0207426_1001214 Ga0207426_100121413 192
231 3300025302 Ga0207426_1002913 Ga0207426_100291310 192
232 3300025302 Ga0207426_1006457 Ga0207426_10064573 192
233 3300025302 Ga0207426_1085627 Ga0207426_10856271 192
234 3300025304 Ga0209257_1000811 Ga0209257_100081122 192
235 3300025315 Ga0207697_10023886 Ga0207697_100238862 192
236 3300025321 Ga0207656_10002937 Ga0207656_100029371 192
237 3300025321 Ga0207656_10162835 Ga0207656_101628351 192
238 3300025321 Ga0207656_10380169 Ga0207656_103801691 192
239 3300025898 Ga0207692_10000091 Ga0207692_100000919 192
240 3300025898 Ga0207692_10012992 Ga0207692_100129921 192
241 3300025898 Ga0207692_10019595 Ga0207692_100195951 192
242 3300025898 Ga0207692_10124431 Ga0207692_101244311 192
243 3300025899 Ga0207642_10160008 Ga0207642_101600082 192
244 3300025900 Ga0207710_10313104 Ga0207710_103131041 192
245 3300025901 Ga0207688_10095556 Ga0207688_100955563 192
246 3300025901 Ga0207688_10141403 Ga0207688_101414032 192
247 3300025903 Ga0207680_10085326 Ga0207680_100853261 192
248 3300025904 Ga0207647_10056880 Ga0207647_100568801 192
249 3300025905 Ga0207685_10244013 Ga0207685_102440131 192
250 3300025906 Ga0207699_10000782 Ga0207699_100007827 192
251 3300025906 Ga0207699_10116843 Ga0207699_101168432 192
252 3300025906 Ga0207699_10192054 Ga0207699_101920542 192
253 3300025907 Ga0207645_10169074 Ga0207645_101690741 192
254 3300025909 Ga0207705_10117076 Ga0207705_101170761 192
255 3300025910 Ga0207684_10058685 Ga0207684_100586854 192
256 3300025910 Ga0207684_10185624 Ga0207684_101856242 192
257 3300025911 Ga0207654_10012455 Ga0207654_100124553 192
258 3300025911 Ga0207654_10048338 Ga0207654_100483383 192
259 3300025912 Ga0207707_10000126 Ga0207707_100001267 192
260 3300025913 Ga0207695_10000503 Ga0207695_100005035 192
261 3300025913 Ga0207695_10080555 Ga0207695_100805554 192
262 3300025914 Ga0207671_10001399 Ga0207671_1000139921 192
263 3300025914 Ga0207671_10039182 Ga0207671_100391823 192
264 3300025914 Ga0207671_10143653 Ga0207671_101436532 192
265 3300025914 Ga0207671_10146601 Ga0207671_101466012 192
266 3300025914 Ga0207671_10388212 Ga0207671_103882121 192
267 3300025914 Ga0207671_10864746 Ga0207671_108647461 192
268 3300025915 Ga0207693_10008718 Ga0207693_100087185 192
269 3300025915 Ga0207693_10044833 Ga0207693_100448333 192
270 3300025915 Ga0207693_10049980 Ga0207693_100499803 192
271 3300025915 Ga0207693_10124219 Ga0207693_101242192 192
272 3300025916 Ga0207663_10013987 Ga0207663_100139873 192
273 3300025916 Ga0207663_10014963 Ga0207663_100149635 192
274 3300025916 Ga0207663_10105709 Ga0207663_101057093 192
275 3300025916 Ga0207663_10179624 Ga0207663_101796243 192
276 3300025921 Ga0207652_10042877 Ga0207652_100428777 192
277 3300025921 Ga0207652_10081529 Ga0207652_100815292 192
278 3300025924 Ga0207694_10040624 Ga0207694_100406244 192
279 3300025924 Ga0207694_10281796 Ga0207694_102817962 192
280 3300025925 Ga0207650_10659163 Ga0207650_106591632 192
281 3300025927 Ga0207687_10021597 Ga0207687_100215972 192
282 3300025928 Ga0207700_10001432 Ga0207700_1000143215 192
283 3300025928 Ga0207700_10015439 Ga0207700_100154395 192
284 3300025928 Ga0207700_10090054 Ga0207700_100900543 192
285 3300025929 Ga0207664_10027757 Ga0207664_100277572 192
286 3300025929 Ga0207664_10087881 Ga0207664_100878813 192
287 3300025929 Ga0207664_10124175 Ga0207664_101241753 192
288 3300025929 Ga0207664_10591993 Ga0207664_105919931 192
289 3300025932 Ga0207690_10213535 Ga0207690_102135351 192
290 3300025934 Ga0207686_10050913 Ga0207686_100509131 192
291 3300025934 Ga0207686_10084586 Ga0207686_100845862 192
292 3300025934 Ga0207686_10169374 Ga0207686_101693741 192
293 3300025934 Ga0207686_10396847 Ga0207686_103968472 192
294 3300025935 Ga0207709_10586103 Ga0207709_105861031 192
295 3300025936 Ga0207670_10104254 Ga0207670_101042542 192
296 3300025937 Ga0207669_10377349 Ga0207669_103773491 192
297 3300025937 Ga0207669_10794847 Ga0207669_107948471 192
298 3300025939 Ga0207665_10006928 Ga0207665_100069286 192
299 3300025939 Ga0207665_10087703 Ga0207665_100877032 192
300 3300025941 Ga0207711_10112304 Ga0207711_101123042 192
301 3300025941 Ga0207711_10428263 Ga0207711_104282632 192
302 3300025941 Ga0207711_10494103 Ga0207711_104941032 192
303 3300025942 Ga0207689_10419368 Ga0207689_104193681 192
304 3300025942 Ga0207689_10668738 Ga0207689_106687382 192
305 3300025945 Ga0207679_10526957 Ga0207679_105269572 192
306 3300025949 Ga0207667_10007456 Ga0207667_1000745615 192
307 3300025949 Ga0207667_10129822 Ga0207667_101298223 192
308 3300025949 Ga0207667_10404371 Ga0207667_104043712 192
309 3300025949 Ga0207667_10693322 Ga0207667_106933221 192
310 3300025972 Ga0207668_10351624 Ga0207668_103516241 192
311 3300025972 Ga0207668_11018720 Ga0207668_110187201 192
312 3300025981 Ga0207640_10094034 Ga0207640_100940341 192
313 3300025986 Ga0207658_10032042 Ga0207658_100320421 192
314 3300025986 Ga0207658_10108732 Ga0207658_101087323 192
315 3300025986 Ga0207658_10404845 Ga0207658_104048451 192
316 3300026035 Ga0207703_10066172 Ga0207703_100661725 192
317 3300026041 Ga0207639_10352059 Ga0207639_103520592 192
318 3300026041 Ga0207639_10430425 Ga0207639_104304251 192
319 3300026067 Ga0207678_10083040 Ga0207678_100830403 192
320 3300026067 Ga0207678_10092881 Ga0207678_100928813 192
321 3300026067 Ga0207678_10166393 Ga0207678_101663933 192
322 3300026078 Ga0207702_10029716 Ga0207702_100297163 192
323 3300026078 Ga0207702_10345124 Ga0207702_103451242 192
324 3300026089 Ga0207648_10266867 Ga0207648_102668673 192
325 3300026095 Ga0207676_10304702 Ga0207676_103047022 192
326 3300026095 Ga0207676_11436312 Ga0207676_114363121 192
327 3300026116 Ga0207674_10008743 Ga0207674_100087435 192
328 3300026116 Ga0207674_10185558 Ga0207674_101855582 192
329 3300026116 Ga0207674_10480690 Ga0207674_104806902 192
330 3300026116 Ga0207674_11183430 Ga0207674_111834301 192
331 3300026118 Ga0207675_100242820 Ga0207675_1002428203 192
332 3300026118 Ga0207675_100621785 Ga0207675_1006217852 192
333 3300026121 Ga0207683_10116740 Ga0207683_101167403 192
334 3300026121 Ga0207683_10860030 Ga0207683_108600302 192
335 3300026142 Ga0207698_10011877 Ga0207698_100118778 192
336 3300026142 Ga0207698_10235696 Ga0207698_102356962 192
337 3300026142 Ga0207698_10610127 Ga0207698_106101272 192
338 3300026142 Ga0207698_11551253 Ga0207698_115512531 192
339 3300026142 Ga0207698_11746783 Ga0207698_117467831 192
340 3300027296 Ga0209389_1000009 Ga0209389_1000009155 192
341 3300027357 Ga0209589_1000007 Ga0209589_100000793 192
342 3300027361 Ga0209489_100008 Ga0209489_10000893 192
343 3300027361 Ga0209489_100671 Ga0209489_10067125 192
344 3300027363 Ga0209700_100009 Ga0209700_10000993 192
345 3300027363 Ga0209700_100016 Ga0209700_10001679 192
346 3300028379 Ga0268266_10014260 Ga0268266_100142604 192
347 3300028379 Ga0268266_10044273 Ga0268266_100442733 192
348 3300028379 Ga0268266_11428724 Ga0268266_114287241 192
349 3300028380 Ga0268265_10265605 Ga0268265_102656052 192
350 3300028381 Ga0268264_10023033 Ga0268264_100230337 192
351 3300028381 Ga0268264_10673709 Ga0268264_106737091 192
352 3300028786 Ga0307517_10040637 Ga0307517_100406375 192
353 3300028786 Ga0307517_10073704 Ga0307517_100737041 192
354 3300031235 Ga0265330_10045051 Ga0265330_100450511 192
355 3300031241 Ga0265325_10203463 Ga0265325_102034632 192
356 3300031249 Ga0265339_10264285 Ga0265339_102642851 192
357 3300031250 Ga0265331_10150577 Ga0265331_101505772 192
358 3300031595 Ga0265313_10061525 Ga0265313_100615252 192
359 3300031616 Ga0307508_10234721 Ga0307508_102347212 192
360 3300031711 Ga0265314_10200587 Ga0265314_102005872 192
361 3300031730 Ga0307516_10048316 Ga0307516_100483163 192
362 3300031911 Ga0307412_10662295 Ga0307412_106622952 192
363 3300032002 Ga0307416_100204999 Ga0307416_1002049991 192
364 3300032002 Ga0307416_101379324 Ga0307416_1013793241 192
365 3300033180 Ga0307510_10032634 Ga0307510_100326347 192
366 3300033180 Ga0307510_10199868 Ga0307510_101998683 192
367 3300033442 Ga0315911_1000004 Ga0315911_1000004443 192
368 3300035086 Ga0373934_0003635 Ga0373934_0003635_4936_5517 192
369 3300035111 Ga0373923_0083746 Ga0373923_0083746_485_1066 192
370 3300035113 Ga0373936_0176351 Ga0373936_0176351_85_666 192
371 3300035114 Ga0373939_0064276 Ga0373939_0064276_145_726 192
372 3300035115 Ga0373941_0036503 Ga0373941_0036503_524_1105 192
373 3300035116 Ga0373945_0202466 Ga0373945_0202466_58_639 192
374 3300035117 Ga0373953_0000752 Ga0373953_0000752_2879_3460 192
375 3300035118 Ga0373954_0001286 Ga0373954_0001286_3517_4098 192
376 3300035119 Ga0373956_0021279 Ga0373956_0021279_2029_2610 192
377 3300035120 Ga0373957_0001582 Ga0373957_0001582_3743_4324 192
378 3300035172 Ga0373955_0001870 Ga0373955_0001870_1654_2235 192
379 3300035410 Ga0373924_0001741 Ga0373924_0001741_1088_1669 192
380 3300035691 Ga0373931_0127429 Ga0373931_0127429_619_1200 192
381 3300035695 Ga0373927_0039982 Ga0373927_0039982_1686_2267 192
382 3300035695 Ga0373927_0168819 Ga0373927_0168819_827_1408 192
383 3300035724 Ga0373933_0005956 Ga0373933_0005956_724_1305 192
384 3300035725 Ga0373947_0402942 Ga0373947_0402942_104_685 192
385 3300036401 Ga0373937_0027219 Ga0373937_0027219_697_1278 192
386 3300037418 Ga0395900_0189155 Ga0395900_0189155_1203_1784 192
387 3300037466 Ga0395898_0178612 Ga0395898_0178612_293_874 192
388 3300037466 Ga0395898_0617546 Ga0395898_0617546_254_835 192
389 3300037466 Ga0395898_0821245 Ga0395898_0821245_77_658 192
390 3300037471 Ga0395905_0002843 Ga0395905_0002843_9682_10263 192
391 3300037471 Ga0395905_0412230 Ga0395905_0412230_227_808 192
392 3300037853 Ga0436364_0521266 Ga0436364_0521266_642_1223 192
393 3300037853 Ga0436364_1331208 Ga0436364_1331208_53_634 192
394 3300038443 Ga0395901_0166879 Ga0395901_0166879_858_1439 192
395 3300039437 Ga0436365_0048824 Ga0436365_0048824_263_844 192
396 3300039437 Ga0436365_0198529 Ga0436365_0198529_1360_1941 192
397 3300039437 Ga0436365_0365623 Ga0436365_0365623_23221_23802 192
398 3300039437 Ga0436365_0525473 Ga0436365_0525473_1684_2265 192
399 3300039437 Ga0436365_0575604 Ga0436365_0575604_487_1068 192
400 3300039437 Ga0436365_1667378 Ga0436365_1667378_507_1088 192
401 3300039450 Ga0436363_0108046 Ga0436363_0108046_171_752 192
402 3300041501 Ga0451845_0569045 Ga0451845_0569045_99_680 192
403 3300041512 Ga0451853_1352546 Ga0451853_1352546_258_839 192
404 3300044656 Ga0466969_0270446 Ga0466969_0270446_160_741 192
405 3300044658 Ga0466972_0002729 Ga0466972_0002729_7622_8203 192
406 3300044684 Ga0466966_0007745 Ga0466966_0007745_4299_4880 192
407 3300044684 Ga0466966_0087453 Ga0466966_0087453_950_1531 192
408 3300044693 Ga0466961_0000090 Ga0466961_0000090_47096_47677 192
409 3300044694 Ga0466963_0768436 Ga0466963_0768436_23_604 192
410 3300044706 Ga0466964_0225591 Ga0466964_0225591_110_691 192
411 3300044719 Ga0466971_0114418 Ga0466971_0114418_352_933 192
412 3300044765 Ga0466970_0129648 Ga0466970_0129648_554_1135 192
413 3300045049 Ga0466959_0015724 Ga0466959_0015724_4345_4926 192
414 3300045049 Ga0466959_0171575 Ga0466959_0171575_496_1077 192
415 3300045049 Ga0466959_0729487 Ga0466959_0729487_12_593 192
416 3300045049 Ga0466959_0770317 Ga0466959_0770317_49_630 192
417 3300045836 Ga0466958_0080568 Ga0466958_0080568_323_904 192
418 3300045976 Ga0466967_0078087 Ga0466967_0078087_1499_2080 192
419 3300045976 Ga0466967_0869996 Ga0466967_0869996_69_650 192
420 3300046454 Ga0495592_0025795 Ga0495592_0025795_3744_4325 192
421 3300046454 Ga0495592_0035268 Ga0495592_0035268_2156_2737 192
422 3300046455 Ga0495603_0062406 Ga0495603_0062406_21_602 192
423 3300046457 Ga0495590_0217196 Ga0495590_0217196_67_648 192
424 3300046459 Ga0495629_0004290 Ga0495629_0004290_3158_3739 192
425 3300046459 Ga0495629_0007382 Ga0495629_0007382_2469_3050 192
426 3300046460 Ga0495638_0029336 Ga0495638_0029336_2645_3226 192
427 3300046460 Ga0495638_0048855 Ga0495638_0048855_879_1463 192
428 3300046462 Ga0495651_0001583 Ga0495651_0001583_9356_9937 192
429 3300046462 Ga0495651_0018088 Ga0495651_0018088_137_718 192
430 3300046462 Ga0495651_0513038 Ga0495651_0513038_62_643 192
431 3300046463 Ga0495653_0011022 Ga0495653_0011022_4739_5320 192
432 3300046463 Ga0495653_0015778 Ga0495653_0015778_2665_3246 192
433 3300046471 Ga0495650_0078064 Ga0495650_0078064_151_732 192
434 3300046473 Ga0495582_0353692 Ga0495582_0353692_252_833 192
435 3300046475 Ga0495639_0267230 Ga0495639_0267230_169_750 192
436 3300046477 Ga0495664_0001921 Ga0495664_0001921_7677_8258 192
437 3300046477 Ga0495664_0577499 Ga0495664_0577499_33_614 192
438 3300046491 Ga0495584_0291973 Ga0495584_0291973_151_732 192
439 3300046491 Ga0495584_0300071 Ga0495584_0300071_173_754 192
440 3300046492 Ga0495585_0185516 Ga0495585_0185516_58_639 192
441 3300046492 Ga0495585_0275297 Ga0495585_0275297_81_662 192
442 3300046499 Ga0495594_0112848 Ga0495594_0112848_239_820 192
443 3300046506 Ga0495583_0000399 Ga0495583_0000399_47430_48014 192
444 3300046507 Ga0495606_0123071 Ga0495606_0123071_828_1409 192
445 3300046511 Ga0495608_0005405 Ga0495608_0005405_1920_2501 192
446 3300046511 Ga0495608_0018913 Ga0495608_0018913_3406_3987 192
447 3300046512 Ga0495610_0223442 Ga0495610_0223442_153_734 192
448 3300046514 Ga0495618_0249318 Ga0495618_0249318_13_594 192
449 3300046516 Ga0495628_0003941 Ga0495628_0003941_4821_5402 192
450 3300046516 Ga0495628_0048683 Ga0495628_0048683_2019_2600 192
451 3300046517 Ga0495630_0040720 Ga0495630_0040720_2483_3064 192
452 3300046518 Ga0495631_0259246 Ga0495631_0259246_29_610 192
453 3300046519 Ga0495632_0063502 Ga0495632_0063502_1039_1620 192
454 3300046519 Ga0495632_0264513 Ga0495632_0264513_112_693 192
455 3300046522 Ga0495643_0020965 Ga0495643_0020965_1314_1895 192
456 3300046523 Ga0495644_0108415 Ga0495644_0108415_358_939 192
457 3300046524 Ga0495648_0005492 Ga0495648_0005492_7579_8160 192
458 3300046526 Ga0495666_0182381 Ga0495666_0182381_86_667 192
459 3300046529 Ga0495652_0008159 Ga0495652_0008159_1390_1971 192
460 3300046529 Ga0495652_0018809 Ga0495652_0018809_3415_3996 192
461 3300046533 Ga0495640_0032777 Ga0495640_0032777_460_1041 192
462 3300046533 Ga0495640_0151251 Ga0495640_0151251_653_1234 192
463 3300046536 Ga0495587_0015615 Ga0495587_0015615_137_718 192
464 3300046536 Ga0495587_0028544 Ga0495587_0028544_624_1205 192
465 3300046537 Ga0495598_0096113 Ga0495598_0096113_83_664 192
466 3300046539 Ga0495621_0085226 Ga0495621_0085226_55_636 192
467 3300046542 Ga0495597_0186357 Ga0495597_0186357_42_623 192
468 3300046557 Ga0495622_0025480 Ga0495622_0025480_173_754 192
469 3300046559 Ga0495667_0005627 Ga0495667_0005627_1008_1589 192
470 3300046559 Ga0495667_0135984 Ga0495667_0135984_257_838 192
471 3300046616 Ga0495668_0209826 Ga0495668_0209826_123_704 192
472 3300046642 Ga0495634_0009394 Ga0495634_0009394_637_1218 192
473 3300046642 Ga0495634_0443650 Ga0495634_0443650_13_594 192
474 3300046648 Ga0495611_0295145 Ga0495611_0295145_127_708 192
475 3300046660 Ga0495625_0510395 Ga0495625_0510395_133_714 192
476 3300046660 Ga0495625_0544127 Ga0495625_0544127_66_647 192
477 3300046663 Ga0495635_0011234 Ga0495635_0011234_2863_3444 192
478 3300046663 Ga0495635_0017454 Ga0495635_0017454_1091_1672 192
479 3300046663 Ga0495635_0029429 Ga0495635_0029429_2388_2969 192
480 3300046664 Ga0495659_0129293 Ga0495659_0129293_160_741 192
481 3300046674 Ga0495588_0013209 Ga0495588_0013209_548_1129 192
482 3300046675 Ga0495657_0005728 Ga0495657_0005728_3066_3647 192
483 3300046675 Ga0495657_0011375 Ga0495657_0011375_747_1328 192
484 3300046678 Ga0495599_0006706 Ga0495599_0006706_5777_6358 192
485 3300046678 Ga0495599_0038367 Ga0495599_0038367_865_1446 192
486 3300046679 Ga0495623_0013374 Ga0495623_0013374_849_1430 192
487 3300046679 Ga0495623_0151330 Ga0495623_0151330_129_710 192
488 3300046680 Ga0495646_0007443 Ga0495646_0007443_6174_6755 192
489 3300046680 Ga0495646_0077229 Ga0495646_0077229_147_728 192
490 3300046684 Ga0495669_0134957 Ga0495669_0134957_178_759 192
491 3300046684 Ga0495669_0322398 Ga0495669_0322398_80_661 192
492 3300046689 Ga0495613_0487293 Ga0495613_0487293_167_748 192
493 3300046690 Ga0495624_0165812 Ga0495624_0165812_316_900 192
494 3300046691 Ga0495670_0413127 Ga0495670_0413127_42_623 192
495 3300046691 Ga0495670_0439711 Ga0495670_0439711_60_644 192
496 3300046694 Ga0495649_0128756 Ga0495649_0128756_463_1044 192
497 3300046794 Ga0495589_0004447 Ga0495589_0004447_6562_7143 192
498 3300046794 Ga0495589_0117126 Ga0495589_0117126_159_740 192
499 3300046794 Ga0495589_0171273 Ga0495589_0171273_80_661 192
500 3300046809 Ga0495600_0003173 Ga0495600_0003173_3228_3809 192
501 3300046809 Ga0495600_0031143 Ga0495600_0031143_713_1294 192
502 3300046810 Ga0495660_0064640 Ga0495660_0064640_1108_1692 192
503 3300047315 Ga0495581_0091626 Ga0495581_0091626_318_899 192
504 3300047317 Ga0495604_0002451 Ga0495604_0002451_6631_7212 192
505 3300047317 Ga0495604_0024181 Ga0495604_0024181_3215_3796 192
506 3300047317 Ga0495604_0044801 Ga0495604_0044801_713_1294 192
507 3300047317 Ga0495604_0329944 Ga0495604_0329944_206_790 192
508 3300047318 Ga0495636_0324399 Ga0495636_0324399_118_699 192
509 3300047319 Ga0495674_0021952 Ga0495674_0021952_183_764 192
510 3300047319 Ga0495674_0024430 Ga0495674_0024430_4815_5396 192
511 3300047320 Ga0495672_0240676 Ga0495672_0240676_189_770 192
512 3300047321 Ga0495676_0148688 Ga0495676_0148688_42_623 192
513 3300047322 Ga0495680_0004114 Ga0495680_0004114_5795_6376 192
514 3300047323 Ga0495683_0068140 Ga0495683_0068140_1159_1740 192
515 3300047443 Ga0495687_014614 Ga0495687_014614_942_1523 192
516 3300047444 Ga0495675_0007193 Ga0495675_0007193_2191_2772 192
517 3300047444 Ga0495675_0017754 Ga0495675_0017754_3616_4197 192
518 3300047469 Ga0495673_0000053 Ga0495673_0000053_177361_177942 192
519 3300047471 Ga0495684_0007358 Ga0495684_0007358_6992_7573 192
520 3300048088 Ga0495602_0007289 Ga0495602_0007289_3351_3932 192
521 3300048088 Ga0495602_0115238 Ga0495602_0115238_633_1214 192
522 3300048090 Ga0495615_0143510 Ga0495615_0143510_73_654 192
523 3300048903 Ga0496100_0018006 Ga0496100_0018006_1672_2253 192
524 3300048903 Ga0496100_0105859 Ga0496100_0105859_496_1077 192
525 3300048903 Ga0496100_0252143 Ga0496100_0252143_657_1238 192
526 3300048903 Ga0496100_0322330 Ga0496100_0322330_302_883 192
527 3300048903 Ga0496100_0346737 Ga0496100_0346737_492_1073 192
528 3300048903 Ga0496100_0503307 Ga0496100_0503307_95_676 192
529 3300048903 Ga0496100_0830206 Ga0496100_0830206_104_685 192
530 3300048904 Ga0496101_0035808 Ga0496101_0035808_275_856 192
531 3300048904 Ga0496101_0194310 Ga0496101_0194310_352_933 192
532 3300048904 Ga0496101_0208750 Ga0496101_0208750_87_668 192
533 3300048904 Ga0496101_0707960 Ga0496101_0707960_193_774 192
534 3300048905 Ga0496102_0013449 Ga0496102_0013449_226_807 192
535 3300048905 Ga0496102_0272614 Ga0496102_0272614_39_620 192
536 3300048905 Ga0496102_0333520 Ga0496102_0333520_62_643 192
537 3300048906 Ga0496103_0024819 Ga0496103_0024819_2105_2686 192
538 3300048907 Ga0496104_0049397 Ga0496104_0049397_3008_3589 192
539 3300048908 Ga0496105_0013759 Ga0496105_0013759_4220_4801 192
540 3300048908 Ga0496105_0064804 Ga0496105_0064804_170_751 192
541 3300048909 Ga0496106_0031859 Ga0496106_0031859_246_827 192
542 3300048909 Ga0496106_0045461 Ga0496106_0045461_2265_2846 192
543 3300048909 Ga0496106_0265384 Ga0496106_0265384_120_701 192
544 3300048909 Ga0496106_0451327 Ga0496106_0451327_258_839 192
545 3300048910 Ga0496107_0136469 Ga0496107_0136469_628_1209 192
546 3300048910 Ga0496107_0627607 Ga0496107_0627607_84_665 192
547 3300048911 Ga0496108_0185630 Ga0496108_0185630_438_1019 192
548 3300048911 Ga0496108_0385645 Ga0496108_0385645_609_1190 192
549 3300048912 Ga0496109_0135872 Ga0496109_0135872_417_998 192
550 3300048912 Ga0496109_0161809 Ga0496109_0161809_115_696 192
551 3300048912 Ga0496109_0484664 Ga0496109_0484664_42_623 192
552 3300048912 Ga0496109_0552490 Ga0496109_0552490_53_634 192
553 3300048912 Ga0496109_0844607 Ga0496109_0844607_71_652 192
554 3300048913 Ga0496110_0046154 Ga0496110_0046154_1093_1674 192
555 3300048913 Ga0496110_0094730 Ga0496110_0094730_694_1275 192
556 3300048913 Ga0496110_0216332 Ga0496110_0216332_619_1200 192
557 3300048913 Ga0496110_0463909 Ga0496110_0463909_358_939 192
558 3300048913 Ga0496110_0831339 Ga0496110_0831339_170_751 192
559 3300048914 Ga0496111_0114133 Ga0496111_0114133_738_1319 192
560 3300048914 Ga0496111_0120150 Ga0496111_0120150_783_1364 192
561 3300048915 Ga0496112_0000045 Ga0496112_0000045_13361_13945 192
562 3300048915 Ga0496112_0040796 Ga0496112_0040796_3082_3663 192
563 3300048915 Ga0496112_0051708 Ga0496112_0051708_1524_2105 192
564 3300048915 Ga0496112_0190082 Ga0496112_0190082_1078_1659 192
565 3300048915 Ga0496112_0366475 Ga0496112_0366475_117_698 192
566 3300048915 Ga0496112_0730263 Ga0496112_0730263_64_645 192
567 3300048916 Ga0496113_0041112 Ga0496113_0041112_1557_2138 192
568 3300048916 Ga0496113_0471411 Ga0496113_0471411_87_668 192
569 3300048917 Ga0496114_0035171 Ga0496114_0035171_960_1541 192
570 3300048917 Ga0496114_0589968 Ga0496114_0589968_377_958 192
571 3300048918 Ga0496115_0106189 Ga0496115_0106189_637_1218 192
572 3300048918 Ga0496115_0730753 Ga0496115_0730753_51_632 192
573 3300048920 Ga0496117_0092093 Ga0496117_0092093_960_1541 192
574 3300048921 Ga0496118_0047165 Ga0496118_0047165_2208_2789 192
575 3300048921 Ga0496118_0081442 Ga0496118_0081442_1340_1921 192
576 3300048921 Ga0496118_0436887 Ga0496118_0436887_43_624 192
577 3300048922 Ga0496119_0146893 Ga0496119_0146893_438_1019 192
578 3300048923 Ga0496120_0039541 Ga0496120_0039541_678_1259 192
579 3300048924 Ga0496121_0004381 Ga0496121_0004381_1758_2339 192
580 3300048924 Ga0496121_0047210 Ga0496121_0047210_2483_3064 192
581 3300048924 Ga0496121_0075894 Ga0496121_0075894_1669_2250 192
582 3300048924 Ga0496121_0111792 Ga0496121_0111792_1314_1895 192
583 3300048924 Ga0496121_0270433 Ga0496121_0270433_34_615 192
584 3300048924 Ga0496121_0394116 Ga0496121_0394116_266_847 192
585 3300048925 Ga0496122_0181684 Ga0496122_0181684_362_943 192
586 3300048926 Ga0496123_0248670 Ga0496123_0248670_240_821 192
587 3300048927 Ga0496124_0238269 Ga0496124_0238269_253_834 192
588 3300048928 Ga0496125_0082316 Ga0496125_0082316_1805_2386 192
589 3300048928 Ga0496125_0085529 Ga0496125_0085529_599_1180 192
590 3300048929 Ga0496126_0005092 Ga0496126_0005092_3089_3670 192
591 3300048929 Ga0496126_0025891 Ga0496126_0025891_4201_4782 192
592 3300048929 Ga0496126_0071562 Ga0496126_0071562_197_778 192
593 3300048929 Ga0496126_0119596 Ga0496126_0119596_155_736 192
594 3300048929 Ga0496126_0122496 Ga0496126_0122496_731_1312 192
595 3300048929 Ga0496126_0159699 Ga0496126_0159699_475_1056 192
596 3300048929 Ga0496126_0205972 Ga0496126_0205972_90_671 192
597 3300048929 Ga0496126_0226326 Ga0496126_0226326_640_1221 192
598 3300048929 Ga0496126_0333683 Ga0496126_0333683_254_835 192
599 3300048929 Ga0496126_0475226 Ga0496126_0475226_310_891 192
600 3300049460 Ga0495682_0147956 Ga0495682_0147956_61_642 192
601 3300049592 Ga0501076_0727512 Ga0501076_0727512_186_767 192
602 3300050490 nmdc:mga03n38_205736_c1 nmdc:mga03n38_205736_c1_327_908 192
603 3300050491 nmdc:mga00v17_120973_c1 nmdc:mga00v17_120973_c1_20_601 192
604 3300050491 nmdc:mga00v17_229841_c1 nmdc:mga00v17_229841_c1_582_1163 192
605 3300050492 nmdc:mga0yw44_201939_c1 nmdc:mga0yw44_201939_c1_716_1297 192
606 3300050492 nmdc:mga0yw44_49041_c1 nmdc:mga0yw44_49041_c1_1586_2167 192
607 3300050492 nmdc:mga0yw44_87026_c1 nmdc:mga0yw44_87026_c1_1170_1751 192
608 3300050492 nmdc:mga0yw44_96688_c1 nmdc:mga0yw44_96688_c1_1273_1854 192
609 3300050492 nmdc:mga0yw44_98668_c1 nmdc:mga0yw44_98668_c1_644_1225 192
610 3300050493 nmdc:mga0k408_122025_c1 nmdc:mga0k408_122025_c1_205_786 192
611 3300050493 nmdc:mga0k408_236724_c1 nmdc:mga0k408_236724_c1_423_1004 192
612 3300050494 nmdc:mga06z11_61294_c1 nmdc:mga06z11_61294_c1_621_1202 192
613 3300050495 nmdc:mga04h51_38503_c1 nmdc:mga04h51_38503_c1_942_1523 192
614 3300050496 nmdc:mga07m45_18815_c1 nmdc:mga07m45_18815_c1_2447_3028 192
615 3300050512 nmdc:mga0n895_12280_c1 nmdc:mga0n895_12280_c1_7021_7650 192
616 3300050513 nmdc:mga0rr50_205675_c1 nmdc:mga0rr50_205675_c1_736_1317 192
617 3300050515 nmdc:mga0a205_591472_c1 nmdc:mga0a205_591472_c1_221_802 192
618 3300050516 nmdc:mga0sz30_213032_c1 nmdc:mga0sz30_213032_c1_82_663 192
619 3300053077 Ga0495601_0095059 Ga0495601_0095059_875_1456 192
620 3300053077 Ga0495601_0162070 Ga0495601_0162070_130_711 192
621 3300053077 Ga0495601_0225166 Ga0495601_0225166_89_670 192
622 3300053084 Ga0495595_0000665 Ga0495595_0000665_12175_12756 192
623 3300053084 Ga0495595_0193074 Ga0495595_0193074_160_741 192
624 3300053085 Ga0495619_0007310 Ga0495619_0007310_747_1328 192
625 3300053086 Ga0500578_0400449 Ga0500578_0400449_135_716 192
626 3300053087 Ga0500643_000047 Ga0500643_000047_42813_43394 192
627 3300053092 Ga0500583_0083581 Ga0500583_0083581_954_1535 192
628 3300053094 Ga0500566_0000003 Ga0500566_0000003_14770_15351 192
629 3300053094 Ga0500566_0002730 Ga0500566_0002730_9319_9900 192
630 3300053094 Ga0500566_0160147 Ga0500566_0160147_66_647 192
631 3300053096 Ga0500641_0144200 Ga0500641_0144200_31_612 192
632 3300053103 Ga0500555_002126 Ga0500555_002126_4189_4770 192
633 3300053104 Ga0500556_0043709 Ga0500556_0043709_359_940 192
634 3300053105 Ga0500557_000115 Ga0500557_000115_7869_8450 192
635 3300053109 Ga0500569_149115 Ga0500569_149115_190_771 192
636 3300053111 Ga0500572_000637 Ga0500572_000637_8241_8822 192
637 3300053118 Ga0500594_0021143 Ga0500594_0021143_992_1573 192
638 3300053119 Ga0500595_077137 Ga0500595_077137_41_622 192
639 3300053121 Ga0500607_062780 Ga0500607_062780_740_1321 192
640 3300053123 Ga0500614_034579 Ga0500614_034579_595_1176 192
641 3300053130 Ga0500642_0000141 Ga0500642_0000141_7892_8473 192
642 3300053130 Ga0500642_0009034 Ga0500642_0009034_885_1466 192
643 3300053134 Ga0500658_0191254 Ga0500658_0191254_140_721 192
644 3300053136 Ga0500559_0000226 Ga0500559_0000226_25834_26415 192
645 3300053136 Ga0500559_0007137 Ga0500559_0007137_362_946 192
646 3300053136 Ga0500559_0007393 Ga0500559_0007393_2609_3190 192
647 3300053139 Ga0500568_0014324 Ga0500568_0014324_1130_1711 192
648 3300053142 Ga0500577_0001229 Ga0500577_0001229_4045_4626 192
649 3300053142 Ga0500577_0139241 Ga0500577_0139241_96_677 192
650 3300053156 Ga0500622_0018031 Ga0500622_0018031_2675_3256 192
651 3300053158 Ga0500627_0011669 Ga0500627_0011669_821_1402 192
652 3300053163 Ga0500639_118688 Ga0500639_118688_660_1241 192
653 3300053177 Ga0500636_0000024 Ga0500636_0000024_20950_21531 192
654 3300053177 Ga0500636_0007534 Ga0500636_0007534_1109_1690 192
655 3300053178 Ga0500637_0202640 Ga0500637_0202640_19_600 192
656 3300053178 Ga0500637_0284887 Ga0500637_0284887_303_884 192
657 3300053730 Ga0500645_005912 Ga0500645_005912_3325_3906 192
658 3300053735 Ga0500596_000691 Ga0500596_000691_2249_2830 192
659 3300053736 Ga0500599_007639 Ga0500599_007639_116_697 192
660 3300053737 Ga0500601_000728 Ga0500601_000728_1440_2021 192
661 3300053737 Ga0500601_008085 Ga0500601_008085_569_1150 192
662 3300061719 Ga0466962_0183960 Ga0466962_0183960_419_1000 192
663 3300003187 JGI25151J46595_10002752 JGI25151J46595_100027526 193
664 3300025294 Ga0209025_1000283 Ga0209025_100028354 193
665 3300031901 Ga0307406_10000719 Ga0307406_100007194 193
666 3300048909 Ga0496106_0016081 Ga0496106_0016081_2880_3467 193
667 3300048910 Ga0496107_0000191 Ga0496107_0000191_4822_5409 193
668 3300048924 Ga0496121_0001169 Ga0496121_0001169_9091_9678 193
669 3300010375 Ga0105239_10618358 Ga0105239_106183581 194
670 3300025912 Ga0207707_10047311 Ga0207707_100473114 194
671 2162886012 MBSR1b_contig_9108740 MBSR1b_0401.00003180 195
672 3300005335 Ga0070666_10363602 Ga0070666_103636022 195
673 3300005338 Ga0068868_100287972 Ga0068868_1002879722 195
674 3300005364 Ga0070673_100470901 Ga0070673_1004709012 195
675 3300005456 Ga0070678_100028290 Ga0070678_1000282902 195
676 3300005618 Ga0068864_100014536 Ga0068864_1000145366 195
677 3300005841 Ga0068863_100023489 Ga0068863_1000234895 195
678 3300006237 Ga0097621_100717841 Ga0097621_1007178411 195
679 3300006358 Ga0068871_100466435 Ga0068871_1004664352 195
680 3300009551 Ga0105238_10147951 Ga0105238_101479511 195
681 3300013296 Ga0157374_10062849 Ga0157374_100628493 195
682 3300013306 Ga0163162_10643872 Ga0163162_106438722 195
683 3300014325 Ga0163163_10069406 Ga0163163_100694063 195
684 3300014968 Ga0157379_10119558 Ga0157379_101195582 195
685 3300025942 Ga0207689_10398595 Ga0207689_103985952 195
686 3300026023 Ga0207677_10111275 Ga0207677_101112752 195
687 3300026095 Ga0207676_10011745 Ga0207676_100117453 195
688 3300026121 Ga0207683_10059644 Ga0207683_100596443 195
689 3300031456 Ga0307513_10071688 Ga0307513_100716883 195
690 3300037853 Ga0436364_0198842 Ga0436364_0198842_917_1561 195
691 3300044684 Ga0466966_0374157 Ga0466966_0374157_49_657 195
692 3300046810 Ga0495660_0179841 Ga0495660_0179841_344_949 195
693 3300048909 Ga0496106_0155837 Ga0496106_0155837_532_1125 195
694 3300048911 Ga0496108_0171300 Ga0496108_0171300_1141_1734 195
695 3300048912 Ga0496109_0074842 Ga0496109_0074842_208_801 195
696 3300048914 Ga0496111_0263810 Ga0496111_0263810_242_835 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

79

218

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
1viu-assembly2.cif.gz_C crystal structure of putative adp ribose pyrophosphatase 0.9628 6 186
3o52-assembly2.cif.gz_C structure of the e.coli gdp-mannose hydrolase (yffh) in complex with tartrate 0.9627 6 186
1viu-assembly1.cif.gz_A crystal structure of putative adp ribose pyrophosphatase 0.9613 6 186
3o69-assembly1.cif.gz_A structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ 0.9599 6 186
3o69-assembly1.cif.gz_B structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ 0.9584 6 186
ID Description Score Start End Superfamily
3o69B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9584 6 186 3.90.79.10
3o69B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9092 6 186 3.90.79.10
1viqA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9072 5 190 3.90.79.10
af_Q1LXZ5_39_239_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9068 47 191 3.90.79.10
af_Q9LDI9_5_132_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8809 6 44 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6G8NQZ1-F1-model_v4 Uncharacterized protein 0.9859 1 51
AF-A0A2S0XQ09-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9826 1 195 GO:0005829
GO:0006753
GO:0016818
GO:0019693
GO:0046872
AF-A0A3S2B0Y2-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9813 4 122 GO:0005829
GO:0006753
GO:0016818
GO:0019693
GO:0046872
AF-A0A366EEV4-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9811 1 193 GO:0005829
GO:0006753
GO:0016818
GO:0019693
GO:0046872
AF-A0A0K6I4J3-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9799 2 194 GO:0005829
GO:0006753
GO:0016818
GO:0019693
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map