F475830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 696 | 379 | 680 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10187701|Ga0081455_101877013 |
| Length | 227 |
| Sequence | MTSRIVSSTPNGSMAASRRHEARDVFSFDDGEFFMSIADRIRVKDIRLLSDNRYTLKTTTFEWRRNDGTWQTQHRETYDRGNGAVLLPYNLAPRTVLLVRQFRYPAYVNGHDELLIEAAAGLLDDAAPEERIRAEAEEETGYRLHDVTKVFEAFMSPGAVTEKLHFFVAEYEPSMKIGSGGGNADEGEEIEVLEISIDEALAMIADGRIVDAKTIMLLQHAALKIFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 4 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 5 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 6 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 7 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 8 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 9 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 10 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 11 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 12 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 13 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 14 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 15 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 16 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 17 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 90 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 354 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 359 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 360 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 365 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 371 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 373 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 0 |
| Isolates | 2.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.22 |
| Nodule | 2.87 |
| Rhizoplane | 8.05 |
| Rhizosphere | 66.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9108740 | 2162886012 | Bacteria | 1052 |
| 2 | JGI24740J21852_10083413 | 3300001979 | Bacteria | 834 |
| 3 | JGI24737J22298_10075821 | 3300001990 | Bacteria | 1003 |
| 4 | JGI24738J21930_10075007 | 3300002075 | Bacteria | 704 |
| 5 | JGI25151J46595_10002752 | 3300003187 | Bacteria | 10217 |
| 6 | JGI25153J46596_10002018 | 3300003215 | Bacteria | 11982 |
| 7 | JGI25153J46596_10010038 | 3300003215 | Bacteria | 4321 |
| 8 | JGI25404J52841_10009670 | 3300003659 | Bacteria | 2064 |
| 9 | JGI25404J52841_10058593 | 3300003659 | Bacteria | 808 |
| 10 | Ga0055539_1011873 | 3300003752 | Bacteria | 1071 |
| 11 | Ga0055526_1047477 | 3300003771 | Bacteria | 1007 |
| 12 | Ga0055531_10004117 | 3300003794 | Bacteria | 8988 |
| 13 | JGI25405J52794_10060247 | 3300003911 | Bacteria | 820 |
| 14 | Ga0065165_1002741 | 3300005262 | Bacteria | 14058 |
| 15 | Ga0065165_1004574 | 3300005262 | Bacteria | 8441 |
| 16 | Ga0065165_1011498 | 3300005262 | Bacteria | 3684 |
| 17 | Ga0070676_10775333 | 3300005328 | Bacteria | 706 |
| 18 | Ga0070683_100066232 | 3300005329 | Bacteria | 3364 |
| 19 | Ga0070670_100087921 | 3300005331 | Bacteria | 2671 |
| 20 | Ga0070670_100571223 | 3300005331 | Bacteria | 1010 |
| 21 | Ga0068869_101015382 | 3300005334 | Bacteria | 723 |
| 22 | Ga0070666_10363602 | 3300005335 | Bacteria | 1037 |
| 23 | Ga0070666_10380804 | 3300005335 | Bacteria | 1013 |
| 24 | Ga0070666_10618792 | 3300005335 | Bacteria | 791 |
| 25 | Ga0068868_100287972 | 3300005338 | Bacteria | 1392 |
| 26 | Ga0070691_10269331 | 3300005341 | Bacteria | 920 |
| 27 | Ga0070668_100167673 | 3300005347 | Bacteria | 1786 |
| 28 | Ga0070668_100805696 | 3300005347 | Bacteria | 835 |
| 29 | Ga0070673_100470901 | 3300005364 | Bacteria | 1133 |
| 30 | Ga0070673_101533867 | 3300005364 | Bacteria | 629 |
| 31 | Ga0070659_100122307 | 3300005366 | Bacteria | 2109 |
| 32 | Ga0070667_100217226 | 3300005367 | Bacteria | 1701 |
| 33 | Ga0070667_100768056 | 3300005367 | Bacteria | 894 |
| 34 | Ga0070709_10028973 | 3300005434 | Bacteria | 3307 |
| 35 | Ga0070709_10132862 | 3300005434 | Bacteria | 1701 |
| 36 | Ga0070709_10320911 | 3300005434 | Bacteria | 1137 |
| 37 | Ga0070714_100008712 | 3300005435 | Bacteria | 7933 |
| 38 | Ga0070714_100211969 | 3300005435 | Bacteria | 1776 |
| 39 | Ga0070714_100308489 | 3300005435 | Bacteria | 1477 |
| 40 | Ga0070714_100355431 | 3300005435 | Bacteria | 1376 |
| 41 | Ga0070713_100001936 | 3300005436 | Bacteria | 13367 |
| 42 | Ga0070713_100007442 | 3300005436 | Bacteria | 7686 |
| 43 | Ga0070710_10000534 | 3300005437 | Bacteria | 17971 |
| 44 | Ga0070710_10006878 | 3300005437 | Bacteria | 5489 |
| 45 | Ga0070701_10379997 | 3300005438 | Bacteria | 890 |
| 46 | Ga0070711_100000548 | 3300005439 | Bacteria | 19604 |
| 47 | Ga0070711_100004958 | 3300005439 | Bacteria | 7906 |
| 48 | Ga0070711_100010548 | 3300005439 | Bacteria | 5720 |
| 49 | Ga0070711_100373276 | 3300005439 | Bacteria | 1151 |
| 50 | Ga0070663_100087429 | 3300005455 | Bacteria | 2304 |
| 51 | Ga0070663_100165706 | 3300005455 | Bacteria | 1704 |
| 52 | Ga0070663_100995476 | 3300005455 | Bacteria | 729 |
| 53 | Ga0070678_100028290 | 3300005456 | Bacteria | 3821 |
| 54 | Ga0070678_100853981 | 3300005456 | Bacteria | 830 |
| 55 | Ga0070678_100985890 | 3300005456 | Bacteria | 774 |
| 56 | Ga0070681_10335052 | 3300005458 | Bacteria | 1422 |
| 57 | Ga0070685_10073379 | 3300005466 | Bacteria | 2034 |
| 58 | Ga0070706_100268703 | 3300005467 | Bacteria | 1592 |
| 59 | Ga0070698_100062802 | 3300005471 | Bacteria | 3747 |
| 60 | Ga0070679_100114126 | 3300005530 | Bacteria | 2687 |
| 61 | Ga0070684_100020644 | 3300005535 | Bacteria | 5464 |
| 62 | Ga0070684_100416881 | 3300005535 | Bacteria | 1239 |
| 63 | Ga0068853_100022057 | 3300005539 | Bacteria | 5313 |
| 64 | Ga0068853_100093892 | 3300005539 | Bacteria | 2642 |
| 65 | Ga0068853_100688287 | 3300005539 | Bacteria | 975 |
| 66 | Ga0070693_100085329 | 3300005547 | Bacteria | 1892 |
| 67 | Ga0070693_100089030 | 3300005547 | Bacteria | 1857 |
| 68 | Ga0070665_100059266 | 3300005548 | Bacteria | 3838 |
| 69 | Ga0070665_100212350 | 3300005548 | Bacteria | 1936 |
| 70 | Ga0070665_100256214 | 3300005548 | Bacteria | 1751 |
| 71 | Ga0068855_100257859 | 3300005563 | Bacteria | 1943 |
| 72 | Ga0068855_100283236 | 3300005563 | Bacteria | 1840 |
| 73 | Ga0068855_100411793 | 3300005563 | Bacteria | 1480 |
| 74 | Ga0068855_100719613 | 3300005563 | Bacteria | 1067 |
| 75 | Ga0068857_100002410 | 3300005577 | Bacteria | 15249 |
| 76 | Ga0068857_100594282 | 3300005577 | Bacteria | 1046 |
| 77 | Ga0068854_100842681 | 3300005578 | Bacteria | 802 |
| 78 | Ga0068856_100039675 | 3300005614 | Bacteria | 4623 |
| 79 | Ga0068856_100193562 | 3300005614 | Bacteria | 2047 |
| 80 | Ga0068856_100510864 | 3300005614 | Bacteria | 1223 |
| 81 | Ga0068852_100091790 | 3300005616 | Bacteria | 2718 |
| 82 | Ga0068852_100182297 | 3300005616 | Bacteria | 1975 |
| 83 | Ga0068852_100749211 | 3300005616 | Bacteria | 989 |
| 84 | Ga0068859_100236483 | 3300005617 | Bacteria | 1915 |
| 85 | Ga0068859_100914702 | 3300005617 | Bacteria | 962 |
| 86 | Ga0068864_100014536 | 3300005618 | Bacteria | 6540 |
| 87 | Ga0068864_100965907 | 3300005618 | Bacteria | 844 |
| 88 | Ga0068866_10349597 | 3300005718 | Bacteria | 939 |
| 89 | Ga0068866_10437937 | 3300005718 | Bacteria | 852 |
| 90 | Ga0068861_100652057 | 3300005719 | Bacteria | 973 |
| 91 | Ga0068851_10010327 | 3300005834 | Bacteria | 4355 |
| 92 | Ga0068863_100023489 | 3300005841 | Bacteria | 5887 |
| 93 | Ga0068858_100159709 | 3300005842 | Bacteria | 2122 |
| 94 | Ga0068862_100252953 | 3300005844 | Bacteria | 1606 |
| 95 | Ga0081455_10052485 | 3300005937 | Bacteria | 3490 |
| 96 | Ga0081455_10129342 | 3300005937 | Bacteria | 1977 |
| 97 | Ga0081455_10187701 | 3300005937 | Bacteria | 1560 |
| 98 | Ga0081540_1014987 | 3300005983 | Bacteria | 4927 |
| 99 | Ga0081540_1028617 | 3300005983 | Bacteria | 3125 |
| 100 | Ga0081540_1033365 | 3300005983 | Bacteria | 2797 |
| 101 | Ga0081540_1055731 | 3300005983 | Bacteria | 1924 |
| 102 | Ga0081540_1067861 | 3300005983 | Bacteria | 1664 |
| 103 | Ga0081540_1092780 | 3300005983 | Bacteria | 1324 |
| 104 | Ga0081540_1097432 | 3300005983 | Bacteria | 1277 |
| 105 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 106 | Ga0081539_10099672 | 3300005985 | Bacteria | 1483 |
| 107 | Ga0070717_10021101 | 3300006028 | Bacteria | 5131 |
| 108 | Ga0070717_10734932 | 3300006028 | Bacteria | 897 |
| 109 | Ga0075365_10038932 | 3300006038 | Bacteria | 3093 |
| 110 | Ga0075365_10049468 | 3300006038 | Bacteria | 2770 |
| 111 | Ga0075365_10082686 | 3300006038 | Bacteria | 2177 |
| 112 | Ga0075365_10131245 | 3300006038 | Bacteria | 1734 |
| 113 | Ga0075368_10279302 | 3300006042 | Bacteria | 717 |
| 114 | Ga0075363_100505841 | 3300006048 | Bacteria | 718 |
| 115 | Ga0075364_10020313 | 3300006051 | Bacteria | 4177 |
| 116 | Ga0075364_10171814 | 3300006051 | Bacteria | 1465 |
| 117 | Ga0070715_10294135 | 3300006163 | Bacteria | 866 |
| 118 | Ga0070715_10387327 | 3300006163 | Bacteria | 773 |
| 119 | Ga0070716_100001291 | 3300006173 | Bacteria | 11061 |
| 120 | Ga0070716_100174356 | 3300006173 | Bacteria | 1406 |
| 121 | Ga0070712_100015913 | 3300006175 | Bacteria | 4850 |
| 122 | Ga0070712_100077833 | 3300006175 | Bacteria | 2392 |
| 123 | Ga0075367_10171018 | 3300006178 | Bacteria | 1353 |
| 124 | Ga0075367_10227638 | 3300006178 | Bacteria | 1167 |
| 125 | Ga0075367_10351282 | 3300006178 | Bacteria | 930 |
| 126 | Ga0075369_10024501 | 3300006186 | Bacteria | 2501 |
| 127 | Ga0075366_10025166 | 3300006195 | Bacteria | 3474 |
| 128 | Ga0097621_100313277 | 3300006237 | Bacteria | 1388 |
| 129 | Ga0097621_100414142 | 3300006237 | Bacteria | 1208 |
| 130 | Ga0097621_100717841 | 3300006237 | Bacteria | 921 |
| 131 | Ga0075370_10032447 | 3300006353 | Bacteria | 2920 |
| 132 | Ga0068871_100466435 | 3300006358 | Bacteria | 1134 |
| 133 | Ga0068871_100841374 | 3300006358 | Bacteria | 848 |
| 134 | Ga0097620_100236487 | 3300006931 | Bacteria | 1915 |
| 135 | Ga0097620_100914748 | 3300006931 | Bacteria | 962 |
| 136 | Ga0099824_1020733 | 3300006942 | Bacteria | 4755 |
| 137 | Ga0099822_1004972 | 3300006943 | Bacteria | 17360 |
| 138 | Ga0099823_1037283 | 3300006944 | Bacteria | 3685 |
| 139 | Ga0075435_100174549 | 3300007076 | Bacteria | 1814 |
| 140 | Ga0105240_10007546 | 3300009093 | Bacteria | 15763 |
| 141 | Ga0105240_10226503 | 3300009093 | Bacteria | 2175 |
| 142 | Ga0105240_10229058 | 3300009093 | Bacteria | 2161 |
| 143 | Ga0105240_11075005 | 3300009093 | Bacteria | 857 |
| 144 | Ga0105245_10040560 | 3300009098 | Bacteria | 4148 |
| 145 | Ga0105247_10039497 | 3300009101 | Bacteria | 2883 |
| 146 | Ga0105247_10175840 | 3300009101 | Bacteria | 1426 |
| 147 | Ga0105247_10686631 | 3300009101 | Bacteria | 769 |
| 148 | Ga0105243_10782028 | 3300009148 | Bacteria | 939 |
| 149 | Ga0105241_10038457 | 3300009174 | Bacteria | 3606 |
| 150 | Ga0105241_10247964 | 3300009174 | Bacteria | 1508 |
| 151 | Ga0105242_10180231 | 3300009176 | Bacteria | 1863 |
| 152 | Ga0105242_10385372 | 3300009176 | Bacteria | 1304 |
| 153 | Ga0105242_10786369 | 3300009176 | Bacteria | 940 |
| 154 | Ga0105248_10077058 | 3300009177 | Bacteria | 3748 |
| 155 | Ga0105248_10238254 | 3300009177 | Bacteria | 2048 |
| 156 | Ga0105248_10730725 | 3300009177 | Bacteria | 1117 |
| 157 | Ga0105248_11426698 | 3300009177 | Bacteria | 783 |
| 158 | Ga0105237_10024884 | 3300009545 | Bacteria | 6125 |
| 159 | Ga0105237_10044111 | 3300009545 | Bacteria | 4490 |
| 160 | Ga0105237_10395855 | 3300009545 | Bacteria | 1386 |
| 161 | Ga0105238_10147951 | 3300009551 | Bacteria | 2325 |
| 162 | Ga0105238_10191548 | 3300009551 | Bacteria | 2021 |
| 163 | Ga0105238_10328745 | 3300009551 | Bacteria | 1515 |
| 164 | Ga0105238_10426726 | 3300009551 | Bacteria | 1321 |
| 165 | Ga0105249_10501156 | 3300009553 | Bacteria | 1259 |
| 166 | Ga0105249_10751478 | 3300009553 | Bacteria | 1037 |
| 167 | Ga0105249_11335731 | 3300009553 | Bacteria | 789 |
| 168 | Ga0105239_10018405 | 3300010375 | Bacteria | 7719 |
| 169 | Ga0105239_10107233 | 3300010375 | Bacteria | 3094 |
| 170 | Ga0105239_10267222 | 3300010375 | Bacteria | 1923 |
| 171 | Ga0105239_10357028 | 3300010375 | Bacteria | 1650 |
| 172 | Ga0105239_10618358 | 3300010375 | Bacteria | 1236 |
| 173 | Ga0105239_10806704 | 3300010375 | Bacteria | 1075 |
| 174 | Ga0105239_12282700 | 3300010375 | Bacteria | 630 |
| 175 | Ga0105246_10581535 | 3300011119 | Bacteria | 965 |
| 176 | Ga0105246_10833270 | 3300011119 | Bacteria | 821 |
| 177 | Ga0105246_11115419 | 3300011119 | Bacteria | 721 |
| 178 | Ga0157370_10216002 | 3300013104 | Bacteria | 1777 |
| 179 | Ga0157370_11203863 | 3300013104 | Bacteria | 683 |
| 180 | Ga0157369_10000685 | 3300013105 | Bacteria | 43830 |
| 181 | Ga0157369_10028615 | 3300013105 | Bacteria | 6166 |
| 182 | Ga0157369_10193359 | 3300013105 | Bacteria | 2137 |
| 183 | Ga0157374_10062849 | 3300013296 | Bacteria | 3481 |
| 184 | Ga0157374_10533491 | 3300013296 | Bacteria | 1180 |
| 185 | Ga0157374_11080953 | 3300013296 | Bacteria | 822 |
| 186 | Ga0157378_10950192 | 3300013297 | Bacteria | 892 |
| 187 | Ga0163162_10643872 | 3300013306 | Bacteria | 1184 |
| 188 | Ga0163162_10784041 | 3300013306 | Bacteria | 1071 |
| 189 | Ga0157372_10173650 | 3300013307 | Bacteria | 2494 |
| 190 | Ga0157375_10243659 | 3300013308 | Bacteria | 1957 |
| 191 | Ga0157375_11905208 | 3300013308 | Bacteria | 706 |
| 192 | Ga0163163_10069406 | 3300014325 | Bacteria | 3508 |
| 193 | Ga0163163_10138239 | 3300014325 | Bacteria | 2478 |
| 194 | Ga0163163_10182217 | 3300014325 | Bacteria | 2147 |
| 195 | Ga0163163_10458015 | 3300014325 | Bacteria | 1336 |
| 196 | Ga0157379_10119558 | 3300014968 | Bacteria | 2370 |
| 197 | Ga0157379_10363880 | 3300014968 | Bacteria | 1326 |
| 198 | Ga0157379_10861408 | 3300014968 | Bacteria | 858 |
| 199 | Ga0157376_10458093 | 3300014969 | Bacteria | 1245 |
| 200 | Ga0157376_10468998 | 3300014969 | Bacteria | 1232 |
| 201 | Ga0163161_10159918 | 3300017792 | Bacteria | 1717 |
| 202 | Ga0213874_10022465 | 3300021377 | Bacteria | 1751 |
| 203 | Ga0213876_10015743 | 3300021384 | Bacteria | 4003 |
| 204 | Ga0213876_10030169 | 3300021384 | Bacteria | 2859 |
| 205 | Ga0209563_106240 | 3300025230 | Bacteria | 2064 |
| 206 | Ga0207425_1005559 | 3300025245 | Bacteria | 3575 |
| 207 | Ga0209026_1022966 | 3300025250 | Bacteria | 952 |
| 208 | Ga0209677_101482 | 3300025253 | Bacteria | 10093 |
| 209 | Ga0209233_1001759 | 3300025261 | Bacteria | 8350 |
| 210 | Ga0209233_1005057 | 3300025261 | Bacteria | 4415 |
| 211 | Ga0209233_1029636 | 3300025261 | Bacteria | 1298 |
| 212 | Ga0209455_1003430 | 3300025272 | Bacteria | 5615 |
| 213 | Ga0209455_1005204 | 3300025272 | Bacteria | 4073 |
| 214 | Ga0209025_1000283 | 3300025294 | Bacteria | 114855 |
| 215 | Ga0209564_1001733 | 3300025295 | Bacteria | 20449 |
| 216 | Ga0209564_1019308 | 3300025295 | Bacteria | 2554 |
| 217 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 218 | Ga0209758_1000320 | 3300025297 | Bacteria | 92649 |
| 219 | Ga0209758_1004056 | 3300025297 | Bacteria | 12618 |
| 220 | Ga0209758_1011540 | 3300025297 | Bacteria | 5099 |
| 221 | Ga0209758_1031721 | 3300025297 | Bacteria | 2161 |
| 222 | Ga0209758_1065514 | 3300025297 | Bacteria | 1172 |
| 223 | Ga0209256_1002277 | 3300025299 | Bacteria | 16219 |
| 224 | Ga0209256_1035689 | 3300025299 | Bacteria | 1311 |
| 225 | Ga0207426_1000902 | 3300025302 | Bacteria | 29899 |
| 226 | Ga0207426_1001214 | 3300025302 | Bacteria | 22769 |
| 227 | Ga0207426_1002913 | 3300025302 | Bacteria | 10090 |
| 228 | Ga0207426_1006457 | 3300025302 | Bacteria | 5100 |
| 229 | Ga0207426_1085627 | 3300025302 | Bacteria | 845 |
| 230 | Ga0209257_1000811 | 3300025304 | Bacteria | 45378 |
| 231 | Ga0207697_10023886 | 3300025315 | Bacteria | 2503 |
| 232 | Ga0207656_10002937 | 3300025321 | Bacteria | 5815 |
| 233 | Ga0207656_10162835 | 3300025321 | Bacteria | 1062 |
| 234 | Ga0207656_10380169 | 3300025321 | Bacteria | 708 |
| 235 | Ga0207692_10000091 | 3300025898 | Bacteria | 26705 |
| 236 | Ga0207692_10012992 | 3300025898 | Bacteria | 3598 |
| 237 | Ga0207692_10019595 | 3300025898 | Bacteria | 3061 |
| 238 | Ga0207692_10124431 | 3300025898 | Bacteria | 1448 |
| 239 | Ga0207642_10160008 | 3300025899 | Bacteria | 1208 |
| 240 | Ga0207710_10313104 | 3300025900 | Bacteria | 795 |
| 241 | Ga0207688_10095556 | 3300025901 | Bacteria | 1711 |
| 242 | Ga0207688_10141403 | 3300025901 | Bacteria | 1417 |
| 243 | Ga0207680_10085326 | 3300025903 | Bacteria | 1994 |
| 244 | Ga0207647_10056880 | 3300025904 | Bacteria | 2399 |
| 245 | Ga0207685_10244013 | 3300025905 | Bacteria | 866 |
| 246 | Ga0207699_10000782 | 3300025906 | Bacteria | 15227 |
| 247 | Ga0207699_10116843 | 3300025906 | Bacteria | 1719 |
| 248 | Ga0207699_10192054 | 3300025906 | Bacteria | 1378 |
| 249 | Ga0207645_10169074 | 3300025907 | Bacteria | 1432 |
| 250 | Ga0207705_10117076 | 3300025909 | Bacteria | 1973 |
| 251 | Ga0207684_10058685 | 3300025910 | Bacteria | 3266 |
| 252 | Ga0207684_10185624 | 3300025910 | Bacteria | 1793 |
| 253 | Ga0207654_10012455 | 3300025911 | Bacteria | 4357 |
| 254 | Ga0207654_10048338 | 3300025911 | Bacteria | 2434 |
| 255 | Ga0207707_10000126 | 3300025912 | Bacteria | 78954 |
| 256 | Ga0207707_10047311 | 3300025912 | Bacteria | 3746 |
| 257 | Ga0207695_10000503 | 3300025913 | Bacteria | 83026 |
| 258 | Ga0207695_10080555 | 3300025913 | Bacteria | 3297 |
| 259 | Ga0207671_10001399 | 3300025914 | Bacteria | 28067 |
| 260 | Ga0207671_10039182 | 3300025914 | Bacteria | 3510 |
| 261 | Ga0207671_10143653 | 3300025914 | Bacteria | 1840 |
| 262 | Ga0207671_10146601 | 3300025914 | Bacteria | 1821 |
| 263 | Ga0207671_10388212 | 3300025914 | Bacteria | 1110 |
| 264 | Ga0207671_10864746 | 3300025914 | Bacteria | 716 |
| 265 | Ga0207693_10008718 | 3300025915 | Bacteria | 8291 |
| 266 | Ga0207693_10044833 | 3300025915 | Bacteria | 3475 |
| 267 | Ga0207693_10049980 | 3300025915 | Bacteria | 3284 |
| 268 | Ga0207693_10124219 | 3300025915 | Bacteria | 2028 |
| 269 | Ga0207663_10013987 | 3300025916 | Bacteria | 4380 |
| 270 | Ga0207663_10014963 | 3300025916 | Bacteria | 4267 |
| 271 | Ga0207663_10105709 | 3300025916 | Bacteria | 1901 |
| 272 | Ga0207663_10179624 | 3300025916 | Bacteria | 1510 |
| 273 | Ga0207652_10042877 | 3300025921 | Bacteria | 3852 |
| 274 | Ga0207652_10081529 | 3300025921 | Bacteria | 2830 |
| 275 | Ga0207694_10040624 | 3300025924 | Bacteria | 3582 |
| 276 | Ga0207694_10281796 | 3300025924 | Bacteria | 1365 |
| 277 | Ga0207650_10659163 | 3300025925 | Bacteria | 882 |
| 278 | Ga0207687_10021597 | 3300025927 | Bacteria | 4278 |
| 279 | Ga0207700_10001432 | 3300025928 | Bacteria | 13527 |
| 280 | Ga0207700_10015439 | 3300025928 | Bacteria | 5039 |
| 281 | Ga0207700_10090054 | 3300025928 | Bacteria | 2420 |
| 282 | Ga0207664_10027757 | 3300025929 | Bacteria | 4296 |
| 283 | Ga0207664_10087881 | 3300025929 | Bacteria | 2542 |
| 284 | Ga0207664_10124175 | 3300025929 | Bacteria | 2165 |
| 285 | Ga0207664_10591993 | 3300025929 | Bacteria | 996 |
| 286 | Ga0207690_10213535 | 3300025932 | Bacteria | 1472 |
| 287 | Ga0207686_10050913 | 3300025934 | Bacteria | 2578 |
| 288 | Ga0207686_10084586 | 3300025934 | Bacteria | 2079 |
| 289 | Ga0207686_10169374 | 3300025934 | Bacteria | 1539 |
| 290 | Ga0207686_10396847 | 3300025934 | Bacteria | 1050 |
| 291 | Ga0207709_10586103 | 3300025935 | Bacteria | 881 |
| 292 | Ga0207670_10104254 | 3300025936 | Bacteria | 2031 |
| 293 | Ga0207669_10377349 | 3300025937 | Bacteria | 1104 |
| 294 | Ga0207669_10794847 | 3300025937 | Bacteria | 784 |
| 295 | Ga0207665_10006928 | 3300025939 | Bacteria | 7498 |
| 296 | Ga0207665_10087703 | 3300025939 | Bacteria | 2151 |
| 297 | Ga0207711_10112304 | 3300025941 | Bacteria | 2425 |
| 298 | Ga0207711_10428263 | 3300025941 | Bacteria | 1231 |
| 299 | Ga0207711_10494103 | 3300025941 | Bacteria | 1140 |
| 300 | Ga0207689_10398595 | 3300025942 | Bacteria | 1147 |
| 301 | Ga0207689_10419368 | 3300025942 | Bacteria | 1117 |
| 302 | Ga0207689_10668738 | 3300025942 | Bacteria | 875 |
| 303 | Ga0207679_10526957 | 3300025945 | Bacteria | 1057 |
| 304 | Ga0207667_10007456 | 3300025949 | Bacteria | 13143 |
| 305 | Ga0207667_10129822 | 3300025949 | Bacteria | 2595 |
| 306 | Ga0207667_10404371 | 3300025949 | Bacteria | 1390 |
| 307 | Ga0207667_10693322 | 3300025949 | Bacteria | 1021 |
| 308 | Ga0207668_10351624 | 3300025972 | Bacteria | 1232 |
| 309 | Ga0207668_11018720 | 3300025972 | Bacteria | 740 |
| 310 | Ga0207640_10094034 | 3300025981 | Bacteria | 2084 |
| 311 | Ga0207658_10032042 | 3300025986 | Bacteria | 3738 |
| 312 | Ga0207658_10108732 | 3300025986 | Bacteria | 2188 |
| 313 | Ga0207658_10404845 | 3300025986 | Bacteria | 1200 |
| 314 | Ga0207677_10111275 | 3300026023 | Bacteria | 2040 |
| 315 | Ga0207703_10066172 | 3300026035 | Bacteria | 2972 |
| 316 | Ga0207639_10352059 | 3300026041 | Bacteria | 1315 |
| 317 | Ga0207639_10430425 | 3300026041 | Bacteria | 1195 |
| 318 | Ga0207678_10083040 | 3300026067 | Bacteria | 2740 |
| 319 | Ga0207678_10092881 | 3300026067 | Bacteria | 2579 |
| 320 | Ga0207678_10166393 | 3300026067 | Bacteria | 1883 |
| 321 | Ga0207702_10029716 | 3300026078 | Bacteria | 4549 |
| 322 | Ga0207702_10345124 | 3300026078 | Bacteria | 1423 |
| 323 | Ga0207648_10266867 | 3300026089 | Bacteria | 1528 |
| 324 | Ga0207676_10011745 | 3300026095 | Bacteria | 6262 |
| 325 | Ga0207676_10304702 | 3300026095 | Bacteria | 1456 |
| 326 | Ga0207676_11436312 | 3300026095 | Bacteria | 686 |
| 327 | Ga0207674_10008743 | 3300026116 | Bacteria | 11659 |
| 328 | Ga0207674_10185558 | 3300026116 | Bacteria | 2030 |
| 329 | Ga0207674_10480690 | 3300026116 | Bacteria | 1201 |
| 330 | Ga0207674_11183430 | 3300026116 | Bacteria | 734 |
| 331 | Ga0207675_100242820 | 3300026118 | Bacteria | 1741 |
| 332 | Ga0207675_100621785 | 3300026118 | Bacteria | 1084 |
| 333 | Ga0207683_10059644 | 3300026121 | Bacteria | 3352 |
| 334 | Ga0207683_10116740 | 3300026121 | Bacteria | 2393 |
| 335 | Ga0207683_10860030 | 3300026121 | Bacteria | 842 |
| 336 | Ga0207698_10011877 | 3300026142 | Bacteria | 5670 |
| 337 | Ga0207698_10235696 | 3300026142 | Bacteria | 1664 |
| 338 | Ga0207698_10610127 | 3300026142 | Bacteria | 1077 |
| 339 | Ga0207698_11551253 | 3300026142 | Bacteria | 678 |
| 340 | Ga0207698_11746783 | 3300026142 | Bacteria | 637 |
| 341 | Ga0209389_1000009 | 3300027296 | Bacteria | 226873 |
| 342 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 343 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 344 | Ga0209489_100671 | 3300027361 | Bacteria | 66550 |
| 345 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 346 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 347 | Ga0268266_10014260 | 3300028379 | Bacteria | 6835 |
| 348 | Ga0268266_10044273 | 3300028379 | Bacteria | 3805 |
| 349 | Ga0268266_11428724 | 3300028379 | Bacteria | 667 |
| 350 | Ga0268265_10265605 | 3300028380 | Bacteria | 1528 |
| 351 | Ga0268264_10023033 | 3300028381 | Bacteria | 5082 |
| 352 | Ga0268264_10673709 | 3300028381 | Bacteria | 1025 |
| 353 | Ga0307517_10040637 | 3300028786 | Bacteria | 5056 |
| 354 | Ga0307517_10073704 | 3300028786 | Bacteria | 3022 |
| 355 | Ga0265330_10045051 | 3300031235 | Bacteria | 1945 |
| 356 | Ga0265325_10203463 | 3300031241 | Bacteria | 912 |
| 357 | Ga0265339_10264285 | 3300031249 | Bacteria | 829 |
| 358 | Ga0265331_10150577 | 3300031250 | Bacteria | 1057 |
| 359 | Ga0307513_10071688 | 3300031456 | Bacteria | 3614 |
| 360 | Ga0265313_10061525 | 3300031595 | Bacteria | 1757 |
| 361 | Ga0307508_10234721 | 3300031616 | Bacteria | 1432 |
| 362 | Ga0265314_10200587 | 3300031711 | Bacteria | 1180 |
| 363 | Ga0307516_10048316 | 3300031730 | Bacteria | 4187 |
| 364 | Ga0307406_10000719 | 3300031901 | Bacteria | 18679 |
| 365 | Ga0307412_10662295 | 3300031911 | Bacteria | 892 |
| 366 | Ga0307416_100204999 | 3300032002 | Bacteria | 1875 |
| 367 | Ga0307416_101379324 | 3300032002 | Bacteria | 811 |
| 368 | Ga0307510_10032634 | 3300033180 | Bacteria | 5863 |
| 369 | Ga0307510_10199868 | 3300033180 | Bacteria | 1535 |
| 370 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 371 | Ga0373934_0003635 | 3300035086 | Bacteria | 5667 |
| 372 | Ga0373923_0083746 | 3300035111 | Bacteria | 1386 |
| 373 | Ga0373936_0176351 | 3300035113 | Bacteria | 936 |
| 374 | Ga0373939_0064276 | 3300035114 | Bacteria | 1178 |
| 375 | Ga0373941_0036503 | 3300035115 | Bacteria | 1495 |
| 376 | Ga0373945_0202466 | 3300035116 | Bacteria | 825 |
| 377 | Ga0373953_0000752 | 3300035117 | Bacteria | 8989 |
| 378 | Ga0373954_0001286 | 3300035118 | Bacteria | 10089 |
| 379 | Ga0373956_0021279 | 3300035119 | Bacteria | 2766 |
| 380 | Ga0373957_0001582 | 3300035120 | Bacteria | 6212 |
| 381 | Ga0373955_0001870 | 3300035172 | Bacteria | 9062 |
| 382 | Ga0373924_0001741 | 3300035410 | Bacteria | 7183 |
| 383 | Ga0373931_0127429 | 3300035691 | Bacteria | 1461 |
| 384 | Ga0373927_0039982 | 3300035695 | Bacteria | 3043 |
| 385 | Ga0373927_0168819 | 3300035695 | Bacteria | 1434 |
| 386 | Ga0373933_0005956 | 3300035724 | Bacteria | 6634 |
| 387 | Ga0373947_0402942 | 3300035725 | Bacteria | 923 |
| 388 | Ga0373937_0027219 | 3300036401 | Bacteria | 5169 |
| 389 | Ga0395900_0189155 | 3300037418 | Bacteria | 2089 |
| 390 | Ga0395898_0178612 | 3300037466 | Bacteria | 2029 |
| 391 | Ga0395898_0617546 | 3300037466 | Bacteria | 1027 |
| 392 | Ga0395898_0821245 | 3300037466 | Bacteria | 869 |
| 393 | Ga0395905_0002843 | 3300037471 | Bacteria | 18958 |
| 394 | Ga0395905_0412230 | 3300037471 | Bacteria | 1246 |
| 395 | Ga0436364_0198842 | 3300037853 | Bacteria | 2267 |
| 396 | Ga0436364_0521266 | 3300037853 | Bacteria | 1341 |
| 397 | Ga0436364_1331208 | 3300037853 | Bacteria | 853 |
| 398 | Ga0395901_0166879 | 3300038443 | Bacteria | 2311 |
| 399 | Ga0436365_0048824 | 3300039437 | Bacteria | 897 |
| 400 | Ga0436365_0198529 | 3300039437 | Bacteria | 2869 |
| 401 | Ga0436365_0365623 | 3300039437 | Bacteria | 31548 |
| 402 | Ga0436365_0525473 | 3300039437 | Bacteria | 2886 |
| 403 | Ga0436365_0575604 | 3300039437 | Bacteria | 1217 |
| 404 | Ga0436365_1667378 | 3300039437 | Bacteria | 1469 |
| 405 | Ga0436363_0108046 | 3300039450 | Bacteria | 1971 |
| 406 | Ga0451845_0569045 | 3300041501 | Bacteria | 917 |
| 407 | Ga0451853_1352546 | 3300041512 | Bacteria | 1271 |
| 408 | Ga0466969_0270446 | 3300044656 | Bacteria | 770 |
| 409 | Ga0466972_0002729 | 3300044658 | Bacteria | 8737 |
| 410 | Ga0466966_0007745 | 3300044684 | Bacteria | 7114 |
| 411 | Ga0466966_0087453 | 3300044684 | Bacteria | 1937 |
| 412 | Ga0466966_0374157 | 3300044684 | Bacteria | 856 |
| 413 | Ga0466961_0000090 | 3300044693 | Bacteria | 57757 |
| 414 | Ga0466963_0768436 | 3300044694 | Bacteria | 680 |
| 415 | Ga0466964_0225591 | 3300044706 | Bacteria | 912 |
| 416 | Ga0466971_0114418 | 3300044719 | Bacteria | 1246 |
| 417 | Ga0466970_0129648 | 3300044765 | Bacteria | 1385 |
| 418 | Ga0466959_0015724 | 3300045049 | Bacteria | 5519 |
| 419 | Ga0466959_0171575 | 3300045049 | Bacteria | 1521 |
| 420 | Ga0466959_0729487 | 3300045049 | Bacteria | 664 |
| 421 | Ga0466959_0770317 | 3300045049 | Bacteria | 644 |
| 422 | Ga0466958_0080568 | 3300045836 | Bacteria | 2003 |
| 423 | Ga0466967_0078087 | 3300045976 | Bacteria | 2982 |
| 424 | Ga0466967_0869996 | 3300045976 | Bacteria | 896 |
| 425 | Ga0495592_0025795 | 3300046454 | Bacteria | 4461 |
| 426 | Ga0495592_0035268 | 3300046454 | Bacteria | 3770 |
| 427 | Ga0495603_0062406 | 3300046455 | Bacteria | 2200 |
| 428 | Ga0495590_0217196 | 3300046457 | Bacteria | 706 |
| 429 | Ga0495629_0004290 | 3300046459 | Bacteria | 10688 |
| 430 | Ga0495629_0007382 | 3300046459 | Bacteria | 8105 |
| 431 | Ga0495638_0029336 | 3300046460 | Bacteria | 3547 |
| 432 | Ga0495638_0048855 | 3300046460 | Bacteria | 2647 |
| 433 | Ga0495651_0001583 | 3300046462 | Bacteria | 17578 |
| 434 | Ga0495651_0018088 | 3300046462 | Bacteria | 5456 |
| 435 | Ga0495651_0513038 | 3300046462 | Bacteria | 766 |
| 436 | Ga0495653_0011022 | 3300046463 | Bacteria | 7392 |
| 437 | Ga0495653_0015778 | 3300046463 | Bacteria | 6159 |
| 438 | Ga0495650_0078064 | 3300046471 | Bacteria | 1283 |
| 439 | Ga0495582_0353692 | 3300046473 | Bacteria | 846 |
| 440 | Ga0495639_0267230 | 3300046475 | Bacteria | 848 |
| 441 | Ga0495664_0001921 | 3300046477 | Bacteria | 11062 |
| 442 | Ga0495664_0577499 | 3300046477 | Bacteria | 669 |
| 443 | Ga0495584_0291973 | 3300046491 | Bacteria | 828 |
| 444 | Ga0495584_0300071 | 3300046491 | Bacteria | 816 |
| 445 | Ga0495585_0185516 | 3300046492 | Bacteria | 1067 |
| 446 | Ga0495585_0275297 | 3300046492 | Bacteria | 833 |
| 447 | Ga0495594_0112848 | 3300046499 | Bacteria | 1533 |
| 448 | Ga0495583_0000399 | 3300046506 | Bacteria | 66020 |
| 449 | Ga0495606_0123071 | 3300046507 | Bacteria | 1550 |
| 450 | Ga0495608_0005405 | 3300046511 | Bacteria | 9133 |
| 451 | Ga0495608_0018913 | 3300046511 | Bacteria | 4747 |
| 452 | Ga0495610_0223442 | 3300046512 | Bacteria | 759 |
| 453 | Ga0495618_0249318 | 3300046514 | Bacteria | 1114 |
| 454 | Ga0495628_0003941 | 3300046516 | Bacteria | 13224 |
| 455 | Ga0495628_0048683 | 3300046516 | Bacteria | 3359 |
| 456 | Ga0495630_0040720 | 3300046517 | Bacteria | 3472 |
| 457 | Ga0495631_0259246 | 3300046518 | Bacteria | 741 |
| 458 | Ga0495632_0063502 | 3300046519 | Bacteria | 1788 |
| 459 | Ga0495632_0264513 | 3300046519 | Bacteria | 769 |
| 460 | Ga0495643_0020965 | 3300046522 | Bacteria | 3758 |
| 461 | Ga0495644_0108415 | 3300046523 | Bacteria | 1053 |
| 462 | Ga0495648_0005492 | 3300046524 | Bacteria | 10520 |
| 463 | Ga0495666_0182381 | 3300046526 | Bacteria | 969 |
| 464 | Ga0495652_0008159 | 3300046529 | Bacteria | 9575 |
| 465 | Ga0495652_0018809 | 3300046529 | Bacteria | 6156 |
| 466 | Ga0495652_0539986 | 3300046529 | Bacteria | 803 |
| 467 | Ga0495640_0032777 | 3300046533 | Bacteria | 3697 |
| 468 | Ga0495640_0151251 | 3300046533 | Bacteria | 1491 |
| 469 | Ga0495587_0015615 | 3300046536 | Bacteria | 4737 |
| 470 | Ga0495587_0028544 | 3300046536 | Bacteria | 3392 |
| 471 | Ga0495598_0096113 | 3300046537 | Bacteria | 973 |
| 472 | Ga0495621_0085226 | 3300046539 | Bacteria | 1184 |
| 473 | Ga0495597_0186357 | 3300046542 | Bacteria | 836 |
| 474 | Ga0495622_0025480 | 3300046557 | Bacteria | 2762 |
| 475 | Ga0495667_0005627 | 3300046559 | Bacteria | 8469 |
| 476 | Ga0495667_0135984 | 3300046559 | Bacteria | 1584 |
| 477 | Ga0495668_0209826 | 3300046616 | Bacteria | 1066 |
| 478 | Ga0495634_0009394 | 3300046642 | Bacteria | 7213 |
| 479 | Ga0495634_0443650 | 3300046642 | Bacteria | 766 |
| 480 | Ga0495611_0295145 | 3300046648 | Bacteria | 747 |
| 481 | Ga0495625_0510395 | 3300046660 | Bacteria | 734 |
| 482 | Ga0495625_0544127 | 3300046660 | Bacteria | 704 |
| 483 | Ga0495635_0011234 | 3300046663 | Bacteria | 6278 |
| 484 | Ga0495635_0017454 | 3300046663 | Bacteria | 5013 |
| 485 | Ga0495635_0029429 | 3300046663 | Bacteria | 3819 |
| 486 | Ga0495659_0129293 | 3300046664 | Bacteria | 1000 |
| 487 | Ga0495588_0013209 | 3300046674 | Bacteria | 3929 |
| 488 | Ga0495657_0005728 | 3300046675 | Bacteria | 9787 |
| 489 | Ga0495657_0011375 | 3300046675 | Bacteria | 6657 |
| 490 | Ga0495599_0006706 | 3300046678 | Bacteria | 6954 |
| 491 | Ga0495599_0038367 | 3300046678 | Bacteria | 3010 |
| 492 | Ga0495623_0013374 | 3300046679 | Bacteria | 5321 |
| 493 | Ga0495623_0151330 | 3300046679 | Bacteria | 1371 |
| 494 | Ga0495646_0007443 | 3300046680 | Bacteria | 6959 |
| 495 | Ga0495646_0077229 | 3300046680 | Bacteria | 1948 |
| 496 | Ga0495669_0134957 | 3300046684 | Bacteria | 1163 |
| 497 | Ga0495669_0322398 | 3300046684 | Bacteria | 746 |
| 498 | Ga0495613_0487293 | 3300046689 | Bacteria | 831 |
| 499 | Ga0495624_0165812 | 3300046690 | Bacteria | 1348 |
| 500 | Ga0495670_0413127 | 3300046691 | Bacteria | 730 |
| 501 | Ga0495670_0439711 | 3300046691 | Bacteria | 706 |
| 502 | Ga0495649_0128756 | 3300046694 | Bacteria | 1336 |
| 503 | Ga0495589_0004447 | 3300046794 | Bacteria | 7455 |
| 504 | Ga0495589_0117126 | 3300046794 | Bacteria | 1284 |
| 505 | Ga0495589_0171273 | 3300046794 | Bacteria | 1032 |
| 506 | Ga0495600_0003173 | 3300046809 | Bacteria | 9620 |
| 507 | Ga0495600_0031143 | 3300046809 | Bacteria | 3454 |
| 508 | Ga0495660_0064640 | 3300046810 | Bacteria | 1955 |
| 509 | Ga0495660_0179841 | 3300046810 | Bacteria | 1024 |
| 510 | Ga0495581_0091626 | 3300047315 | Bacteria | 1764 |
| 511 | Ga0495604_0002451 | 3300047317 | Bacteria | 14835 |
| 512 | Ga0495604_0024181 | 3300047317 | Bacteria | 4848 |
| 513 | Ga0495604_0044801 | 3300047317 | Bacteria | 3454 |
| 514 | Ga0495604_0329944 | 3300047317 | Bacteria | 1018 |
| 515 | Ga0495636_0324399 | 3300047318 | Bacteria | 723 |
| 516 | Ga0495674_0021952 | 3300047319 | Bacteria | 5894 |
| 517 | Ga0495674_0024430 | 3300047319 | Bacteria | 5553 |
| 518 | Ga0495672_0240676 | 3300047320 | Bacteria | 884 |
| 519 | Ga0495676_0148688 | 3300047321 | Bacteria | 1670 |
| 520 | Ga0495680_0004114 | 3300047322 | Bacteria | 13987 |
| 521 | Ga0495683_0068140 | 3300047323 | Bacteria | 1751 |
| 522 | Ga0495687_014614 | 3300047443 | Bacteria | 4030 |
| 523 | Ga0495675_0007193 | 3300047444 | Bacteria | 6853 |
| 524 | Ga0495675_0017754 | 3300047444 | Bacteria | 4511 |
| 525 | Ga0495673_0000053 | 3300047469 | Bacteria | 254433 |
| 526 | Ga0495684_0007358 | 3300047471 | Bacteria | 8533 |
| 527 | Ga0495602_0007289 | 3300048088 | Bacteria | 11579 |
| 528 | Ga0495602_0115238 | 3300048088 | Bacteria | 2174 |
| 529 | Ga0495615_0143510 | 3300048090 | Bacteria | 706 |
| 530 | Ga0496100_0018006 | 3300048903 | Bacteria | 4183 |
| 531 | Ga0496100_0105859 | 3300048903 | Bacteria | 1946 |
| 532 | Ga0496100_0252143 | 3300048903 | Bacteria | 1306 |
| 533 | Ga0496100_0322330 | 3300048903 | Bacteria | 1161 |
| 534 | Ga0496100_0346737 | 3300048903 | Bacteria | 1121 |
| 535 | Ga0496100_0503307 | 3300048903 | Bacteria | 933 |
| 536 | Ga0496100_0830206 | 3300048903 | Bacteria | 724 |
| 537 | Ga0496101_0035808 | 3300048904 | Bacteria | 3512 |
| 538 | Ga0496101_0194310 | 3300048904 | Bacteria | 1567 |
| 539 | Ga0496101_0208750 | 3300048904 | Bacteria | 1512 |
| 540 | Ga0496101_0707960 | 3300048904 | Bacteria | 795 |
| 541 | Ga0496102_0013449 | 3300048905 | Bacteria | 7089 |
| 542 | Ga0496102_0272614 | 3300048905 | Bacteria | 1595 |
| 543 | Ga0496102_0333520 | 3300048905 | Bacteria | 1428 |
| 544 | Ga0496103_0024819 | 3300048906 | Bacteria | 3618 |
| 545 | Ga0496104_0049397 | 3300048907 | Bacteria | 3967 |
| 546 | Ga0496105_0013759 | 3300048908 | Bacteria | 6424 |
| 547 | Ga0496105_0064804 | 3300048908 | Bacteria | 3015 |
| 548 | Ga0496106_0016081 | 3300048909 | Bacteria | 5533 |
| 549 | Ga0496106_0031859 | 3300048909 | Bacteria | 3929 |
| 550 | Ga0496106_0045461 | 3300048909 | Bacteria | 3298 |
| 551 | Ga0496106_0155837 | 3300048909 | Bacteria | 1803 |
| 552 | Ga0496106_0265384 | 3300048909 | Bacteria | 1374 |
| 553 | Ga0496106_0451327 | 3300048909 | Bacteria | 1033 |
| 554 | Ga0496107_0000191 | 3300048910 | Bacteria | 31847 |
| 555 | Ga0496107_0136469 | 3300048910 | Bacteria | 1812 |
| 556 | Ga0496107_0627607 | 3300048910 | Bacteria | 793 |
| 557 | Ga0496108_0171300 | 3300048911 | Bacteria | 1878 |
| 558 | Ga0496108_0185630 | 3300048911 | Bacteria | 1801 |
| 559 | Ga0496108_0385645 | 3300048911 | Bacteria | 1223 |
| 560 | Ga0496109_0074842 | 3300048912 | Bacteria | 3113 |
| 561 | Ga0496109_0135872 | 3300048912 | Bacteria | 2297 |
| 562 | Ga0496109_0161809 | 3300048912 | Bacteria | 2097 |
| 563 | Ga0496109_0484664 | 3300048912 | Bacteria | 1167 |
| 564 | Ga0496109_0552490 | 3300048912 | Bacteria | 1086 |
| 565 | Ga0496109_0844607 | 3300048912 | Bacteria | 854 |
| 566 | Ga0496110_0046154 | 3300048913 | Bacteria | 3811 |
| 567 | Ga0496110_0094730 | 3300048913 | Bacteria | 2673 |
| 568 | Ga0496110_0216332 | 3300048913 | Bacteria | 1742 |
| 569 | Ga0496110_0463909 | 3300048913 | Bacteria | 1154 |
| 570 | Ga0496110_0831339 | 3300048913 | Bacteria | 828 |
| 571 | Ga0496111_0114133 | 3300048914 | Bacteria | 1991 |
| 572 | Ga0496111_0120150 | 3300048914 | Bacteria | 1941 |
| 573 | Ga0496111_0263810 | 3300048914 | Bacteria | 1278 |
| 574 | Ga0496112_0000045 | 3300048915 | Bacteria | 85873 |
| 575 | Ga0496112_0040796 | 3300048915 | Bacteria | 4539 |
| 576 | Ga0496112_0051708 | 3300048915 | Bacteria | 4030 |
| 577 | Ga0496112_0190082 | 3300048915 | Bacteria | 2015 |
| 578 | Ga0496112_0366475 | 3300048915 | Bacteria | 1382 |
| 579 | Ga0496112_0730263 | 3300048915 | Bacteria | 917 |
| 580 | Ga0496113_0041112 | 3300048916 | Bacteria | 3409 |
| 581 | Ga0496113_0471411 | 3300048916 | Bacteria | 1009 |
| 582 | Ga0496114_0035171 | 3300048917 | Bacteria | 4136 |
| 583 | Ga0496114_0589968 | 3300048917 | Bacteria | 980 |
| 584 | Ga0496115_0106189 | 3300048918 | Bacteria | 2305 |
| 585 | Ga0496115_0730753 | 3300048918 | Bacteria | 776 |
| 586 | Ga0496117_0092093 | 3300048920 | Bacteria | 1948 |
| 587 | Ga0496118_0047165 | 3300048921 | Bacteria | 3343 |
| 588 | Ga0496118_0081442 | 3300048921 | Bacteria | 2273 |
| 589 | Ga0496118_0436887 | 3300048921 | Bacteria | 668 |
| 590 | Ga0496119_0146893 | 3300048922 | Bacteria | 1267 |
| 591 | Ga0496120_0039541 | 3300048923 | Bacteria | 2781 |
| 592 | Ga0496121_0001169 | 3300048924 | Bacteria | 46049 |
| 593 | Ga0496121_0004381 | 3300048924 | Bacteria | 19069 |
| 594 | Ga0496121_0047210 | 3300048924 | Bacteria | 3677 |
| 595 | Ga0496121_0075894 | 3300048924 | Bacteria | 2683 |
| 596 | Ga0496121_0111792 | 3300048924 | Bacteria | 2082 |
| 597 | Ga0496121_0270433 | 3300048924 | Bacteria | 1168 |
| 598 | Ga0496121_0394116 | 3300048924 | Bacteria | 909 |
| 599 | Ga0496122_0181684 | 3300048925 | Bacteria | 1254 |
| 600 | Ga0496123_0248670 | 3300048926 | Bacteria | 879 |
| 601 | Ga0496124_0238269 | 3300048927 | Bacteria | 1355 |
| 602 | Ga0496125_0082316 | 3300048928 | Bacteria | 2454 |
| 603 | Ga0496125_0085529 | 3300048928 | Bacteria | 2389 |
| 604 | Ga0496126_0005092 | 3300048929 | Bacteria | 15243 |
| 605 | Ga0496126_0025891 | 3300048929 | Bacteria | 5634 |
| 606 | Ga0496126_0071562 | 3300048929 | Bacteria | 3086 |
| 607 | Ga0496126_0119596 | 3300048929 | Bacteria | 2286 |
| 608 | Ga0496126_0122496 | 3300048929 | Bacteria | 2254 |
| 609 | Ga0496126_0159699 | 3300048929 | Bacteria | 1927 |
| 610 | Ga0496126_0205972 | 3300048929 | Bacteria | 1658 |
| 611 | Ga0496126_0226326 | 3300048929 | Bacteria | 1569 |
| 612 | Ga0496126_0333683 | 3300048929 | Bacteria | 1244 |
| 613 | Ga0496126_0475226 | 3300048929 | Bacteria | 1002 |
| 614 | Ga0495682_0147956 | 3300049460 | Bacteria | 838 |
| 615 | Ga0501047_0089734 | 3300049581 | Bacteria | 2951 |
| 616 | Ga0501070_0039101 | 3300049586 | Bacteria | 3958 |
| 617 | Ga0501074_0112947 | 3300049590 | Bacteria | 1944 |
| 618 | Ga0501076_0727512 | 3300049592 | Bacteria | 819 |
| 619 | Ga0501080_0008826 | 3300049742 | Bacteria | 9162 |
| 620 | nmdc:mga03n38_205736_c1 | 3300050490 | Bacteria | 1021 |
| 621 | nmdc:mga00v17_120973_c1 | 3300050491 | Bacteria | 1667 |
| 622 | nmdc:mga00v17_229841_c1 | 3300050491 | Bacteria | 1202 |
| 623 | nmdc:mga0yw44_201939_c1 | 3300050492 | Bacteria | 1313 |
| 624 | nmdc:mga0yw44_49041_c1 | 3300050492 | Bacteria | 2547 |
| 625 | nmdc:mga0yw44_87026_c1 | 3300050492 | Bacteria | 1969 |
| 626 | nmdc:mga0yw44_96688_c1 | 3300050492 | Bacteria | 1875 |
| 627 | nmdc:mga0yw44_98668_c1 | 3300050492 | Bacteria | 1858 |
| 628 | nmdc:mga0k408_122025_c1 | 3300050493 | Bacteria | 1544 |
| 629 | nmdc:mga0k408_236724_c1 | 3300050493 | Bacteria | 1090 |
| 630 | nmdc:mga06z11_61294_c1 | 3300050494 | Bacteria | 1962 |
| 631 | nmdc:mga04h51_38503_c1 | 3300050495 | Bacteria | 1549 |
| 632 | nmdc:mga07m45_18815_c1 | 3300050496 | Bacteria | 3736 |
| 633 | nmdc:mga0n895_12280_c1 | 3300050512 | Bacteria | 7675 |
| 634 | nmdc:mga0rr50_205675_c1 | 3300050513 | Bacteria | 1620 |
| 635 | nmdc:mga0a205_591472_c1 | 3300050515 | Bacteria | 963 |
| 636 | nmdc:mga0sz30_213032_c1 | 3300050516 | Bacteria | 858 |
| 637 | Ga0495601_0095059 | 3300053077 | Bacteria | 1921 |
| 638 | Ga0495601_0162070 | 3300053077 | Bacteria | 1462 |
| 639 | Ga0495601_0225166 | 3300053077 | Bacteria | 1225 |
| 640 | Ga0495595_0000665 | 3300053084 | Bacteria | 13109 |
| 641 | Ga0495595_0193074 | 3300053084 | Bacteria | 1012 |
| 642 | Ga0495619_0007310 | 3300053085 | Bacteria | 6995 |
| 643 | Ga0500578_0400449 | 3300053086 | Bacteria | 791 |
| 644 | Ga0500643_000047 | 3300053087 | Bacteria | 148938 |
| 645 | Ga0500583_0083581 | 3300053092 | Bacteria | 1545 |
| 646 | Ga0500566_0000003 | 3300053094 | Bacteria | 166820 |
| 647 | Ga0500566_0002730 | 3300053094 | Bacteria | 10521 |
| 648 | Ga0500566_0160147 | 3300053094 | Bacteria | 1174 |
| 649 | Ga0500641_0144200 | 3300053096 | Bacteria | 1029 |
| 650 | Ga0500555_002126 | 3300053103 | Bacteria | 5793 |
| 651 | Ga0500556_0043709 | 3300053104 | Bacteria | 1591 |
| 652 | Ga0500557_000115 | 3300053105 | Bacteria | 22643 |
| 653 | Ga0500569_149115 | 3300053109 | Bacteria | 788 |
| 654 | Ga0500572_000637 | 3300053111 | Bacteria | 11626 |
| 655 | Ga0500594_0021143 | 3300053118 | Bacteria | 1629 |
| 656 | Ga0500595_077137 | 3300053119 | Bacteria | 980 |
| 657 | Ga0500607_062780 | 3300053121 | Bacteria | 1940 |
| 658 | Ga0500614_034579 | 3300053123 | Bacteria | 1254 |
| 659 | Ga0500642_0000141 | 3300053130 | Bacteria | 32052 |
| 660 | Ga0500642_0009034 | 3300053130 | Bacteria | 3440 |
| 661 | Ga0500658_0191254 | 3300053134 | Bacteria | 934 |
| 662 | Ga0500559_0000226 | 3300053136 | Bacteria | 45182 |
| 663 | Ga0500559_0007137 | 3300053136 | Bacteria | 4979 |
| 664 | Ga0500559_0007393 | 3300053136 | Bacteria | 4871 |
| 665 | Ga0500568_0014324 | 3300053139 | Bacteria | 3584 |
| 666 | Ga0500577_0001229 | 3300053142 | Bacteria | 6556 |
| 667 | Ga0500577_0139241 | 3300053142 | Bacteria | 1022 |
| 668 | Ga0500622_0018031 | 3300053156 | Bacteria | 3753 |
| 669 | Ga0500627_0011669 | 3300053158 | Bacteria | 3259 |
| 670 | Ga0500639_118688 | 3300053163 | Bacteria | 1274 |
| 671 | Ga0500636_0000024 | 3300053177 | Bacteria | 86744 |
| 672 | Ga0500636_0007534 | 3300053177 | Bacteria | 6295 |
| 673 | Ga0500637_0202640 | 3300053178 | Bacteria | 1129 |
| 674 | Ga0500637_0284887 | 3300053178 | Bacteria | 908 |
| 675 | Ga0500645_005912 | 3300053730 | Bacteria | 4434 |
| 676 | Ga0500596_000691 | 3300053735 | Bacteria | 6570 |
| 677 | Ga0500599_007639 | 3300053736 | Bacteria | 1395 |
| 678 | Ga0500601_000728 | 3300053737 | Bacteria | 4321 |
| 679 | Ga0500601_008085 | 3300053737 | Bacteria | 1168 |
| 680 | Ga0466962_0183960 | 3300061719 | Bacteria | 1019 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0089734 | Ga0501047_0089734_1662_2243 | 182 |
| 2 | 3300049586 | Ga0501070_0039101 | Ga0501070_0039101_148_729 | 182 |
| 3 | 3300049590 | Ga0501074_0112947 | Ga0501074_0112947_405_986 | 182 |
| 4 | 3300049742 | Ga0501080_0008826 | Ga0501080_0008826_4378_4959 | 182 |
| 5 | 3300046529 | Ga0495652_0539986 | Ga0495652_0539986_199_780 | 183 |
| 6 | iso_pu_bacteria | 2513237092 | 2513628722 | 188 |
| 7 | iso_pu_bacteria | 2513237139 | 2513876644 | 188 |
| 8 | iso_pu_bacteria | 2617270735 | 2617350333 | 188 |
| 9 | iso_pu_bacteria | 2791355196 | 2793061251 | 188 |
| 10 | iso_pu_bacteria | 2802429603 | 2805918624 | 188 |
| 11 | iso_pu_bacteria | 2824696289 | 2824703093 | 188 |
| 12 | iso_pu_bacteria | 2824773399 | 2824779666 | 188 |
| 13 | iso_pu_bacteria | 2841941048 | 2841947375 | 188 |
| 14 | iso_pu_bacteria | 2841974524 | 2841981009 | 188 |
| 15 | iso_pu_bacteria | 2847939898 | 2847948149 | 188 |
| 16 | iso_pu_bacteria | 2849076700 | 2849077940 | 188 |
| 17 | iso_pu_bacteria | 2874612657 | 2874618515 | 188 |
| 18 | iso_pu_bacteria | 2874628541 | 2874632935 | 188 |
| 19 | iso_pu_bacteria | 2879110137 | 2879110801 | 188 |
| 20 | iso_pu_bacteria | 2904541872 | 2904546716 | 189 |
| 21 | iso_pu_bacteria | 2929160207 | 2929166165 | 189 |
| 22 | 3300001979 | JGI24740J21852_10083413 | JGI24740J21852_100834131 | 192 |
| 23 | 3300001990 | JGI24737J22298_10075821 | JGI24737J22298_100758211 | 192 |
| 24 | 3300002075 | JGI24738J21930_10075007 | JGI24738J21930_100750071 | 192 |
| 25 | 3300003215 | JGI25153J46596_10002018 | JGI25153J46596_100020185 | 192 |
| 26 | 3300003215 | JGI25153J46596_10010038 | JGI25153J46596_100100384 | 192 |
| 27 | 3300003659 | JGI25404J52841_10009670 | JGI25404J52841_100096704 | 192 |
| 28 | 3300003659 | JGI25404J52841_10058593 | JGI25404J52841_100585931 | 192 |
| 29 | 3300003752 | Ga0055539_1011873 | Ga0055539_10118732 | 192 |
| 30 | 3300003771 | Ga0055526_1047477 | Ga0055526_10474771 | 192 |
| 31 | 3300003794 | Ga0055531_10004117 | Ga0055531_100041173 | 192 |
| 32 | 3300003911 | JGI25405J52794_10060247 | JGI25405J52794_100602471 | 192 |
| 33 | 3300005262 | Ga0065165_1002741 | Ga0065165_10027414 | 192 |
| 34 | 3300005262 | Ga0065165_1004574 | Ga0065165_10045747 | 192 |
| 35 | 3300005262 | Ga0065165_1011498 | Ga0065165_10114981 | 192 |
| 36 | 3300005328 | Ga0070676_10775333 | Ga0070676_107753331 | 192 |
| 37 | 3300005329 | Ga0070683_100066232 | Ga0070683_1000662323 | 192 |
| 38 | 3300005331 | Ga0070670_100087921 | Ga0070670_1000879212 | 192 |
| 39 | 3300005331 | Ga0070670_100571223 | Ga0070670_1005712231 | 192 |
| 40 | 3300005334 | Ga0068869_101015382 | Ga0068869_1010153821 | 192 |
| 41 | 3300005335 | Ga0070666_10380804 | Ga0070666_103808041 | 192 |
| 42 | 3300005335 | Ga0070666_10618792 | Ga0070666_106187921 | 192 |
| 43 | 3300005341 | Ga0070691_10269331 | Ga0070691_102693311 | 192 |
| 44 | 3300005347 | Ga0070668_100167673 | Ga0070668_1001676731 | 192 |
| 45 | 3300005347 | Ga0070668_100805696 | Ga0070668_1008056962 | 192 |
| 46 | 3300005364 | Ga0070673_101533867 | Ga0070673_1015338671 | 192 |
| 47 | 3300005366 | Ga0070659_100122307 | Ga0070659_1001223072 | 192 |
| 48 | 3300005367 | Ga0070667_100217226 | Ga0070667_1002172262 | 192 |
| 49 | 3300005367 | Ga0070667_100768056 | Ga0070667_1007680561 | 192 |
| 50 | 3300005434 | Ga0070709_10028973 | Ga0070709_100289733 | 192 |
| 51 | 3300005434 | Ga0070709_10132862 | Ga0070709_101328622 | 192 |
| 52 | 3300005434 | Ga0070709_10320911 | Ga0070709_103209111 | 192 |
| 53 | 3300005435 | Ga0070714_100008712 | Ga0070714_1000087123 | 192 |
| 54 | 3300005435 | Ga0070714_100211969 | Ga0070714_1002119691 | 192 |
| 55 | 3300005435 | Ga0070714_100308489 | Ga0070714_1003084891 | 192 |
| 56 | 3300005435 | Ga0070714_100355431 | Ga0070714_1003554312 | 192 |
| 57 | 3300005436 | Ga0070713_100001936 | Ga0070713_10000193615 | 192 |
| 58 | 3300005436 | Ga0070713_100007442 | Ga0070713_1000074429 | 192 |
| 59 | 3300005437 | Ga0070710_10000534 | Ga0070710_100005349 | 192 |
| 60 | 3300005437 | Ga0070710_10006878 | Ga0070710_100068784 | 192 |
| 61 | 3300005438 | Ga0070701_10379997 | Ga0070701_103799971 | 192 |
| 62 | 3300005439 | Ga0070711_100000548 | Ga0070711_10000054813 | 192 |
| 63 | 3300005439 | Ga0070711_100004958 | Ga0070711_1000049589 | 192 |
| 64 | 3300005439 | Ga0070711_100010548 | Ga0070711_1000105487 | 192 |
| 65 | 3300005439 | Ga0070711_100373276 | Ga0070711_1003732762 | 192 |
| 66 | 3300005455 | Ga0070663_100087429 | Ga0070663_1000874293 | 192 |
| 67 | 3300005455 | Ga0070663_100165706 | Ga0070663_1001657063 | 192 |
| 68 | 3300005455 | Ga0070663_100995476 | Ga0070663_1009954761 | 192 |
| 69 | 3300005456 | Ga0070678_100853981 | Ga0070678_1008539811 | 192 |
| 70 | 3300005456 | Ga0070678_100985890 | Ga0070678_1009858901 | 192 |
| 71 | 3300005458 | Ga0070681_10335052 | Ga0070681_103350522 | 192 |
| 72 | 3300005466 | Ga0070685_10073379 | Ga0070685_100733793 | 192 |
| 73 | 3300005467 | Ga0070706_100268703 | Ga0070706_1002687032 | 192 |
| 74 | 3300005471 | Ga0070698_100062802 | Ga0070698_1000628023 | 192 |
| 75 | 3300005530 | Ga0070679_100114126 | Ga0070679_1001141262 | 192 |
| 76 | 3300005535 | Ga0070684_100020644 | Ga0070684_1000206445 | 192 |
| 77 | 3300005535 | Ga0070684_100416881 | Ga0070684_1004168811 | 192 |
| 78 | 3300005539 | Ga0068853_100022057 | Ga0068853_1000220572 | 192 |
| 79 | 3300005539 | Ga0068853_100093892 | Ga0068853_1000938923 | 192 |
| 80 | 3300005539 | Ga0068853_100688287 | Ga0068853_1006882872 | 192 |
| 81 | 3300005547 | Ga0070693_100085329 | Ga0070693_1000853291 | 192 |
| 82 | 3300005547 | Ga0070693_100089030 | Ga0070693_1000890301 | 192 |
| 83 | 3300005548 | Ga0070665_100059266 | Ga0070665_1000592664 | 192 |
| 84 | 3300005548 | Ga0070665_100212350 | Ga0070665_1002123501 | 192 |
| 85 | 3300005548 | Ga0070665_100256214 | Ga0070665_1002562143 | 192 |
| 86 | 3300005563 | Ga0068855_100257859 | Ga0068855_1002578592 | 192 |
| 87 | 3300005563 | Ga0068855_100283236 | Ga0068855_1002832363 | 192 |
| 88 | 3300005563 | Ga0068855_100411793 | Ga0068855_1004117932 | 192 |
| 89 | 3300005563 | Ga0068855_100719613 | Ga0068855_1007196132 | 192 |
| 90 | 3300005577 | Ga0068857_100002410 | Ga0068857_10000241016 | 192 |
| 91 | 3300005577 | Ga0068857_100594282 | Ga0068857_1005942821 | 192 |
| 92 | 3300005578 | Ga0068854_100842681 | Ga0068854_1008426812 | 192 |
| 93 | 3300005614 | Ga0068856_100039675 | Ga0068856_1000396755 | 192 |
| 94 | 3300005614 | Ga0068856_100193562 | Ga0068856_1001935623 | 192 |
| 95 | 3300005614 | Ga0068856_100510864 | Ga0068856_1005108641 | 192 |
| 96 | 3300005616 | Ga0068852_100091790 | Ga0068852_1000917903 | 192 |
| 97 | 3300005616 | Ga0068852_100182297 | Ga0068852_1001822972 | 192 |
| 98 | 3300005616 | Ga0068852_100749211 | Ga0068852_1007492112 | 192 |
| 99 | 3300005617 | Ga0068859_100236483 | Ga0068859_1002364833 | 192 |
| 100 | 3300005617 | Ga0068859_100914702 | Ga0068859_1009147021 | 192 |
| 101 | 3300005618 | Ga0068864_100965907 | Ga0068864_1009659072 | 192 |
| 102 | 3300005718 | Ga0068866_10349597 | Ga0068866_103495972 | 192 |
| 103 | 3300005718 | Ga0068866_10437937 | Ga0068866_104379372 | 192 |
| 104 | 3300005719 | Ga0068861_100652057 | Ga0068861_1006520571 | 192 |
| 105 | 3300005834 | Ga0068851_10010327 | Ga0068851_100103273 | 192 |
| 106 | 3300005842 | Ga0068858_100159709 | Ga0068858_1001597092 | 192 |
| 107 | 3300005844 | Ga0068862_100252953 | Ga0068862_1002529533 | 192 |
| 108 | 3300005937 | Ga0081455_10052485 | Ga0081455_100524852 | 192 |
| 109 | 3300005937 | Ga0081455_10129342 | Ga0081455_101293423 | 192 |
| 110 | 3300005937 | Ga0081455_10187701 | Ga0081455_101877013 | 192 |
| 111 | 3300005983 | Ga0081540_1014987 | Ga0081540_10149874 | 192 |
| 112 | 3300005983 | Ga0081540_1028617 | Ga0081540_10286173 | 192 |
| 113 | 3300005983 | Ga0081540_1033365 | Ga0081540_10333652 | 192 |
| 114 | 3300005983 | Ga0081540_1055731 | Ga0081540_10557312 | 192 |
| 115 | 3300005983 | Ga0081540_1067861 | Ga0081540_10678611 | 192 |
| 116 | 3300005983 | Ga0081540_1092780 | Ga0081540_10927802 | 192 |
| 117 | 3300005983 | Ga0081540_1097432 | Ga0081540_10974322 | 192 |
| 118 | 3300005985 | Ga0081539_10000199 | Ga0081539_1000019912 | 192 |
| 119 | 3300005985 | Ga0081539_10099672 | Ga0081539_100996723 | 192 |
| 120 | 3300006028 | Ga0070717_10021101 | Ga0070717_100211014 | 192 |
| 121 | 3300006028 | Ga0070717_10734932 | Ga0070717_107349321 | 192 |
| 122 | 3300006038 | Ga0075365_10038932 | Ga0075365_100389323 | 192 |
| 123 | 3300006038 | Ga0075365_10049468 | Ga0075365_100494683 | 192 |
| 124 | 3300006038 | Ga0075365_10082686 | Ga0075365_100826863 | 192 |
| 125 | 3300006038 | Ga0075365_10131245 | Ga0075365_101312452 | 192 |
| 126 | 3300006042 | Ga0075368_10279302 | Ga0075368_102793022 | 192 |
| 127 | 3300006048 | Ga0075363_100505841 | Ga0075363_1005058411 | 192 |
| 128 | 3300006051 | Ga0075364_10020313 | Ga0075364_100203133 | 192 |
| 129 | 3300006051 | Ga0075364_10171814 | Ga0075364_101718142 | 192 |
| 130 | 3300006163 | Ga0070715_10294135 | Ga0070715_102941352 | 192 |
| 131 | 3300006163 | Ga0070715_10387327 | Ga0070715_103873272 | 192 |
| 132 | 3300006173 | Ga0070716_100001291 | Ga0070716_10000129112 | 192 |
| 133 | 3300006173 | Ga0070716_100174356 | Ga0070716_1001743563 | 192 |
| 134 | 3300006175 | Ga0070712_100015913 | Ga0070712_1000159135 | 192 |
| 135 | 3300006175 | Ga0070712_100077833 | Ga0070712_1000778333 | 192 |
| 136 | 3300006178 | Ga0075367_10171018 | Ga0075367_101710182 | 192 |
| 137 | 3300006178 | Ga0075367_10227638 | Ga0075367_102276381 | 192 |
| 138 | 3300006178 | Ga0075367_10351282 | Ga0075367_103512821 | 192 |
| 139 | 3300006186 | Ga0075369_10024501 | Ga0075369_100245012 | 192 |
| 140 | 3300006195 | Ga0075366_10025166 | Ga0075366_100251663 | 192 |
| 141 | 3300006237 | Ga0097621_100313277 | Ga0097621_1003132773 | 192 |
| 142 | 3300006237 | Ga0097621_100414142 | Ga0097621_1004141422 | 192 |
| 143 | 3300006353 | Ga0075370_10032447 | Ga0075370_100324474 | 192 |
| 144 | 3300006358 | Ga0068871_100841374 | Ga0068871_1008413742 | 192 |
| 145 | 3300006931 | Ga0097620_100236487 | Ga0097620_1002364872 | 192 |
| 146 | 3300006931 | Ga0097620_100914748 | Ga0097620_1009147481 | 192 |
| 147 | 3300006942 | Ga0099824_1020733 | Ga0099824_10207333 | 192 |
| 148 | 3300006943 | Ga0099822_1004972 | Ga0099822_100497215 | 192 |
| 149 | 3300006944 | Ga0099823_1037283 | Ga0099823_10372831 | 192 |
| 150 | 3300007076 | Ga0075435_100174549 | Ga0075435_1001745492 | 192 |
| 151 | 3300009093 | Ga0105240_10007546 | Ga0105240_100075462 | 192 |
| 152 | 3300009093 | Ga0105240_10226503 | Ga0105240_102265033 | 192 |
| 153 | 3300009093 | Ga0105240_10229058 | Ga0105240_102290582 | 192 |
| 154 | 3300009093 | Ga0105240_11075005 | Ga0105240_110750051 | 192 |
| 155 | 3300009098 | Ga0105245_10040560 | Ga0105245_100405604 | 192 |
| 156 | 3300009101 | Ga0105247_10039497 | Ga0105247_100394975 | 192 |
| 157 | 3300009101 | Ga0105247_10175840 | Ga0105247_101758401 | 192 |
| 158 | 3300009101 | Ga0105247_10686631 | Ga0105247_106866311 | 192 |
| 159 | 3300009148 | Ga0105243_10782028 | Ga0105243_107820281 | 192 |
| 160 | 3300009174 | Ga0105241_10038457 | Ga0105241_100384573 | 192 |
| 161 | 3300009174 | Ga0105241_10247964 | Ga0105241_102479641 | 192 |
| 162 | 3300009176 | Ga0105242_10180231 | Ga0105242_101802313 | 192 |
| 163 | 3300009176 | Ga0105242_10385372 | Ga0105242_103853722 | 192 |
| 164 | 3300009176 | Ga0105242_10786369 | Ga0105242_107863692 | 192 |
| 165 | 3300009177 | Ga0105248_10077058 | Ga0105248_100770582 | 192 |
| 166 | 3300009177 | Ga0105248_10238254 | Ga0105248_102382543 | 192 |
| 167 | 3300009177 | Ga0105248_10730725 | Ga0105248_107307251 | 192 |
| 168 | 3300009177 | Ga0105248_11426698 | Ga0105248_114266981 | 192 |
| 169 | 3300009545 | Ga0105237_10024884 | Ga0105237_100248842 | 192 |
| 170 | 3300009545 | Ga0105237_10044111 | Ga0105237_100441115 | 192 |
| 171 | 3300009545 | Ga0105237_10395855 | Ga0105237_103958552 | 192 |
| 172 | 3300009551 | Ga0105238_10191548 | Ga0105238_101915483 | 192 |
| 173 | 3300009551 | Ga0105238_10328745 | Ga0105238_103287453 | 192 |
| 174 | 3300009551 | Ga0105238_10426726 | Ga0105238_104267262 | 192 |
| 175 | 3300009553 | Ga0105249_10501156 | Ga0105249_105011562 | 192 |
| 176 | 3300009553 | Ga0105249_10751478 | Ga0105249_107514781 | 192 |
| 177 | 3300009553 | Ga0105249_11335731 | Ga0105249_113357311 | 192 |
| 178 | 3300010375 | Ga0105239_10018405 | Ga0105239_100184056 | 192 |
| 179 | 3300010375 | Ga0105239_10107233 | Ga0105239_101072334 | 192 |
| 180 | 3300010375 | Ga0105239_10267222 | Ga0105239_102672222 | 192 |
| 181 | 3300010375 | Ga0105239_10357028 | Ga0105239_103570282 | 192 |
| 182 | 3300010375 | Ga0105239_10806704 | Ga0105239_108067042 | 192 |
| 183 | 3300010375 | Ga0105239_12282700 | Ga0105239_122827001 | 192 |
| 184 | 3300011119 | Ga0105246_10581535 | Ga0105246_105815351 | 192 |
| 185 | 3300011119 | Ga0105246_10833270 | Ga0105246_108332701 | 192 |
| 186 | 3300011119 | Ga0105246_11115419 | Ga0105246_111154191 | 192 |
| 187 | 3300013104 | Ga0157370_10216002 | Ga0157370_102160022 | 192 |
| 188 | 3300013104 | Ga0157370_11203863 | Ga0157370_112038631 | 192 |
| 189 | 3300013105 | Ga0157369_10000685 | Ga0157369_1000068513 | 192 |
| 190 | 3300013105 | Ga0157369_10028615 | Ga0157369_100286156 | 192 |
| 191 | 3300013105 | Ga0157369_10193359 | Ga0157369_101933593 | 192 |
| 192 | 3300013296 | Ga0157374_10533491 | Ga0157374_105334912 | 192 |
| 193 | 3300013296 | Ga0157374_11080953 | Ga0157374_110809531 | 192 |
| 194 | 3300013297 | Ga0157378_10950192 | Ga0157378_109501921 | 192 |
| 195 | 3300013306 | Ga0163162_10784041 | Ga0163162_107840412 | 192 |
| 196 | 3300013307 | Ga0157372_10173650 | Ga0157372_101736503 | 192 |
| 197 | 3300013308 | Ga0157375_10243659 | Ga0157375_102436591 | 192 |
| 198 | 3300013308 | Ga0157375_11905208 | Ga0157375_119052081 | 192 |
| 199 | 3300014325 | Ga0163163_10138239 | Ga0163163_101382393 | 192 |
| 200 | 3300014325 | Ga0163163_10182217 | Ga0163163_101822173 | 192 |
| 201 | 3300014325 | Ga0163163_10458015 | Ga0163163_104580152 | 192 |
| 202 | 3300014968 | Ga0157379_10363880 | Ga0157379_103638802 | 192 |
| 203 | 3300014968 | Ga0157379_10861408 | Ga0157379_108614082 | 192 |
| 204 | 3300014969 | Ga0157376_10458093 | Ga0157376_104580932 | 192 |
| 205 | 3300014969 | Ga0157376_10468998 | Ga0157376_104689982 | 192 |
| 206 | 3300017792 | Ga0163161_10159918 | Ga0163161_101599182 | 192 |
| 207 | 3300021377 | Ga0213874_10022465 | Ga0213874_100224651 | 192 |
| 208 | 3300021384 | Ga0213876_10015743 | Ga0213876_100157432 | 192 |
| 209 | 3300021384 | Ga0213876_10030169 | Ga0213876_100301693 | 192 |
| 210 | 3300025230 | Ga0209563_106240 | Ga0209563_1062402 | 192 |
| 211 | 3300025245 | Ga0207425_1005559 | Ga0207425_10055592 | 192 |
| 212 | 3300025250 | Ga0209026_1022966 | Ga0209026_10229661 | 192 |
| 213 | 3300025253 | Ga0209677_101482 | Ga0209677_1014822 | 192 |
| 214 | 3300025261 | Ga0209233_1001759 | Ga0209233_10017597 | 192 |
| 215 | 3300025261 | Ga0209233_1005057 | Ga0209233_10050574 | 192 |
| 216 | 3300025261 | Ga0209233_1029636 | Ga0209233_10296362 | 192 |
| 217 | 3300025272 | Ga0209455_1003430 | Ga0209455_10034303 | 192 |
| 218 | 3300025272 | Ga0209455_1005204 | Ga0209455_10052042 | 192 |
| 219 | 3300025295 | Ga0209564_1001733 | Ga0209564_10017332 | 192 |
| 220 | 3300025295 | Ga0209564_1019308 | Ga0209564_10193082 | 192 |
| 221 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011750 | 192 |
| 222 | 3300025297 | Ga0209758_1000320 | Ga0209758_100032066 | 192 |
| 223 | 3300025297 | Ga0209758_1004056 | Ga0209758_10040565 | 192 |
| 224 | 3300025297 | Ga0209758_1011540 | Ga0209758_10115404 | 192 |
| 225 | 3300025297 | Ga0209758_1031721 | Ga0209758_10317213 | 192 |
| 226 | 3300025297 | Ga0209758_1065514 | Ga0209758_10655142 | 192 |
| 227 | 3300025299 | Ga0209256_1002277 | Ga0209256_10022774 | 192 |
| 228 | 3300025299 | Ga0209256_1035689 | Ga0209256_10356892 | 192 |
| 229 | 3300025302 | Ga0207426_1000902 | Ga0207426_10009021 | 192 |
| 230 | 3300025302 | Ga0207426_1001214 | Ga0207426_100121413 | 192 |
| 231 | 3300025302 | Ga0207426_1002913 | Ga0207426_100291310 | 192 |
| 232 | 3300025302 | Ga0207426_1006457 | Ga0207426_10064573 | 192 |
| 233 | 3300025302 | Ga0207426_1085627 | Ga0207426_10856271 | 192 |
| 234 | 3300025304 | Ga0209257_1000811 | Ga0209257_100081122 | 192 |
| 235 | 3300025315 | Ga0207697_10023886 | Ga0207697_100238862 | 192 |
| 236 | 3300025321 | Ga0207656_10002937 | Ga0207656_100029371 | 192 |
| 237 | 3300025321 | Ga0207656_10162835 | Ga0207656_101628351 | 192 |
| 238 | 3300025321 | Ga0207656_10380169 | Ga0207656_103801691 | 192 |
| 239 | 3300025898 | Ga0207692_10000091 | Ga0207692_100000919 | 192 |
| 240 | 3300025898 | Ga0207692_10012992 | Ga0207692_100129921 | 192 |
| 241 | 3300025898 | Ga0207692_10019595 | Ga0207692_100195951 | 192 |
| 242 | 3300025898 | Ga0207692_10124431 | Ga0207692_101244311 | 192 |
| 243 | 3300025899 | Ga0207642_10160008 | Ga0207642_101600082 | 192 |
| 244 | 3300025900 | Ga0207710_10313104 | Ga0207710_103131041 | 192 |
| 245 | 3300025901 | Ga0207688_10095556 | Ga0207688_100955563 | 192 |
| 246 | 3300025901 | Ga0207688_10141403 | Ga0207688_101414032 | 192 |
| 247 | 3300025903 | Ga0207680_10085326 | Ga0207680_100853261 | 192 |
| 248 | 3300025904 | Ga0207647_10056880 | Ga0207647_100568801 | 192 |
| 249 | 3300025905 | Ga0207685_10244013 | Ga0207685_102440131 | 192 |
| 250 | 3300025906 | Ga0207699_10000782 | Ga0207699_100007827 | 192 |
| 251 | 3300025906 | Ga0207699_10116843 | Ga0207699_101168432 | 192 |
| 252 | 3300025906 | Ga0207699_10192054 | Ga0207699_101920542 | 192 |
| 253 | 3300025907 | Ga0207645_10169074 | Ga0207645_101690741 | 192 |
| 254 | 3300025909 | Ga0207705_10117076 | Ga0207705_101170761 | 192 |
| 255 | 3300025910 | Ga0207684_10058685 | Ga0207684_100586854 | 192 |
| 256 | 3300025910 | Ga0207684_10185624 | Ga0207684_101856242 | 192 |
| 257 | 3300025911 | Ga0207654_10012455 | Ga0207654_100124553 | 192 |
| 258 | 3300025911 | Ga0207654_10048338 | Ga0207654_100483383 | 192 |
| 259 | 3300025912 | Ga0207707_10000126 | Ga0207707_100001267 | 192 |
| 260 | 3300025913 | Ga0207695_10000503 | Ga0207695_100005035 | 192 |
| 261 | 3300025913 | Ga0207695_10080555 | Ga0207695_100805554 | 192 |
| 262 | 3300025914 | Ga0207671_10001399 | Ga0207671_1000139921 | 192 |
| 263 | 3300025914 | Ga0207671_10039182 | Ga0207671_100391823 | 192 |
| 264 | 3300025914 | Ga0207671_10143653 | Ga0207671_101436532 | 192 |
| 265 | 3300025914 | Ga0207671_10146601 | Ga0207671_101466012 | 192 |
| 266 | 3300025914 | Ga0207671_10388212 | Ga0207671_103882121 | 192 |
| 267 | 3300025914 | Ga0207671_10864746 | Ga0207671_108647461 | 192 |
| 268 | 3300025915 | Ga0207693_10008718 | Ga0207693_100087185 | 192 |
| 269 | 3300025915 | Ga0207693_10044833 | Ga0207693_100448333 | 192 |
| 270 | 3300025915 | Ga0207693_10049980 | Ga0207693_100499803 | 192 |
| 271 | 3300025915 | Ga0207693_10124219 | Ga0207693_101242192 | 192 |
| 272 | 3300025916 | Ga0207663_10013987 | Ga0207663_100139873 | 192 |
| 273 | 3300025916 | Ga0207663_10014963 | Ga0207663_100149635 | 192 |
| 274 | 3300025916 | Ga0207663_10105709 | Ga0207663_101057093 | 192 |
| 275 | 3300025916 | Ga0207663_10179624 | Ga0207663_101796243 | 192 |
| 276 | 3300025921 | Ga0207652_10042877 | Ga0207652_100428777 | 192 |
| 277 | 3300025921 | Ga0207652_10081529 | Ga0207652_100815292 | 192 |
| 278 | 3300025924 | Ga0207694_10040624 | Ga0207694_100406244 | 192 |
| 279 | 3300025924 | Ga0207694_10281796 | Ga0207694_102817962 | 192 |
| 280 | 3300025925 | Ga0207650_10659163 | Ga0207650_106591632 | 192 |
| 281 | 3300025927 | Ga0207687_10021597 | Ga0207687_100215972 | 192 |
| 282 | 3300025928 | Ga0207700_10001432 | Ga0207700_1000143215 | 192 |
| 283 | 3300025928 | Ga0207700_10015439 | Ga0207700_100154395 | 192 |
| 284 | 3300025928 | Ga0207700_10090054 | Ga0207700_100900543 | 192 |
| 285 | 3300025929 | Ga0207664_10027757 | Ga0207664_100277572 | 192 |
| 286 | 3300025929 | Ga0207664_10087881 | Ga0207664_100878813 | 192 |
| 287 | 3300025929 | Ga0207664_10124175 | Ga0207664_101241753 | 192 |
| 288 | 3300025929 | Ga0207664_10591993 | Ga0207664_105919931 | 192 |
| 289 | 3300025932 | Ga0207690_10213535 | Ga0207690_102135351 | 192 |
| 290 | 3300025934 | Ga0207686_10050913 | Ga0207686_100509131 | 192 |
| 291 | 3300025934 | Ga0207686_10084586 | Ga0207686_100845862 | 192 |
| 292 | 3300025934 | Ga0207686_10169374 | Ga0207686_101693741 | 192 |
| 293 | 3300025934 | Ga0207686_10396847 | Ga0207686_103968472 | 192 |
| 294 | 3300025935 | Ga0207709_10586103 | Ga0207709_105861031 | 192 |
| 295 | 3300025936 | Ga0207670_10104254 | Ga0207670_101042542 | 192 |
| 296 | 3300025937 | Ga0207669_10377349 | Ga0207669_103773491 | 192 |
| 297 | 3300025937 | Ga0207669_10794847 | Ga0207669_107948471 | 192 |
| 298 | 3300025939 | Ga0207665_10006928 | Ga0207665_100069286 | 192 |
| 299 | 3300025939 | Ga0207665_10087703 | Ga0207665_100877032 | 192 |
| 300 | 3300025941 | Ga0207711_10112304 | Ga0207711_101123042 | 192 |
| 301 | 3300025941 | Ga0207711_10428263 | Ga0207711_104282632 | 192 |
| 302 | 3300025941 | Ga0207711_10494103 | Ga0207711_104941032 | 192 |
| 303 | 3300025942 | Ga0207689_10419368 | Ga0207689_104193681 | 192 |
| 304 | 3300025942 | Ga0207689_10668738 | Ga0207689_106687382 | 192 |
| 305 | 3300025945 | Ga0207679_10526957 | Ga0207679_105269572 | 192 |
| 306 | 3300025949 | Ga0207667_10007456 | Ga0207667_1000745615 | 192 |
| 307 | 3300025949 | Ga0207667_10129822 | Ga0207667_101298223 | 192 |
| 308 | 3300025949 | Ga0207667_10404371 | Ga0207667_104043712 | 192 |
| 309 | 3300025949 | Ga0207667_10693322 | Ga0207667_106933221 | 192 |
| 310 | 3300025972 | Ga0207668_10351624 | Ga0207668_103516241 | 192 |
| 311 | 3300025972 | Ga0207668_11018720 | Ga0207668_110187201 | 192 |
| 312 | 3300025981 | Ga0207640_10094034 | Ga0207640_100940341 | 192 |
| 313 | 3300025986 | Ga0207658_10032042 | Ga0207658_100320421 | 192 |
| 314 | 3300025986 | Ga0207658_10108732 | Ga0207658_101087323 | 192 |
| 315 | 3300025986 | Ga0207658_10404845 | Ga0207658_104048451 | 192 |
| 316 | 3300026035 | Ga0207703_10066172 | Ga0207703_100661725 | 192 |
| 317 | 3300026041 | Ga0207639_10352059 | Ga0207639_103520592 | 192 |
| 318 | 3300026041 | Ga0207639_10430425 | Ga0207639_104304251 | 192 |
| 319 | 3300026067 | Ga0207678_10083040 | Ga0207678_100830403 | 192 |
| 320 | 3300026067 | Ga0207678_10092881 | Ga0207678_100928813 | 192 |
| 321 | 3300026067 | Ga0207678_10166393 | Ga0207678_101663933 | 192 |
| 322 | 3300026078 | Ga0207702_10029716 | Ga0207702_100297163 | 192 |
| 323 | 3300026078 | Ga0207702_10345124 | Ga0207702_103451242 | 192 |
| 324 | 3300026089 | Ga0207648_10266867 | Ga0207648_102668673 | 192 |
| 325 | 3300026095 | Ga0207676_10304702 | Ga0207676_103047022 | 192 |
| 326 | 3300026095 | Ga0207676_11436312 | Ga0207676_114363121 | 192 |
| 327 | 3300026116 | Ga0207674_10008743 | Ga0207674_100087435 | 192 |
| 328 | 3300026116 | Ga0207674_10185558 | Ga0207674_101855582 | 192 |
| 329 | 3300026116 | Ga0207674_10480690 | Ga0207674_104806902 | 192 |
| 330 | 3300026116 | Ga0207674_11183430 | Ga0207674_111834301 | 192 |
| 331 | 3300026118 | Ga0207675_100242820 | Ga0207675_1002428203 | 192 |
| 332 | 3300026118 | Ga0207675_100621785 | Ga0207675_1006217852 | 192 |
| 333 | 3300026121 | Ga0207683_10116740 | Ga0207683_101167403 | 192 |
| 334 | 3300026121 | Ga0207683_10860030 | Ga0207683_108600302 | 192 |
| 335 | 3300026142 | Ga0207698_10011877 | Ga0207698_100118778 | 192 |
| 336 | 3300026142 | Ga0207698_10235696 | Ga0207698_102356962 | 192 |
| 337 | 3300026142 | Ga0207698_10610127 | Ga0207698_106101272 | 192 |
| 338 | 3300026142 | Ga0207698_11551253 | Ga0207698_115512531 | 192 |
| 339 | 3300026142 | Ga0207698_11746783 | Ga0207698_117467831 | 192 |
| 340 | 3300027296 | Ga0209389_1000009 | Ga0209389_1000009155 | 192 |
| 341 | 3300027357 | Ga0209589_1000007 | Ga0209589_100000793 | 192 |
| 342 | 3300027361 | Ga0209489_100008 | Ga0209489_10000893 | 192 |
| 343 | 3300027361 | Ga0209489_100671 | Ga0209489_10067125 | 192 |
| 344 | 3300027363 | Ga0209700_100009 | Ga0209700_10000993 | 192 |
| 345 | 3300027363 | Ga0209700_100016 | Ga0209700_10001679 | 192 |
| 346 | 3300028379 | Ga0268266_10014260 | Ga0268266_100142604 | 192 |
| 347 | 3300028379 | Ga0268266_10044273 | Ga0268266_100442733 | 192 |
| 348 | 3300028379 | Ga0268266_11428724 | Ga0268266_114287241 | 192 |
| 349 | 3300028380 | Ga0268265_10265605 | Ga0268265_102656052 | 192 |
| 350 | 3300028381 | Ga0268264_10023033 | Ga0268264_100230337 | 192 |
| 351 | 3300028381 | Ga0268264_10673709 | Ga0268264_106737091 | 192 |
| 352 | 3300028786 | Ga0307517_10040637 | Ga0307517_100406375 | 192 |
| 353 | 3300028786 | Ga0307517_10073704 | Ga0307517_100737041 | 192 |
| 354 | 3300031235 | Ga0265330_10045051 | Ga0265330_100450511 | 192 |
| 355 | 3300031241 | Ga0265325_10203463 | Ga0265325_102034632 | 192 |
| 356 | 3300031249 | Ga0265339_10264285 | Ga0265339_102642851 | 192 |
| 357 | 3300031250 | Ga0265331_10150577 | Ga0265331_101505772 | 192 |
| 358 | 3300031595 | Ga0265313_10061525 | Ga0265313_100615252 | 192 |
| 359 | 3300031616 | Ga0307508_10234721 | Ga0307508_102347212 | 192 |
| 360 | 3300031711 | Ga0265314_10200587 | Ga0265314_102005872 | 192 |
| 361 | 3300031730 | Ga0307516_10048316 | Ga0307516_100483163 | 192 |
| 362 | 3300031911 | Ga0307412_10662295 | Ga0307412_106622952 | 192 |
| 363 | 3300032002 | Ga0307416_100204999 | Ga0307416_1002049991 | 192 |
| 364 | 3300032002 | Ga0307416_101379324 | Ga0307416_1013793241 | 192 |
| 365 | 3300033180 | Ga0307510_10032634 | Ga0307510_100326347 | 192 |
| 366 | 3300033180 | Ga0307510_10199868 | Ga0307510_101998683 | 192 |
| 367 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004443 | 192 |
| 368 | 3300035086 | Ga0373934_0003635 | Ga0373934_0003635_4936_5517 | 192 |
| 369 | 3300035111 | Ga0373923_0083746 | Ga0373923_0083746_485_1066 | 192 |
| 370 | 3300035113 | Ga0373936_0176351 | Ga0373936_0176351_85_666 | 192 |
| 371 | 3300035114 | Ga0373939_0064276 | Ga0373939_0064276_145_726 | 192 |
| 372 | 3300035115 | Ga0373941_0036503 | Ga0373941_0036503_524_1105 | 192 |
| 373 | 3300035116 | Ga0373945_0202466 | Ga0373945_0202466_58_639 | 192 |
| 374 | 3300035117 | Ga0373953_0000752 | Ga0373953_0000752_2879_3460 | 192 |
| 375 | 3300035118 | Ga0373954_0001286 | Ga0373954_0001286_3517_4098 | 192 |
| 376 | 3300035119 | Ga0373956_0021279 | Ga0373956_0021279_2029_2610 | 192 |
| 377 | 3300035120 | Ga0373957_0001582 | Ga0373957_0001582_3743_4324 | 192 |
| 378 | 3300035172 | Ga0373955_0001870 | Ga0373955_0001870_1654_2235 | 192 |
| 379 | 3300035410 | Ga0373924_0001741 | Ga0373924_0001741_1088_1669 | 192 |
| 380 | 3300035691 | Ga0373931_0127429 | Ga0373931_0127429_619_1200 | 192 |
| 381 | 3300035695 | Ga0373927_0039982 | Ga0373927_0039982_1686_2267 | 192 |
| 382 | 3300035695 | Ga0373927_0168819 | Ga0373927_0168819_827_1408 | 192 |
| 383 | 3300035724 | Ga0373933_0005956 | Ga0373933_0005956_724_1305 | 192 |
| 384 | 3300035725 | Ga0373947_0402942 | Ga0373947_0402942_104_685 | 192 |
| 385 | 3300036401 | Ga0373937_0027219 | Ga0373937_0027219_697_1278 | 192 |
| 386 | 3300037418 | Ga0395900_0189155 | Ga0395900_0189155_1203_1784 | 192 |
| 387 | 3300037466 | Ga0395898_0178612 | Ga0395898_0178612_293_874 | 192 |
| 388 | 3300037466 | Ga0395898_0617546 | Ga0395898_0617546_254_835 | 192 |
| 389 | 3300037466 | Ga0395898_0821245 | Ga0395898_0821245_77_658 | 192 |
| 390 | 3300037471 | Ga0395905_0002843 | Ga0395905_0002843_9682_10263 | 192 |
| 391 | 3300037471 | Ga0395905_0412230 | Ga0395905_0412230_227_808 | 192 |
| 392 | 3300037853 | Ga0436364_0521266 | Ga0436364_0521266_642_1223 | 192 |
| 393 | 3300037853 | Ga0436364_1331208 | Ga0436364_1331208_53_634 | 192 |
| 394 | 3300038443 | Ga0395901_0166879 | Ga0395901_0166879_858_1439 | 192 |
| 395 | 3300039437 | Ga0436365_0048824 | Ga0436365_0048824_263_844 | 192 |
| 396 | 3300039437 | Ga0436365_0198529 | Ga0436365_0198529_1360_1941 | 192 |
| 397 | 3300039437 | Ga0436365_0365623 | Ga0436365_0365623_23221_23802 | 192 |
| 398 | 3300039437 | Ga0436365_0525473 | Ga0436365_0525473_1684_2265 | 192 |
| 399 | 3300039437 | Ga0436365_0575604 | Ga0436365_0575604_487_1068 | 192 |
| 400 | 3300039437 | Ga0436365_1667378 | Ga0436365_1667378_507_1088 | 192 |
| 401 | 3300039450 | Ga0436363_0108046 | Ga0436363_0108046_171_752 | 192 |
| 402 | 3300041501 | Ga0451845_0569045 | Ga0451845_0569045_99_680 | 192 |
| 403 | 3300041512 | Ga0451853_1352546 | Ga0451853_1352546_258_839 | 192 |
| 404 | 3300044656 | Ga0466969_0270446 | Ga0466969_0270446_160_741 | 192 |
| 405 | 3300044658 | Ga0466972_0002729 | Ga0466972_0002729_7622_8203 | 192 |
| 406 | 3300044684 | Ga0466966_0007745 | Ga0466966_0007745_4299_4880 | 192 |
| 407 | 3300044684 | Ga0466966_0087453 | Ga0466966_0087453_950_1531 | 192 |
| 408 | 3300044693 | Ga0466961_0000090 | Ga0466961_0000090_47096_47677 | 192 |
| 409 | 3300044694 | Ga0466963_0768436 | Ga0466963_0768436_23_604 | 192 |
| 410 | 3300044706 | Ga0466964_0225591 | Ga0466964_0225591_110_691 | 192 |
| 411 | 3300044719 | Ga0466971_0114418 | Ga0466971_0114418_352_933 | 192 |
| 412 | 3300044765 | Ga0466970_0129648 | Ga0466970_0129648_554_1135 | 192 |
| 413 | 3300045049 | Ga0466959_0015724 | Ga0466959_0015724_4345_4926 | 192 |
| 414 | 3300045049 | Ga0466959_0171575 | Ga0466959_0171575_496_1077 | 192 |
| 415 | 3300045049 | Ga0466959_0729487 | Ga0466959_0729487_12_593 | 192 |
| 416 | 3300045049 | Ga0466959_0770317 | Ga0466959_0770317_49_630 | 192 |
| 417 | 3300045836 | Ga0466958_0080568 | Ga0466958_0080568_323_904 | 192 |
| 418 | 3300045976 | Ga0466967_0078087 | Ga0466967_0078087_1499_2080 | 192 |
| 419 | 3300045976 | Ga0466967_0869996 | Ga0466967_0869996_69_650 | 192 |
| 420 | 3300046454 | Ga0495592_0025795 | Ga0495592_0025795_3744_4325 | 192 |
| 421 | 3300046454 | Ga0495592_0035268 | Ga0495592_0035268_2156_2737 | 192 |
| 422 | 3300046455 | Ga0495603_0062406 | Ga0495603_0062406_21_602 | 192 |
| 423 | 3300046457 | Ga0495590_0217196 | Ga0495590_0217196_67_648 | 192 |
| 424 | 3300046459 | Ga0495629_0004290 | Ga0495629_0004290_3158_3739 | 192 |
| 425 | 3300046459 | Ga0495629_0007382 | Ga0495629_0007382_2469_3050 | 192 |
| 426 | 3300046460 | Ga0495638_0029336 | Ga0495638_0029336_2645_3226 | 192 |
| 427 | 3300046460 | Ga0495638_0048855 | Ga0495638_0048855_879_1463 | 192 |
| 428 | 3300046462 | Ga0495651_0001583 | Ga0495651_0001583_9356_9937 | 192 |
| 429 | 3300046462 | Ga0495651_0018088 | Ga0495651_0018088_137_718 | 192 |
| 430 | 3300046462 | Ga0495651_0513038 | Ga0495651_0513038_62_643 | 192 |
| 431 | 3300046463 | Ga0495653_0011022 | Ga0495653_0011022_4739_5320 | 192 |
| 432 | 3300046463 | Ga0495653_0015778 | Ga0495653_0015778_2665_3246 | 192 |
| 433 | 3300046471 | Ga0495650_0078064 | Ga0495650_0078064_151_732 | 192 |
| 434 | 3300046473 | Ga0495582_0353692 | Ga0495582_0353692_252_833 | 192 |
| 435 | 3300046475 | Ga0495639_0267230 | Ga0495639_0267230_169_750 | 192 |
| 436 | 3300046477 | Ga0495664_0001921 | Ga0495664_0001921_7677_8258 | 192 |
| 437 | 3300046477 | Ga0495664_0577499 | Ga0495664_0577499_33_614 | 192 |
| 438 | 3300046491 | Ga0495584_0291973 | Ga0495584_0291973_151_732 | 192 |
| 439 | 3300046491 | Ga0495584_0300071 | Ga0495584_0300071_173_754 | 192 |
| 440 | 3300046492 | Ga0495585_0185516 | Ga0495585_0185516_58_639 | 192 |
| 441 | 3300046492 | Ga0495585_0275297 | Ga0495585_0275297_81_662 | 192 |
| 442 | 3300046499 | Ga0495594_0112848 | Ga0495594_0112848_239_820 | 192 |
| 443 | 3300046506 | Ga0495583_0000399 | Ga0495583_0000399_47430_48014 | 192 |
| 444 | 3300046507 | Ga0495606_0123071 | Ga0495606_0123071_828_1409 | 192 |
| 445 | 3300046511 | Ga0495608_0005405 | Ga0495608_0005405_1920_2501 | 192 |
| 446 | 3300046511 | Ga0495608_0018913 | Ga0495608_0018913_3406_3987 | 192 |
| 447 | 3300046512 | Ga0495610_0223442 | Ga0495610_0223442_153_734 | 192 |
| 448 | 3300046514 | Ga0495618_0249318 | Ga0495618_0249318_13_594 | 192 |
| 449 | 3300046516 | Ga0495628_0003941 | Ga0495628_0003941_4821_5402 | 192 |
| 450 | 3300046516 | Ga0495628_0048683 | Ga0495628_0048683_2019_2600 | 192 |
| 451 | 3300046517 | Ga0495630_0040720 | Ga0495630_0040720_2483_3064 | 192 |
| 452 | 3300046518 | Ga0495631_0259246 | Ga0495631_0259246_29_610 | 192 |
| 453 | 3300046519 | Ga0495632_0063502 | Ga0495632_0063502_1039_1620 | 192 |
| 454 | 3300046519 | Ga0495632_0264513 | Ga0495632_0264513_112_693 | 192 |
| 455 | 3300046522 | Ga0495643_0020965 | Ga0495643_0020965_1314_1895 | 192 |
| 456 | 3300046523 | Ga0495644_0108415 | Ga0495644_0108415_358_939 | 192 |
| 457 | 3300046524 | Ga0495648_0005492 | Ga0495648_0005492_7579_8160 | 192 |
| 458 | 3300046526 | Ga0495666_0182381 | Ga0495666_0182381_86_667 | 192 |
| 459 | 3300046529 | Ga0495652_0008159 | Ga0495652_0008159_1390_1971 | 192 |
| 460 | 3300046529 | Ga0495652_0018809 | Ga0495652_0018809_3415_3996 | 192 |
| 461 | 3300046533 | Ga0495640_0032777 | Ga0495640_0032777_460_1041 | 192 |
| 462 | 3300046533 | Ga0495640_0151251 | Ga0495640_0151251_653_1234 | 192 |
| 463 | 3300046536 | Ga0495587_0015615 | Ga0495587_0015615_137_718 | 192 |
| 464 | 3300046536 | Ga0495587_0028544 | Ga0495587_0028544_624_1205 | 192 |
| 465 | 3300046537 | Ga0495598_0096113 | Ga0495598_0096113_83_664 | 192 |
| 466 | 3300046539 | Ga0495621_0085226 | Ga0495621_0085226_55_636 | 192 |
| 467 | 3300046542 | Ga0495597_0186357 | Ga0495597_0186357_42_623 | 192 |
| 468 | 3300046557 | Ga0495622_0025480 | Ga0495622_0025480_173_754 | 192 |
| 469 | 3300046559 | Ga0495667_0005627 | Ga0495667_0005627_1008_1589 | 192 |
| 470 | 3300046559 | Ga0495667_0135984 | Ga0495667_0135984_257_838 | 192 |
| 471 | 3300046616 | Ga0495668_0209826 | Ga0495668_0209826_123_704 | 192 |
| 472 | 3300046642 | Ga0495634_0009394 | Ga0495634_0009394_637_1218 | 192 |
| 473 | 3300046642 | Ga0495634_0443650 | Ga0495634_0443650_13_594 | 192 |
| 474 | 3300046648 | Ga0495611_0295145 | Ga0495611_0295145_127_708 | 192 |
| 475 | 3300046660 | Ga0495625_0510395 | Ga0495625_0510395_133_714 | 192 |
| 476 | 3300046660 | Ga0495625_0544127 | Ga0495625_0544127_66_647 | 192 |
| 477 | 3300046663 | Ga0495635_0011234 | Ga0495635_0011234_2863_3444 | 192 |
| 478 | 3300046663 | Ga0495635_0017454 | Ga0495635_0017454_1091_1672 | 192 |
| 479 | 3300046663 | Ga0495635_0029429 | Ga0495635_0029429_2388_2969 | 192 |
| 480 | 3300046664 | Ga0495659_0129293 | Ga0495659_0129293_160_741 | 192 |
| 481 | 3300046674 | Ga0495588_0013209 | Ga0495588_0013209_548_1129 | 192 |
| 482 | 3300046675 | Ga0495657_0005728 | Ga0495657_0005728_3066_3647 | 192 |
| 483 | 3300046675 | Ga0495657_0011375 | Ga0495657_0011375_747_1328 | 192 |
| 484 | 3300046678 | Ga0495599_0006706 | Ga0495599_0006706_5777_6358 | 192 |
| 485 | 3300046678 | Ga0495599_0038367 | Ga0495599_0038367_865_1446 | 192 |
| 486 | 3300046679 | Ga0495623_0013374 | Ga0495623_0013374_849_1430 | 192 |
| 487 | 3300046679 | Ga0495623_0151330 | Ga0495623_0151330_129_710 | 192 |
| 488 | 3300046680 | Ga0495646_0007443 | Ga0495646_0007443_6174_6755 | 192 |
| 489 | 3300046680 | Ga0495646_0077229 | Ga0495646_0077229_147_728 | 192 |
| 490 | 3300046684 | Ga0495669_0134957 | Ga0495669_0134957_178_759 | 192 |
| 491 | 3300046684 | Ga0495669_0322398 | Ga0495669_0322398_80_661 | 192 |
| 492 | 3300046689 | Ga0495613_0487293 | Ga0495613_0487293_167_748 | 192 |
| 493 | 3300046690 | Ga0495624_0165812 | Ga0495624_0165812_316_900 | 192 |
| 494 | 3300046691 | Ga0495670_0413127 | Ga0495670_0413127_42_623 | 192 |
| 495 | 3300046691 | Ga0495670_0439711 | Ga0495670_0439711_60_644 | 192 |
| 496 | 3300046694 | Ga0495649_0128756 | Ga0495649_0128756_463_1044 | 192 |
| 497 | 3300046794 | Ga0495589_0004447 | Ga0495589_0004447_6562_7143 | 192 |
| 498 | 3300046794 | Ga0495589_0117126 | Ga0495589_0117126_159_740 | 192 |
| 499 | 3300046794 | Ga0495589_0171273 | Ga0495589_0171273_80_661 | 192 |
| 500 | 3300046809 | Ga0495600_0003173 | Ga0495600_0003173_3228_3809 | 192 |
| 501 | 3300046809 | Ga0495600_0031143 | Ga0495600_0031143_713_1294 | 192 |
| 502 | 3300046810 | Ga0495660_0064640 | Ga0495660_0064640_1108_1692 | 192 |
| 503 | 3300047315 | Ga0495581_0091626 | Ga0495581_0091626_318_899 | 192 |
| 504 | 3300047317 | Ga0495604_0002451 | Ga0495604_0002451_6631_7212 | 192 |
| 505 | 3300047317 | Ga0495604_0024181 | Ga0495604_0024181_3215_3796 | 192 |
| 506 | 3300047317 | Ga0495604_0044801 | Ga0495604_0044801_713_1294 | 192 |
| 507 | 3300047317 | Ga0495604_0329944 | Ga0495604_0329944_206_790 | 192 |
| 508 | 3300047318 | Ga0495636_0324399 | Ga0495636_0324399_118_699 | 192 |
| 509 | 3300047319 | Ga0495674_0021952 | Ga0495674_0021952_183_764 | 192 |
| 510 | 3300047319 | Ga0495674_0024430 | Ga0495674_0024430_4815_5396 | 192 |
| 511 | 3300047320 | Ga0495672_0240676 | Ga0495672_0240676_189_770 | 192 |
| 512 | 3300047321 | Ga0495676_0148688 | Ga0495676_0148688_42_623 | 192 |
| 513 | 3300047322 | Ga0495680_0004114 | Ga0495680_0004114_5795_6376 | 192 |
| 514 | 3300047323 | Ga0495683_0068140 | Ga0495683_0068140_1159_1740 | 192 |
| 515 | 3300047443 | Ga0495687_014614 | Ga0495687_014614_942_1523 | 192 |
| 516 | 3300047444 | Ga0495675_0007193 | Ga0495675_0007193_2191_2772 | 192 |
| 517 | 3300047444 | Ga0495675_0017754 | Ga0495675_0017754_3616_4197 | 192 |
| 518 | 3300047469 | Ga0495673_0000053 | Ga0495673_0000053_177361_177942 | 192 |
| 519 | 3300047471 | Ga0495684_0007358 | Ga0495684_0007358_6992_7573 | 192 |
| 520 | 3300048088 | Ga0495602_0007289 | Ga0495602_0007289_3351_3932 | 192 |
| 521 | 3300048088 | Ga0495602_0115238 | Ga0495602_0115238_633_1214 | 192 |
| 522 | 3300048090 | Ga0495615_0143510 | Ga0495615_0143510_73_654 | 192 |
| 523 | 3300048903 | Ga0496100_0018006 | Ga0496100_0018006_1672_2253 | 192 |
| 524 | 3300048903 | Ga0496100_0105859 | Ga0496100_0105859_496_1077 | 192 |
| 525 | 3300048903 | Ga0496100_0252143 | Ga0496100_0252143_657_1238 | 192 |
| 526 | 3300048903 | Ga0496100_0322330 | Ga0496100_0322330_302_883 | 192 |
| 527 | 3300048903 | Ga0496100_0346737 | Ga0496100_0346737_492_1073 | 192 |
| 528 | 3300048903 | Ga0496100_0503307 | Ga0496100_0503307_95_676 | 192 |
| 529 | 3300048903 | Ga0496100_0830206 | Ga0496100_0830206_104_685 | 192 |
| 530 | 3300048904 | Ga0496101_0035808 | Ga0496101_0035808_275_856 | 192 |
| 531 | 3300048904 | Ga0496101_0194310 | Ga0496101_0194310_352_933 | 192 |
| 532 | 3300048904 | Ga0496101_0208750 | Ga0496101_0208750_87_668 | 192 |
| 533 | 3300048904 | Ga0496101_0707960 | Ga0496101_0707960_193_774 | 192 |
| 534 | 3300048905 | Ga0496102_0013449 | Ga0496102_0013449_226_807 | 192 |
| 535 | 3300048905 | Ga0496102_0272614 | Ga0496102_0272614_39_620 | 192 |
| 536 | 3300048905 | Ga0496102_0333520 | Ga0496102_0333520_62_643 | 192 |
| 537 | 3300048906 | Ga0496103_0024819 | Ga0496103_0024819_2105_2686 | 192 |
| 538 | 3300048907 | Ga0496104_0049397 | Ga0496104_0049397_3008_3589 | 192 |
| 539 | 3300048908 | Ga0496105_0013759 | Ga0496105_0013759_4220_4801 | 192 |
| 540 | 3300048908 | Ga0496105_0064804 | Ga0496105_0064804_170_751 | 192 |
| 541 | 3300048909 | Ga0496106_0031859 | Ga0496106_0031859_246_827 | 192 |
| 542 | 3300048909 | Ga0496106_0045461 | Ga0496106_0045461_2265_2846 | 192 |
| 543 | 3300048909 | Ga0496106_0265384 | Ga0496106_0265384_120_701 | 192 |
| 544 | 3300048909 | Ga0496106_0451327 | Ga0496106_0451327_258_839 | 192 |
| 545 | 3300048910 | Ga0496107_0136469 | Ga0496107_0136469_628_1209 | 192 |
| 546 | 3300048910 | Ga0496107_0627607 | Ga0496107_0627607_84_665 | 192 |
| 547 | 3300048911 | Ga0496108_0185630 | Ga0496108_0185630_438_1019 | 192 |
| 548 | 3300048911 | Ga0496108_0385645 | Ga0496108_0385645_609_1190 | 192 |
| 549 | 3300048912 | Ga0496109_0135872 | Ga0496109_0135872_417_998 | 192 |
| 550 | 3300048912 | Ga0496109_0161809 | Ga0496109_0161809_115_696 | 192 |
| 551 | 3300048912 | Ga0496109_0484664 | Ga0496109_0484664_42_623 | 192 |
| 552 | 3300048912 | Ga0496109_0552490 | Ga0496109_0552490_53_634 | 192 |
| 553 | 3300048912 | Ga0496109_0844607 | Ga0496109_0844607_71_652 | 192 |
| 554 | 3300048913 | Ga0496110_0046154 | Ga0496110_0046154_1093_1674 | 192 |
| 555 | 3300048913 | Ga0496110_0094730 | Ga0496110_0094730_694_1275 | 192 |
| 556 | 3300048913 | Ga0496110_0216332 | Ga0496110_0216332_619_1200 | 192 |
| 557 | 3300048913 | Ga0496110_0463909 | Ga0496110_0463909_358_939 | 192 |
| 558 | 3300048913 | Ga0496110_0831339 | Ga0496110_0831339_170_751 | 192 |
| 559 | 3300048914 | Ga0496111_0114133 | Ga0496111_0114133_738_1319 | 192 |
| 560 | 3300048914 | Ga0496111_0120150 | Ga0496111_0120150_783_1364 | 192 |
| 561 | 3300048915 | Ga0496112_0000045 | Ga0496112_0000045_13361_13945 | 192 |
| 562 | 3300048915 | Ga0496112_0040796 | Ga0496112_0040796_3082_3663 | 192 |
| 563 | 3300048915 | Ga0496112_0051708 | Ga0496112_0051708_1524_2105 | 192 |
| 564 | 3300048915 | Ga0496112_0190082 | Ga0496112_0190082_1078_1659 | 192 |
| 565 | 3300048915 | Ga0496112_0366475 | Ga0496112_0366475_117_698 | 192 |
| 566 | 3300048915 | Ga0496112_0730263 | Ga0496112_0730263_64_645 | 192 |
| 567 | 3300048916 | Ga0496113_0041112 | Ga0496113_0041112_1557_2138 | 192 |
| 568 | 3300048916 | Ga0496113_0471411 | Ga0496113_0471411_87_668 | 192 |
| 569 | 3300048917 | Ga0496114_0035171 | Ga0496114_0035171_960_1541 | 192 |
| 570 | 3300048917 | Ga0496114_0589968 | Ga0496114_0589968_377_958 | 192 |
| 571 | 3300048918 | Ga0496115_0106189 | Ga0496115_0106189_637_1218 | 192 |
| 572 | 3300048918 | Ga0496115_0730753 | Ga0496115_0730753_51_632 | 192 |
| 573 | 3300048920 | Ga0496117_0092093 | Ga0496117_0092093_960_1541 | 192 |
| 574 | 3300048921 | Ga0496118_0047165 | Ga0496118_0047165_2208_2789 | 192 |
| 575 | 3300048921 | Ga0496118_0081442 | Ga0496118_0081442_1340_1921 | 192 |
| 576 | 3300048921 | Ga0496118_0436887 | Ga0496118_0436887_43_624 | 192 |
| 577 | 3300048922 | Ga0496119_0146893 | Ga0496119_0146893_438_1019 | 192 |
| 578 | 3300048923 | Ga0496120_0039541 | Ga0496120_0039541_678_1259 | 192 |
| 579 | 3300048924 | Ga0496121_0004381 | Ga0496121_0004381_1758_2339 | 192 |
| 580 | 3300048924 | Ga0496121_0047210 | Ga0496121_0047210_2483_3064 | 192 |
| 581 | 3300048924 | Ga0496121_0075894 | Ga0496121_0075894_1669_2250 | 192 |
| 582 | 3300048924 | Ga0496121_0111792 | Ga0496121_0111792_1314_1895 | 192 |
| 583 | 3300048924 | Ga0496121_0270433 | Ga0496121_0270433_34_615 | 192 |
| 584 | 3300048924 | Ga0496121_0394116 | Ga0496121_0394116_266_847 | 192 |
| 585 | 3300048925 | Ga0496122_0181684 | Ga0496122_0181684_362_943 | 192 |
| 586 | 3300048926 | Ga0496123_0248670 | Ga0496123_0248670_240_821 | 192 |
| 587 | 3300048927 | Ga0496124_0238269 | Ga0496124_0238269_253_834 | 192 |
| 588 | 3300048928 | Ga0496125_0082316 | Ga0496125_0082316_1805_2386 | 192 |
| 589 | 3300048928 | Ga0496125_0085529 | Ga0496125_0085529_599_1180 | 192 |
| 590 | 3300048929 | Ga0496126_0005092 | Ga0496126_0005092_3089_3670 | 192 |
| 591 | 3300048929 | Ga0496126_0025891 | Ga0496126_0025891_4201_4782 | 192 |
| 592 | 3300048929 | Ga0496126_0071562 | Ga0496126_0071562_197_778 | 192 |
| 593 | 3300048929 | Ga0496126_0119596 | Ga0496126_0119596_155_736 | 192 |
| 594 | 3300048929 | Ga0496126_0122496 | Ga0496126_0122496_731_1312 | 192 |
| 595 | 3300048929 | Ga0496126_0159699 | Ga0496126_0159699_475_1056 | 192 |
| 596 | 3300048929 | Ga0496126_0205972 | Ga0496126_0205972_90_671 | 192 |
| 597 | 3300048929 | Ga0496126_0226326 | Ga0496126_0226326_640_1221 | 192 |
| 598 | 3300048929 | Ga0496126_0333683 | Ga0496126_0333683_254_835 | 192 |
| 599 | 3300048929 | Ga0496126_0475226 | Ga0496126_0475226_310_891 | 192 |
| 600 | 3300049460 | Ga0495682_0147956 | Ga0495682_0147956_61_642 | 192 |
| 601 | 3300049592 | Ga0501076_0727512 | Ga0501076_0727512_186_767 | 192 |
| 602 | 3300050490 | nmdc:mga03n38_205736_c1 | nmdc:mga03n38_205736_c1_327_908 | 192 |
| 603 | 3300050491 | nmdc:mga00v17_120973_c1 | nmdc:mga00v17_120973_c1_20_601 | 192 |
| 604 | 3300050491 | nmdc:mga00v17_229841_c1 | nmdc:mga00v17_229841_c1_582_1163 | 192 |
| 605 | 3300050492 | nmdc:mga0yw44_201939_c1 | nmdc:mga0yw44_201939_c1_716_1297 | 192 |
| 606 | 3300050492 | nmdc:mga0yw44_49041_c1 | nmdc:mga0yw44_49041_c1_1586_2167 | 192 |
| 607 | 3300050492 | nmdc:mga0yw44_87026_c1 | nmdc:mga0yw44_87026_c1_1170_1751 | 192 |
| 608 | 3300050492 | nmdc:mga0yw44_96688_c1 | nmdc:mga0yw44_96688_c1_1273_1854 | 192 |
| 609 | 3300050492 | nmdc:mga0yw44_98668_c1 | nmdc:mga0yw44_98668_c1_644_1225 | 192 |
| 610 | 3300050493 | nmdc:mga0k408_122025_c1 | nmdc:mga0k408_122025_c1_205_786 | 192 |
| 611 | 3300050493 | nmdc:mga0k408_236724_c1 | nmdc:mga0k408_236724_c1_423_1004 | 192 |
| 612 | 3300050494 | nmdc:mga06z11_61294_c1 | nmdc:mga06z11_61294_c1_621_1202 | 192 |
| 613 | 3300050495 | nmdc:mga04h51_38503_c1 | nmdc:mga04h51_38503_c1_942_1523 | 192 |
| 614 | 3300050496 | nmdc:mga07m45_18815_c1 | nmdc:mga07m45_18815_c1_2447_3028 | 192 |
| 615 | 3300050512 | nmdc:mga0n895_12280_c1 | nmdc:mga0n895_12280_c1_7021_7650 | 192 |
| 616 | 3300050513 | nmdc:mga0rr50_205675_c1 | nmdc:mga0rr50_205675_c1_736_1317 | 192 |
| 617 | 3300050515 | nmdc:mga0a205_591472_c1 | nmdc:mga0a205_591472_c1_221_802 | 192 |
| 618 | 3300050516 | nmdc:mga0sz30_213032_c1 | nmdc:mga0sz30_213032_c1_82_663 | 192 |
| 619 | 3300053077 | Ga0495601_0095059 | Ga0495601_0095059_875_1456 | 192 |
| 620 | 3300053077 | Ga0495601_0162070 | Ga0495601_0162070_130_711 | 192 |
| 621 | 3300053077 | Ga0495601_0225166 | Ga0495601_0225166_89_670 | 192 |
| 622 | 3300053084 | Ga0495595_0000665 | Ga0495595_0000665_12175_12756 | 192 |
| 623 | 3300053084 | Ga0495595_0193074 | Ga0495595_0193074_160_741 | 192 |
| 624 | 3300053085 | Ga0495619_0007310 | Ga0495619_0007310_747_1328 | 192 |
| 625 | 3300053086 | Ga0500578_0400449 | Ga0500578_0400449_135_716 | 192 |
| 626 | 3300053087 | Ga0500643_000047 | Ga0500643_000047_42813_43394 | 192 |
| 627 | 3300053092 | Ga0500583_0083581 | Ga0500583_0083581_954_1535 | 192 |
| 628 | 3300053094 | Ga0500566_0000003 | Ga0500566_0000003_14770_15351 | 192 |
| 629 | 3300053094 | Ga0500566_0002730 | Ga0500566_0002730_9319_9900 | 192 |
| 630 | 3300053094 | Ga0500566_0160147 | Ga0500566_0160147_66_647 | 192 |
| 631 | 3300053096 | Ga0500641_0144200 | Ga0500641_0144200_31_612 | 192 |
| 632 | 3300053103 | Ga0500555_002126 | Ga0500555_002126_4189_4770 | 192 |
| 633 | 3300053104 | Ga0500556_0043709 | Ga0500556_0043709_359_940 | 192 |
| 634 | 3300053105 | Ga0500557_000115 | Ga0500557_000115_7869_8450 | 192 |
| 635 | 3300053109 | Ga0500569_149115 | Ga0500569_149115_190_771 | 192 |
| 636 | 3300053111 | Ga0500572_000637 | Ga0500572_000637_8241_8822 | 192 |
| 637 | 3300053118 | Ga0500594_0021143 | Ga0500594_0021143_992_1573 | 192 |
| 638 | 3300053119 | Ga0500595_077137 | Ga0500595_077137_41_622 | 192 |
| 639 | 3300053121 | Ga0500607_062780 | Ga0500607_062780_740_1321 | 192 |
| 640 | 3300053123 | Ga0500614_034579 | Ga0500614_034579_595_1176 | 192 |
| 641 | 3300053130 | Ga0500642_0000141 | Ga0500642_0000141_7892_8473 | 192 |
| 642 | 3300053130 | Ga0500642_0009034 | Ga0500642_0009034_885_1466 | 192 |
| 643 | 3300053134 | Ga0500658_0191254 | Ga0500658_0191254_140_721 | 192 |
| 644 | 3300053136 | Ga0500559_0000226 | Ga0500559_0000226_25834_26415 | 192 |
| 645 | 3300053136 | Ga0500559_0007137 | Ga0500559_0007137_362_946 | 192 |
| 646 | 3300053136 | Ga0500559_0007393 | Ga0500559_0007393_2609_3190 | 192 |
| 647 | 3300053139 | Ga0500568_0014324 | Ga0500568_0014324_1130_1711 | 192 |
| 648 | 3300053142 | Ga0500577_0001229 | Ga0500577_0001229_4045_4626 | 192 |
| 649 | 3300053142 | Ga0500577_0139241 | Ga0500577_0139241_96_677 | 192 |
| 650 | 3300053156 | Ga0500622_0018031 | Ga0500622_0018031_2675_3256 | 192 |
| 651 | 3300053158 | Ga0500627_0011669 | Ga0500627_0011669_821_1402 | 192 |
| 652 | 3300053163 | Ga0500639_118688 | Ga0500639_118688_660_1241 | 192 |
| 653 | 3300053177 | Ga0500636_0000024 | Ga0500636_0000024_20950_21531 | 192 |
| 654 | 3300053177 | Ga0500636_0007534 | Ga0500636_0007534_1109_1690 | 192 |
| 655 | 3300053178 | Ga0500637_0202640 | Ga0500637_0202640_19_600 | 192 |
| 656 | 3300053178 | Ga0500637_0284887 | Ga0500637_0284887_303_884 | 192 |
| 657 | 3300053730 | Ga0500645_005912 | Ga0500645_005912_3325_3906 | 192 |
| 658 | 3300053735 | Ga0500596_000691 | Ga0500596_000691_2249_2830 | 192 |
| 659 | 3300053736 | Ga0500599_007639 | Ga0500599_007639_116_697 | 192 |
| 660 | 3300053737 | Ga0500601_000728 | Ga0500601_000728_1440_2021 | 192 |
| 661 | 3300053737 | Ga0500601_008085 | Ga0500601_008085_569_1150 | 192 |
| 662 | 3300061719 | Ga0466962_0183960 | Ga0466962_0183960_419_1000 | 192 |
| 663 | 3300003187 | JGI25151J46595_10002752 | JGI25151J46595_100027526 | 193 |
| 664 | 3300025294 | Ga0209025_1000283 | Ga0209025_100028354 | 193 |
| 665 | 3300031901 | Ga0307406_10000719 | Ga0307406_100007194 | 193 |
| 666 | 3300048909 | Ga0496106_0016081 | Ga0496106_0016081_2880_3467 | 193 |
| 667 | 3300048910 | Ga0496107_0000191 | Ga0496107_0000191_4822_5409 | 193 |
| 668 | 3300048924 | Ga0496121_0001169 | Ga0496121_0001169_9091_9678 | 193 |
| 669 | 3300010375 | Ga0105239_10618358 | Ga0105239_106183581 | 194 |
| 670 | 3300025912 | Ga0207707_10047311 | Ga0207707_100473114 | 194 |
| 671 | 2162886012 | MBSR1b_contig_9108740 | MBSR1b_0401.00003180 | 195 |
| 672 | 3300005335 | Ga0070666_10363602 | Ga0070666_103636022 | 195 |
| 673 | 3300005338 | Ga0068868_100287972 | Ga0068868_1002879722 | 195 |
| 674 | 3300005364 | Ga0070673_100470901 | Ga0070673_1004709012 | 195 |
| 675 | 3300005456 | Ga0070678_100028290 | Ga0070678_1000282902 | 195 |
| 676 | 3300005618 | Ga0068864_100014536 | Ga0068864_1000145366 | 195 |
| 677 | 3300005841 | Ga0068863_100023489 | Ga0068863_1000234895 | 195 |
| 678 | 3300006237 | Ga0097621_100717841 | Ga0097621_1007178411 | 195 |
| 679 | 3300006358 | Ga0068871_100466435 | Ga0068871_1004664352 | 195 |
| 680 | 3300009551 | Ga0105238_10147951 | Ga0105238_101479511 | 195 |
| 681 | 3300013296 | Ga0157374_10062849 | Ga0157374_100628493 | 195 |
| 682 | 3300013306 | Ga0163162_10643872 | Ga0163162_106438722 | 195 |
| 683 | 3300014325 | Ga0163163_10069406 | Ga0163163_100694063 | 195 |
| 684 | 3300014968 | Ga0157379_10119558 | Ga0157379_101195582 | 195 |
| 685 | 3300025942 | Ga0207689_10398595 | Ga0207689_103985952 | 195 |
| 686 | 3300026023 | Ga0207677_10111275 | Ga0207677_101112752 | 195 |
| 687 | 3300026095 | Ga0207676_10011745 | Ga0207676_100117453 | 195 |
| 688 | 3300026121 | Ga0207683_10059644 | Ga0207683_100596443 | 195 |
| 689 | 3300031456 | Ga0307513_10071688 | Ga0307513_100716883 | 195 |
| 690 | 3300037853 | Ga0436364_0198842 | Ga0436364_0198842_917_1561 | 195 |
| 691 | 3300044684 | Ga0466966_0374157 | Ga0466966_0374157_49_657 | 195 |
| 692 | 3300046810 | Ga0495660_0179841 | Ga0495660_0179841_344_949 | 195 |
| 693 | 3300048909 | Ga0496106_0155837 | Ga0496106_0155837_532_1125 | 195 |
| 694 | 3300048911 | Ga0496108_0171300 | Ga0496108_0171300_1141_1734 | 195 |
| 695 | 3300048912 | Ga0496109_0074842 | Ga0496109_0074842_208_801 | 195 |
| 696 | 3300048914 | Ga0496111_0263810 | Ga0496111_0263810_242_835 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1viu-assembly2.cif.gz_C | crystal structure of putative adp ribose pyrophosphatase | 0.9628 | 6 | 186 |
| 3o52-assembly2.cif.gz_C | structure of the e.coli gdp-mannose hydrolase (yffh) in complex with tartrate | 0.9627 | 6 | 186 |
| 1viu-assembly1.cif.gz_A | crystal structure of putative adp ribose pyrophosphatase | 0.9613 | 6 | 186 |
| 3o69-assembly1.cif.gz_A | structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ | 0.9599 | 6 | 186 |
| 3o69-assembly1.cif.gz_B | structure of the e100a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ | 0.9584 | 6 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o69B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9584 | 6 | 186 | 3.90.79.10 |
| 3o69B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9092 | 6 | 186 | 3.90.79.10 |
| 1viqA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9072 | 5 | 190 | 3.90.79.10 |
| af_Q1LXZ5_39_239_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9068 | 47 | 191 | 3.90.79.10 |
| af_Q9LDI9_5_132_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8809 | 6 | 44 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G8NQZ1-F1-model_v4 | Uncharacterized protein | 0.9859 | 1 | 51 |
|
| AF-A0A2S0XQ09-F1-model_v4 | GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) | 0.9826 | 1 | 195 |
GO:0005829
GO:0006753 GO:0016818 GO:0019693 GO:0046872 |
| AF-A0A3S2B0Y2-F1-model_v4 | GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) | 0.9813 | 4 | 122 |
GO:0005829
GO:0006753 GO:0016818 GO:0019693 GO:0046872 |
| AF-A0A366EEV4-F1-model_v4 | GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) | 0.9811 | 1 | 193 |
GO:0005829
GO:0006753 GO:0016818 GO:0019693 GO:0046872 |
| AF-A0A0K6I4J3-F1-model_v4 | GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) | 0.9799 | 2 | 194 |
GO:0005829
GO:0006753 GO:0016818 GO:0019693 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar