F475841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 696 | 365 | 695 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10048431|Ga0265330_100484312 |
| Length | 246 |
| Sequence | MPDRTPQSLSIAQRMRSLHKAASGVENASPAKFVPAKTKARRKPGPRGPRKEKSAARRDAILAAALAEFAERGFEAARLDDVARRANVAKGTIYLYFRDKQALFQELLRQMLTPIIGGIEALGAADLPVHAFVEQLVELFVREVYETPRKDVIRLMITEGRRFPKLAEFYYREVLSRIIAAVRALLSRAAARGEVPAGLVDFPQIIVAPGLLAIVWSGLFDKYEPLDVRAMMKAHVELLFAPRRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 103 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 104 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 235 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 357 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 358 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.31 |
| Nodule | 0 |
| Rhizoplane | 5.32 |
| Rhizosphere | 89.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000444 | 3300000041 | Bacteria | 5518 |
| 2 | ARSoilYngRDRAFT_c00409 | 3300000042 | Bacteria | 5538 |
| 3 | ARcpr5yngRDRAFT_c000424 | 3300000043 | Bacteria | 5559 |
| 4 | ARSoilOldRDRAFT_c000395 | 3300000044 | Bacteria | 5402 |
| 5 | ARCol0oldRDRAFT_c01154 | 3300000045 | Bacteria | 1926 |
| 6 | ARCol0yngRDRAFT_1000418 | 3300000652 | Bacteria | 5543 |
| 7 | JGI24752J21851_1003948 | 3300001976 | Bacteria | 1952 |
| 8 | JGI24746J21847_1000185 | 3300001977 | Bacteria | 8237 |
| 9 | JGI24747J21853_1002365 | 3300001978 | Bacteria | 1531 |
| 10 | JGI24739J22299_10000164 | 3300001989 | Bacteria | 21825 |
| 11 | JGI24745J21846_1000369 | 3300002073 | Bacteria | 3934 |
| 12 | JGI24749J21850_1005843 | 3300002076 | Bacteria | 1716 |
| 13 | JGI24744J21845_10011578 | 3300002077 | Bacteria | 1802 |
| 14 | JGI24033J26618_1002322 | 3300002155 | Bacteria | 1938 |
| 15 | JGI24751J29686_10011012 | 3300002459 | Unclassified | 1865 |
| 16 | JGI25405J52794_10058386 | 3300003911 | Bacteria | 832 |
| 17 | Ga0065704_10139579 | 3300005289 | Bacteria | 1532 |
| 18 | Ga0065712_10105365 | 3300005290 | Bacteria | 1941 |
| 19 | Ga0065715_10001682 | 3300005293 | Bacteria | 8090 |
| 20 | Ga0065715_10121240 | 3300005293 | Bacteria | 2235 |
| 21 | Ga0070676_10136131 | 3300005328 | Bacteria | 1559 |
| 22 | Ga0070683_100000376 | 3300005329 | Bacteria | 31004 |
| 23 | Ga0070683_100022026 | 3300005329 | Bacteria | 5690 |
| 24 | Ga0070666_10184690 | 3300005335 | Bacteria | 1463 |
| 25 | Ga0070680_100172825 | 3300005336 | Unclassified | 1819 |
| 26 | Ga0070680_100500512 | 3300005336 | Bacteria | 1040 |
| 27 | Ga0070682_100000141 | 3300005337 | Bacteria | 57251 |
| 28 | Ga0068868_100379489 | 3300005338 | Bacteria | 1216 |
| 29 | Ga0070660_100100076 | 3300005339 | Unclassified | 2295 |
| 30 | Ga0070689_100003974 | 3300005340 | Bacteria | 9929 |
| 31 | Ga0070691_10014449 | 3300005341 | Bacteria | 3623 |
| 32 | Ga0070661_100000242 | 3300005344 | Bacteria | 44945 |
| 33 | Ga0070668_100192735 | 3300005347 | Bacteria | 1670 |
| 34 | Ga0070675_100000165 | 3300005354 | Bacteria | 40656 |
| 35 | Ga0070675_100280831 | 3300005354 | Bacteria | 1463 |
| 36 | Ga0070671_100001907 | 3300005355 | Bacteria | 15957 |
| 37 | Ga0070674_100142637 | 3300005356 | Bacteria | 1799 |
| 38 | Ga0070673_100001190 | 3300005364 | Bacteria | 14967 |
| 39 | Ga0070673_100027376 | 3300005364 | Bacteria | 4225 |
| 40 | Ga0070688_100002746 | 3300005365 | Bacteria | 8940 |
| 41 | Ga0070703_10010312 | 3300005406 | Bacteria | 2632 |
| 42 | Ga0070709_10633969 | 3300005434 | Bacteria | 826 |
| 43 | Ga0070713_100010515 | 3300005436 | Bacteria | 6688 |
| 44 | Ga0070713_100538902 | 3300005436 | Bacteria | 1104 |
| 45 | Ga0070710_10013868 | 3300005437 | Bacteria | 4046 |
| 46 | Ga0070710_10036184 | 3300005437 | Bacteria | 2697 |
| 47 | Ga0070711_100090906 | 3300005439 | Bacteria | 2199 |
| 48 | Ga0070711_100282896 | 3300005439 | Bacteria | 1313 |
| 49 | Ga0070711_100367936 | 3300005439 | Bacteria | 1159 |
| 50 | Ga0070705_100102590 | 3300005440 | Bacteria | 1809 |
| 51 | Ga0070705_100166578 | 3300005440 | Bacteria | 1479 |
| 52 | Ga0070708_100038832 | 3300005445 | Bacteria | 4162 |
| 53 | Ga0070663_100012645 | 3300005455 | Bacteria | 5348 |
| 54 | Ga0070663_100130562 | 3300005455 | Bacteria | 1907 |
| 55 | Ga0070678_100001012 | 3300005456 | Bacteria | 14620 |
| 56 | Ga0070662_100235133 | 3300005457 | Unclassified | 1467 |
| 57 | Ga0068867_100050314 | 3300005459 | Bacteria | 3070 |
| 58 | Ga0068867_100290654 | 3300005459 | Unclassified | 1344 |
| 59 | Ga0068867_100701373 | 3300005459 | Bacteria | 893 |
| 60 | Ga0070685_10000547 | 3300005466 | Bacteria | 21062 |
| 61 | Ga0070707_101018000 | 3300005468 | Bacteria | 794 |
| 62 | Ga0070679_100024204 | 3300005530 | Bacteria | 5950 |
| 63 | Ga0070679_100641681 | 3300005530 | Bacteria | 1005 |
| 64 | Ga0070679_100697948 | 3300005530 | Bacteria | 957 |
| 65 | Ga0070684_100382482 | 3300005535 | Bacteria | 1296 |
| 66 | Ga0070697_100201328 | 3300005536 | Bacteria | 1693 |
| 67 | Ga0070672_100000527 | 3300005543 | Bacteria | 22399 |
| 68 | Ga0070672_100406113 | 3300005543 | Bacteria | 1168 |
| 69 | Ga0070695_100001734 | 3300005545 | Bacteria | 12268 |
| 70 | Ga0070695_100007154 | 3300005545 | Bacteria | 6616 |
| 71 | Ga0070695_100012588 | 3300005545 | Bacteria | 5079 |
| 72 | Ga0070696_100040533 | 3300005546 | Bacteria | 3215 |
| 73 | Ga0070693_100000199 | 3300005547 | Bacteria | 28265 |
| 74 | Ga0070693_100013889 | 3300005547 | Bacteria | 4113 |
| 75 | Ga0070665_100374166 | 3300005548 | Bacteria | 1432 |
| 76 | Ga0068855_100004444 | 3300005563 | Bacteria | 17127 |
| 77 | Ga0070664_100000895 | 3300005564 | Bacteria | 23168 |
| 78 | Ga0070664_100006659 | 3300005564 | Bacteria | 9319 |
| 79 | Ga0070664_100031100 | 3300005564 | Bacteria | 4457 |
| 80 | Ga0068857_100001816 | 3300005577 | Bacteria | 17161 |
| 81 | Ga0068854_100001666 | 3300005578 | Bacteria | 13522 |
| 82 | Ga0068856_100001538 | 3300005614 | Bacteria | 24179 |
| 83 | Ga0068856_100478856 | 3300005614 | Bacteria | 1266 |
| 84 | Ga0068856_100622010 | 3300005614 | Bacteria | 1101 |
| 85 | Ga0070702_100001415 | 3300005615 | Bacteria | 9801 |
| 86 | Ga0070702_100700950 | 3300005615 | Unclassified | 772 |
| 87 | Ga0068852_100002972 | 3300005616 | Bacteria | 11773 |
| 88 | Ga0068864_100000227 | 3300005618 | Bacteria | 50765 |
| 89 | Ga0068870_10000155 | 3300005840 | Bacteria | 23940 |
| 90 | Ga0068863_100000495 | 3300005841 | Bacteria | 39957 |
| 91 | Ga0068858_100000783 | 3300005842 | Bacteria | 33229 |
| 92 | Ga0068858_100286720 | 3300005842 | Bacteria | 1569 |
| 93 | Ga0068860_100022860 | 3300005843 | Bacteria | 6046 |
| 94 | Ga0068860_100126276 | 3300005843 | Bacteria | 2452 |
| 95 | Ga0068860_100312604 | 3300005843 | Bacteria | 1541 |
| 96 | Ga0068862_100313808 | 3300005844 | Unclassified | 1445 |
| 97 | Ga0081455_10006948 | 3300005937 | Bacteria | 12035 |
| 98 | Ga0081455_10169393 | 3300005937 | Bacteria | 1665 |
| 99 | Ga0081538_10006317 | 3300005981 | Bacteria | 10463 |
| 100 | Ga0081540_1029769 | 3300005983 | Bacteria | 3036 |
| 101 | Ga0081540_1067389 | 3300005983 | Bacteria | 1673 |
| 102 | Ga0070717_10421408 | 3300006028 | Bacteria | 1201 |
| 103 | Ga0070717_10440499 | 3300006028 | Bacteria | 1173 |
| 104 | Ga0075365_10077232 | 3300006038 | Bacteria | 2250 |
| 105 | Ga0075368_10000202 | 3300006042 | Bacteria | 16522 |
| 106 | Ga0075368_10009591 | 3300006042 | Bacteria | 3483 |
| 107 | Ga0075363_100015552 | 3300006048 | Bacteria | 3743 |
| 108 | Ga0075363_100064868 | 3300006048 | Bacteria | 1973 |
| 109 | Ga0075363_100082581 | 3300006048 | Bacteria | 1759 |
| 110 | Ga0075432_10000464 | 3300006058 | Bacteria | 12026 |
| 111 | Ga0075432_10058773 | 3300006058 | Bacteria | 1366 |
| 112 | Ga0070715_10063192 | 3300006163 | Bacteria | 1631 |
| 113 | Ga0070712_100365350 | 3300006175 | Bacteria | 1184 |
| 114 | Ga0070712_100849664 | 3300006175 | Bacteria | 785 |
| 115 | Ga0075367_10000448 | 3300006178 | Bacteria | 15330 |
| 116 | Ga0075367_10126994 | 3300006178 | Bacteria | 1574 |
| 117 | Ga0075367_10309065 | 3300006178 | Bacteria | 996 |
| 118 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 119 | Ga0097621_100038380 | 3300006237 | Bacteria | 3843 |
| 120 | Ga0075370_10099418 | 3300006353 | Bacteria | 1683 |
| 121 | Ga0068871_100000034 | 3300006358 | Bacteria | 71462 |
| 122 | Ga0075428_100016761 | 3300006844 | Bacteria | 8090 |
| 123 | Ga0075428_100156309 | 3300006844 | Bacteria | 2477 |
| 124 | Ga0075428_100410294 | 3300006844 | Bacteria | 1451 |
| 125 | Ga0075428_100507572 | 3300006844 | Bacteria | 1290 |
| 126 | Ga0075428_100610672 | 3300006844 | Bacteria | 1164 |
| 127 | Ga0075430_100005590 | 3300006846 | Bacteria | 10623 |
| 128 | Ga0075430_100006793 | 3300006846 | Bacteria | 9642 |
| 129 | Ga0075430_100074585 | 3300006846 | Bacteria | 2844 |
| 130 | Ga0075430_100092819 | 3300006846 | Bacteria | 2523 |
| 131 | Ga0075430_100178157 | 3300006846 | Bacteria | 1768 |
| 132 | Ga0075430_100281040 | 3300006846 | Bacteria | 1377 |
| 133 | Ga0075431_100002999 | 3300006847 | Bacteria | 16342 |
| 134 | Ga0075431_100004052 | 3300006847 | Bacteria | 14278 |
| 135 | Ga0075431_100010695 | 3300006847 | Bacteria | 9221 |
| 136 | Ga0075431_100171407 | 3300006847 | Bacteria | 2229 |
| 137 | Ga0075431_100252069 | 3300006847 | Bacteria | 1793 |
| 138 | Ga0075431_100260622 | 3300006847 | Bacteria | 1759 |
| 139 | Ga0075431_100395587 | 3300006847 | Bacteria | 1384 |
| 140 | Ga0075431_100619943 | 3300006847 | Bacteria | 1064 |
| 141 | Ga0075433_10000774 | 3300006852 | Bacteria | 21997 |
| 142 | Ga0075433_10009145 | 3300006852 | Bacteria | 7912 |
| 143 | Ga0075434_100001700 | 3300006871 | Bacteria | 18837 |
| 144 | Ga0075434_100005910 | 3300006871 | Bacteria | 11193 |
| 145 | Ga0075434_100017596 | 3300006871 | Bacteria | 6890 |
| 146 | Ga0075429_100007130 | 3300006880 | Bacteria | 9709 |
| 147 | Ga0075429_100208466 | 3300006880 | Bacteria | 1712 |
| 148 | Ga0075429_100249590 | 3300006880 | Bacteria | 1554 |
| 149 | Ga0075429_100291621 | 3300006880 | Bacteria | 1428 |
| 150 | Ga0068865_100000230 | 3300006881 | Bacteria | 31147 |
| 151 | Ga0068865_100460130 | 3300006881 | Unclassified | 1054 |
| 152 | Ga0075435_100018036 | 3300007076 | Bacteria | 5355 |
| 153 | Ga0075435_100262238 | 3300007076 | Bacteria | 1472 |
| 154 | Ga0099795_10020516 | 3300007788 | Bacteria | 2154 |
| 155 | Ga0105240_10412735 | 3300009093 | Unclassified | 1518 |
| 156 | Ga0111539_10000932 | 3300009094 | Bacteria | 38323 |
| 157 | Ga0111539_10010377 | 3300009094 | Bacteria | 11726 |
| 158 | Ga0111539_10134890 | 3300009094 | Bacteria | 2891 |
| 159 | Ga0111539_10361669 | 3300009094 | Bacteria | 1689 |
| 160 | Ga0114129_10026350 | 3300009147 | Bacteria | 8231 |
| 161 | Ga0114129_10072966 | 3300009147 | Bacteria | 4783 |
| 162 | Ga0114129_10097472 | 3300009147 | Bacteria | 4071 |
| 163 | Ga0114129_10124834 | 3300009147 | Bacteria | 3540 |
| 164 | Ga0114129_10151517 | 3300009147 | Bacteria | 3173 |
| 165 | Ga0114129_10646036 | 3300009147 | Bacteria | 1366 |
| 166 | Ga0114129_10743347 | 3300009147 | Bacteria | 1256 |
| 167 | Ga0114129_10970007 | 3300009147 | Bacteria | 1072 |
| 168 | Ga0105241_10052670 | 3300009174 | Bacteria | 3109 |
| 169 | Ga0105241_10300667 | 3300009174 | Bacteria | 1377 |
| 170 | Ga0105238_10287562 | 3300009551 | Bacteria | 1626 |
| 171 | Ga0105249_10018811 | 3300009553 | Bacteria | 6157 |
| 172 | Ga0105249_10080288 | 3300009553 | Bacteria | 3029 |
| 173 | Ga0105249_11226388 | 3300009553 | Bacteria | 821 |
| 174 | Ga0099796_10075690 | 3300010159 | Unclassified | 1224 |
| 175 | Ga0105239_10074122 | 3300010375 | Bacteria | 3742 |
| 176 | Ga0105239_10528203 | 3300010375 | Bacteria | 1343 |
| 177 | Ga0157324_1000372 | 3300012506 | Bacteria | 2076 |
| 178 | Ga0157326_1001336 | 3300012513 | Bacteria | 2725 |
| 179 | Ga0157338_1004402 | 3300012515 | Bacteria | 1216 |
| 180 | Ga0157373_10122264 | 3300013100 | Bacteria | 1829 |
| 181 | Ga0157370_10038246 | 3300013104 | Bacteria | 4642 |
| 182 | Ga0157370_10501211 | 3300013104 | Bacteria | 1115 |
| 183 | Ga0163162_10238564 | 3300013306 | Bacteria | 1949 |
| 184 | Ga0157372_10085368 | 3300013307 | Bacteria | 3580 |
| 185 | Ga0157380_10031602 | 3300014326 | Bacteria | 4065 |
| 186 | Ga0157380_10156672 | 3300014326 | Bacteria | 1975 |
| 187 | Ga0157379_10228435 | 3300014968 | Bacteria | 1687 |
| 188 | Ga0163161_10000523 | 3300017792 | Bacteria | 31363 |
| 189 | Ga0213875_10000567 | 3300021388 | Bacteria | 30137 |
| 190 | Ga0207666_1000010 | 3300025271 | Bacteria | 46973 |
| 191 | Ga0207673_1000265 | 3300025290 | Bacteria | 5342 |
| 192 | Ga0207697_10000186 | 3300025315 | Bacteria | 32405 |
| 193 | Ga0207697_10003939 | 3300025315 | Bacteria | 7220 |
| 194 | Ga0207653_10006329 | 3300025885 | Bacteria | 3693 |
| 195 | Ga0207682_10000123 | 3300025893 | Bacteria | 34953 |
| 196 | Ga0207692_10196855 | 3300025898 | Bacteria | 1182 |
| 197 | Ga0207642_10043751 | 3300025899 | Unclassified | 1978 |
| 198 | Ga0207710_10002765 | 3300025900 | Bacteria | 8022 |
| 199 | Ga0207688_10000889 | 3300025901 | Bacteria | 15094 |
| 200 | Ga0207685_10026415 | 3300025905 | Bacteria | 2019 |
| 201 | Ga0207699_10003769 | 3300025906 | Bacteria | 7238 |
| 202 | Ga0207699_10043874 | 3300025906 | Bacteria | 2600 |
| 203 | Ga0207645_10000023 | 3300025907 | Bacteria | 98724 |
| 204 | Ga0207645_10141903 | 3300025907 | Unclassified | 1566 |
| 205 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 206 | Ga0207654_10006607 | 3300025911 | Bacteria | 5831 |
| 207 | Ga0207654_10059928 | 3300025911 | Unclassified | 2222 |
| 208 | Ga0207707_10002015 | 3300025912 | Bacteria | 18441 |
| 209 | Ga0207707_10454637 | 3300025912 | Bacteria | 1095 |
| 210 | Ga0207671_10053873 | 3300025914 | Bacteria | 2981 |
| 211 | Ga0207671_10317139 | 3300025914 | Bacteria | 1233 |
| 212 | Ga0207693_10009823 | 3300025915 | Bacteria | 7788 |
| 213 | Ga0207693_10062939 | 3300025915 | Bacteria | 2907 |
| 214 | Ga0207663_10059523 | 3300025916 | Bacteria | 2417 |
| 215 | Ga0207663_10193802 | 3300025916 | Bacteria | 1461 |
| 216 | Ga0207663_10243886 | 3300025916 | Bacteria | 1319 |
| 217 | Ga0207660_10000393 | 3300025917 | Bacteria | 28822 |
| 218 | Ga0207660_10050417 | 3300025917 | Bacteria | 2955 |
| 219 | Ga0207660_10109916 | 3300025917 | Bacteria | 2073 |
| 220 | Ga0207660_10136260 | 3300025917 | Bacteria | 1874 |
| 221 | Ga0207662_10000136 | 3300025918 | Bacteria | 35258 |
| 222 | Ga0207657_10035478 | 3300025919 | Bacteria | 4471 |
| 223 | Ga0207649_10000434 | 3300025920 | Bacteria | 30314 |
| 224 | Ga0207652_10001720 | 3300025921 | Bacteria | 19098 |
| 225 | Ga0207652_10065502 | 3300025921 | Bacteria | 3146 |
| 226 | Ga0207652_10066943 | 3300025921 | Bacteria | 3114 |
| 227 | Ga0207681_10000273 | 3300025923 | Bacteria | 38704 |
| 228 | Ga0207659_10000097 | 3300025926 | Bacteria | 51545 |
| 229 | Ga0207687_10001031 | 3300025927 | Bacteria | 18938 |
| 230 | Ga0207700_10019506 | 3300025928 | Bacteria | 4580 |
| 231 | Ga0207664_10470213 | 3300025929 | Bacteria | 1124 |
| 232 | Ga0207644_10005450 | 3300025931 | Bacteria | 8289 |
| 233 | Ga0207690_10000962 | 3300025932 | Bacteria | 18398 |
| 234 | Ga0207690_10176703 | 3300025932 | Bacteria | 1604 |
| 235 | Ga0207706_10000867 | 3300025933 | Bacteria | 31142 |
| 236 | Ga0207706_10023602 | 3300025933 | Bacteria | 5522 |
| 237 | Ga0207706_10271666 | 3300025933 | Unclassified | 1479 |
| 238 | Ga0207686_10002591 | 3300025934 | Bacteria | 9812 |
| 239 | Ga0207686_10020419 | 3300025934 | Bacteria | 3784 |
| 240 | Ga0207709_10007329 | 3300025935 | Bacteria | 6150 |
| 241 | Ga0207709_10047675 | 3300025935 | Bacteria | 2606 |
| 242 | Ga0207670_10000536 | 3300025936 | Bacteria | 20898 |
| 243 | Ga0207669_10001135 | 3300025937 | Bacteria | 11370 |
| 244 | Ga0207669_10082800 | 3300025937 | Bacteria | 2061 |
| 245 | Ga0207669_10094150 | 3300025937 | Bacteria | 1959 |
| 246 | Ga0207704_10000119 | 3300025938 | Bacteria | 43208 |
| 247 | Ga0207665_10103561 | 3300025939 | Bacteria | 1991 |
| 248 | Ga0207691_10000544 | 3300025940 | Bacteria | 37754 |
| 249 | Ga0207711_10002468 | 3300025941 | Bacteria | 16502 |
| 250 | Ga0207711_10235409 | 3300025941 | Bacteria | 1678 |
| 251 | Ga0207689_10001743 | 3300025942 | Bacteria | 20521 |
| 252 | Ga0207661_10000785 | 3300025944 | Bacteria | 20682 |
| 253 | Ga0207661_10080161 | 3300025944 | Bacteria | 2693 |
| 254 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 255 | Ga0207667_10016422 | 3300025949 | Bacteria | 8368 |
| 256 | Ga0207651_10000083 | 3300025960 | Bacteria | 42310 |
| 257 | Ga0207712_10000471 | 3300025961 | Bacteria | 33929 |
| 258 | Ga0207712_10313237 | 3300025961 | Bacteria | 1292 |
| 259 | Ga0207668_10000862 | 3300025972 | Bacteria | 18292 |
| 260 | Ga0207658_10002203 | 3300025986 | Bacteria | 14473 |
| 261 | Ga0207677_10000992 | 3300026023 | Bacteria | 15647 |
| 262 | Ga0207703_10088692 | 3300026035 | Bacteria | 2596 |
| 263 | Ga0207639_10004451 | 3300026041 | Bacteria | 9457 |
| 264 | Ga0207678_10001568 | 3300026067 | Bacteria | 21015 |
| 265 | Ga0207708_10002060 | 3300026075 | Bacteria | 14813 |
| 266 | Ga0207708_10163360 | 3300026075 | Bacteria | 1759 |
| 267 | Ga0207702_10003639 | 3300026078 | Bacteria | 13965 |
| 268 | Ga0207702_10421742 | 3300026078 | Bacteria | 1290 |
| 269 | Ga0207702_11047310 | 3300026078 | Bacteria | 809 |
| 270 | Ga0207641_10000510 | 3300026088 | Bacteria | 43699 |
| 271 | Ga0207648_10002351 | 3300026089 | Bacteria | 20407 |
| 272 | Ga0207648_10739767 | 3300026089 | Bacteria | 913 |
| 273 | Ga0207676_10003788 | 3300026095 | Bacteria | 10694 |
| 274 | Ga0207674_10000608 | 3300026116 | Bacteria | 46971 |
| 275 | Ga0207675_100000805 | 3300026118 | Bacteria | 31142 |
| 276 | Ga0207675_100049572 | 3300026118 | Bacteria | 3918 |
| 277 | Ga0207675_100172777 | 3300026118 | Bacteria | 2066 |
| 278 | Ga0207683_10000082 | 3300026121 | Bacteria | 74842 |
| 279 | Ga0207698_10000377 | 3300026142 | Bacteria | 25983 |
| 280 | Ga0207698_10257026 | 3300026142 | Bacteria | 1602 |
| 281 | Ga0209999_1021261 | 3300027543 | Unclassified | 1191 |
| 282 | Ga0209971_1007895 | 3300027682 | Bacteria | 2525 |
| 283 | Ga0209966_1000761 | 3300027695 | Bacteria | 6647 |
| 284 | Ga0209998_10001920 | 3300027717 | Bacteria | 4889 |
| 285 | Ga0209998_10005097 | 3300027717 | Bacteria | 2759 |
| 286 | Ga0209813_10004851 | 3300027866 | Bacteria | 3233 |
| 287 | Ga0209974_10004757 | 3300027876 | Bacteria | 4820 |
| 288 | Ga0207428_10000124 | 3300027907 | Bacteria | 105795 |
| 289 | Ga0207428_10000420 | 3300027907 | Bacteria | 52679 |
| 290 | Ga0207428_10000703 | 3300027907 | Bacteria | 38851 |
| 291 | Ga0207428_10040025 | 3300027907 | Bacteria | 3804 |
| 292 | Ga0268265_10001170 | 3300028380 | Bacteria | 22993 |
| 293 | Ga0268265_10322200 | 3300028380 | Bacteria | 1400 |
| 294 | Ga0268265_10335815 | 3300028380 | Bacteria | 1374 |
| 295 | Ga0268264_10001878 | 3300028381 | Bacteria | 19073 |
| 296 | Ga0268264_10080791 | 3300028381 | Bacteria | 2777 |
| 297 | Ga0268264_10196448 | 3300028381 | Bacteria | 1842 |
| 298 | Ga0268264_10646488 | 3300028381 | Bacteria | 1046 |
| 299 | Ga0265330_10048431 | 3300031235 | Bacteria | 1869 |
| 300 | Ga0265332_10001311 | 3300031238 | Bacteria | 14161 |
| 301 | Ga0265325_10000105 | 3300031241 | Bacteria | 59642 |
| 302 | Ga0265325_10007640 | 3300031241 | Bacteria | 6463 |
| 303 | Ga0265325_10026904 | 3300031241 | Bacteria | 3112 |
| 304 | Ga0265340_10069909 | 3300031247 | Bacteria | 1666 |
| 305 | Ga0265339_10002938 | 3300031249 | Bacteria | 12049 |
| 306 | Ga0265339_10004703 | 3300031249 | Bacteria | 9264 |
| 307 | Ga0265316_10133683 | 3300031344 | Bacteria | 1867 |
| 308 | Ga0265313_10000041 | 3300031595 | Bacteria | 119119 |
| 309 | Ga0265313_10005622 | 3300031595 | Bacteria | 9166 |
| 310 | Ga0265313_10014009 | 3300031595 | Bacteria | 4774 |
| 311 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 312 | Ga0265314_10010302 | 3300031711 | Bacteria | 7807 |
| 313 | Ga0265342_10000287 | 3300031712 | Bacteria | 57222 |
| 314 | Ga0307416_100252012 | 3300032002 | Bacteria | 1719 |
| 315 | Ga0373930_0000557 | 3300034816 | Bacteria | 5130 |
| 316 | Ga0373930_0003558 | 3300034816 | Bacteria | 2478 |
| 317 | Ga0373950_0042416 | 3300034818 | Bacteria | 874 |
| 318 | Ga0373958_0001091 | 3300034819 | Bacteria | 3577 |
| 319 | Ga0373959_0001344 | 3300034820 | Bacteria | 3926 |
| 320 | Ga0373959_0005481 | 3300034820 | Bacteria | 2081 |
| 321 | Ga0373938_0000092 | 3300034957 | Bacteria | 12211 |
| 322 | Ga0373938_0004552 | 3300034957 | Bacteria | 2323 |
| 323 | Ga0373926_0002897 | 3300035083 | Bacteria | 5500 |
| 324 | Ga0373928_0000404 | 3300035084 | Bacteria | 8588 |
| 325 | Ga0373929_0000856 | 3300035085 | Bacteria | 5927 |
| 326 | Ga0373929_0019904 | 3300035085 | Unclassified | 1348 |
| 327 | Ga0373934_0014603 | 3300035086 | Bacteria | 2977 |
| 328 | Ga0373940_0000069 | 3300035088 | Bacteria | 11756 |
| 329 | Ga0373944_0000522 | 3300035089 | Bacteria | 9004 |
| 330 | Ga0373949_0002201 | 3300035090 | Bacteria | 5100 |
| 331 | Ga0373949_0003185 | 3300035090 | Bacteria | 3988 |
| 332 | Ga0373951_0005474 | 3300035091 | Bacteria | 2950 |
| 333 | Ga0373952_0001123 | 3300035092 | Bacteria | 4891 |
| 334 | Ga0373952_0002122 | 3300035092 | Bacteria | 3563 |
| 335 | Ga0373923_0000908 | 3300035111 | Bacteria | 7900 |
| 336 | Ga0373923_0012499 | 3300035111 | Bacteria | 3139 |
| 337 | Ga0373932_0000510 | 3300035112 | Bacteria | 11939 |
| 338 | Ga0373932_0076146 | 3300035112 | Unclassified | 1051 |
| 339 | Ga0373936_0013341 | 3300035113 | Bacteria | 3136 |
| 340 | Ga0373936_0017209 | 3300035113 | Bacteria | 2782 |
| 341 | Ga0373939_0002803 | 3300035114 | Bacteria | 4090 |
| 342 | Ga0373939_0044377 | 3300035114 | Bacteria | 1353 |
| 343 | Ga0373941_0000855 | 3300035115 | Bacteria | 6273 |
| 344 | Ga0373941_0002011 | 3300035115 | Bacteria | 4408 |
| 345 | Ga0373941_0003910 | 3300035115 | Bacteria | 3413 |
| 346 | Ga0373945_0000687 | 3300035116 | Bacteria | 9768 |
| 347 | Ga0373956_0003018 | 3300035119 | Bacteria | 6820 |
| 348 | Ga0373956_0017796 | 3300035119 | Bacteria | 3002 |
| 349 | Ga0373957_0118942 | 3300035120 | Bacteria | 1068 |
| 350 | Ga0373960_0002095 | 3300035121 | Bacteria | 4490 |
| 351 | Ga0373960_0051174 | 3300035121 | Bacteria | 1226 |
| 352 | Ga0373943_0078240 | 3300035170 | Bacteria | 1690 |
| 353 | Ga0373943_0094844 | 3300035170 | Bacteria | 1551 |
| 354 | Ga0373946_0070176 | 3300035171 | Unclassified | 1511 |
| 355 | Ga0373955_0006189 | 3300035172 | Bacteria | 5443 |
| 356 | Ga0373942_0001103 | 3300035207 | Bacteria | 7179 |
| 357 | Ga0373961_0000636 | 3300035241 | Bacteria | 12674 |
| 358 | Ga0373961_0005849 | 3300035241 | Bacteria | 2954 |
| 359 | Ga0373961_0079517 | 3300035241 | Unclassified | 1029 |
| 360 | Ga0373962_0054149 | 3300035242 | Bacteria | 1163 |
| 361 | Ga0373962_0060521 | 3300035242 | Bacteria | 1111 |
| 362 | Ga0373924_0027294 | 3300035410 | Bacteria | 2270 |
| 363 | Ga0373924_0089884 | 3300035410 | Bacteria | 1313 |
| 364 | Ga0373931_0000186 | 3300035691 | Bacteria | 26950 |
| 365 | Ga0373931_0001154 | 3300035691 | Bacteria | 11223 |
| 366 | Ga0373931_0003707 | 3300035691 | Bacteria | 6911 |
| 367 | Ga0373931_0032737 | 3300035691 | Bacteria | 2691 |
| 368 | Ga0373935_0032811 | 3300035692 | Bacteria | 3228 |
| 369 | Ga0373935_0124844 | 3300035692 | Bacteria | 1723 |
| 370 | Ga0373927_0006188 | 3300035695 | Bacteria | 8178 |
| 371 | Ga0373927_0123446 | 3300035695 | Bacteria | 1690 |
| 372 | Ga0373933_0004423 | 3300035724 | Bacteria | 7714 |
| 373 | Ga0373933_0012736 | 3300035724 | Bacteria | 4650 |
| 374 | Ga0373947_0039335 | 3300035725 | Bacteria | 2813 |
| 375 | Ga0373937_0011291 | 3300036401 | Bacteria | 7833 |
| 376 | Ga0373937_0019099 | 3300036401 | Bacteria | 6133 |
| 377 | Ga0373937_0019441 | 3300036401 | Bacteria | 6080 |
| 378 | Ga0373937_0020009 | 3300036401 | Bacteria | 5995 |
| 379 | Ga0373937_0062979 | 3300036401 | Bacteria | 3410 |
| 380 | Ga0373925_0033046 | 3300037068 | Bacteria | 3812 |
| 381 | Ga0373925_0040062 | 3300037068 | Bacteria | 3467 |
| 382 | Ga0373925_0115602 | 3300037068 | Bacteria | 2077 |
| 383 | Ga0373925_0334949 | 3300037068 | Unclassified | 1226 |
| 384 | Ga0373925_0402059 | 3300037068 | Bacteria | 1117 |
| 385 | Ga0436364_0045028 | 3300037853 | Bacteria | 9121 |
| 386 | Ga0242420_004233 | 3300038996 | Bacteria | 2161 |
| 387 | Ga0436361_0405803 | 3300039447 | Bacteria | 1009 |
| 388 | Ga0436363_0770944 | 3300039450 | Bacteria | 1322 |
| 389 | Ga0436362_0112778 | 3300039453 | Bacteria | 755 |
| 390 | Ga0439441_015523 | 3300042001 | Unclassified | 1348 |
| 391 | Ga0439455_0010858 | 3300042012 | Bacteria | 2013 |
| 392 | Ga0451577_0048381 | 3300042876 | Bacteria | 3799 |
| 393 | Ga0451576_0052484 | 3300045051 | Bacteria | 4272 |
| 394 | Ga0495592_0001116 | 3300046454 | Bacteria | 18677 |
| 395 | Ga0495592_0008124 | 3300046454 | Bacteria | 7881 |
| 396 | Ga0495592_0028640 | 3300046454 | Bacteria | 4217 |
| 397 | Ga0495592_0169115 | 3300046454 | Bacteria | 1498 |
| 398 | Ga0495603_0008589 | 3300046455 | Bacteria | 6173 |
| 399 | Ga0495603_0040127 | 3300046455 | Bacteria | 2803 |
| 400 | Ga0495629_0061155 | 3300046459 | Bacteria | 2631 |
| 401 | Ga0495629_0162800 | 3300046459 | Bacteria | 1549 |
| 402 | Ga0495638_0041088 | 3300046460 | Bacteria | 2928 |
| 403 | Ga0495641_0021653 | 3300046461 | Bacteria | 3230 |
| 404 | Ga0495641_0110662 | 3300046461 | Bacteria | 1226 |
| 405 | Ga0495651_0000493 | 3300046462 | Bacteria | 30523 |
| 406 | Ga0495651_0003892 | 3300046462 | Bacteria | 11420 |
| 407 | Ga0495651_0006050 | 3300046462 | Bacteria | 9238 |
| 408 | Ga0495653_0004657 | 3300046463 | Bacteria | 11097 |
| 409 | Ga0495653_0174008 | 3300046463 | Bacteria | 1483 |
| 410 | Ga0495580_0021831 | 3300046472 | Bacteria | 4721 |
| 411 | Ga0495582_0001705 | 3300046473 | Bacteria | 12400 |
| 412 | Ga0495582_0024557 | 3300046473 | Bacteria | 3299 |
| 413 | Ga0495639_0047948 | 3300046475 | Bacteria | 1936 |
| 414 | Ga0495662_0009334 | 3300046476 | Bacteria | 4811 |
| 415 | Ga0495664_0001609 | 3300046477 | Bacteria | 12011 |
| 416 | Ga0495585_0003281 | 3300046492 | Bacteria | 11009 |
| 417 | Ga0495594_0022175 | 3300046499 | Bacteria | 3395 |
| 418 | Ga0495607_0004288 | 3300046501 | Bacteria | 10532 |
| 419 | Ga0495608_0088519 | 3300046511 | Bacteria | 2004 |
| 420 | Ga0495618_0015490 | 3300046514 | Bacteria | 4653 |
| 421 | Ga0495628_0002046 | 3300046516 | Bacteria | 18273 |
| 422 | Ga0495628_0014402 | 3300046516 | Bacteria | 6630 |
| 423 | Ga0495630_0036431 | 3300046517 | Bacteria | 3678 |
| 424 | Ga0495630_0065419 | 3300046517 | Bacteria | 2732 |
| 425 | Ga0495630_0143743 | 3300046517 | Bacteria | 1814 |
| 426 | Ga0495644_0000514 | 3300046523 | Bacteria | 16546 |
| 427 | Ga0495666_0001847 | 3300046526 | Bacteria | 10463 |
| 428 | Ga0495666_0016564 | 3300046526 | Bacteria | 3672 |
| 429 | Ga0495652_0011016 | 3300046529 | Bacteria | 8193 |
| 430 | Ga0495652_0143441 | 3300046529 | Bacteria | 1875 |
| 431 | Ga0495652_0325251 | 3300046529 | Bacteria | 1109 |
| 432 | Ga0495665_0026043 | 3300046531 | Bacteria | 3141 |
| 433 | Ga0495640_0019454 | 3300046533 | Bacteria | 5011 |
| 434 | Ga0495640_0036686 | 3300046533 | Bacteria | 3462 |
| 435 | Ga0495640_0038267 | 3300046533 | Bacteria | 3375 |
| 436 | Ga0495640_0153691 | 3300046533 | Bacteria | 1477 |
| 437 | Ga0495587_0016309 | 3300046536 | Bacteria | 4623 |
| 438 | Ga0495587_0016489 | 3300046536 | Bacteria | 4595 |
| 439 | Ga0495587_0020228 | 3300046536 | Bacteria | 4111 |
| 440 | Ga0495645_0001781 | 3300046543 | Bacteria | 14625 |
| 441 | Ga0495645_0009419 | 3300046543 | Bacteria | 6824 |
| 442 | Ga0495645_0312691 | 3300046543 | Bacteria | 1022 |
| 443 | Ga0495622_0012353 | 3300046557 | Bacteria | 3952 |
| 444 | Ga0495622_0148178 | 3300046557 | Bacteria | 1063 |
| 445 | Ga0495667_0002342 | 3300046559 | Bacteria | 12672 |
| 446 | Ga0495667_0011331 | 3300046559 | Bacteria | 6037 |
| 447 | Ga0495667_0037159 | 3300046559 | Bacteria | 3246 |
| 448 | Ga0495667_0052769 | 3300046559 | Bacteria | 2678 |
| 449 | Ga0495656_0001283 | 3300046615 | Bacteria | 8165 |
| 450 | Ga0495634_0063424 | 3300046642 | Bacteria | 2452 |
| 451 | Ga0495634_0088224 | 3300046642 | Bacteria | 2018 |
| 452 | Ga0495634_0096170 | 3300046642 | Bacteria | 1918 |
| 453 | Ga0495625_0193799 | 3300046660 | Bacteria | 1345 |
| 454 | Ga0495635_0000736 | 3300046663 | Bacteria | 21173 |
| 455 | Ga0495635_0004379 | 3300046663 | Bacteria | 9778 |
| 456 | Ga0495659_0056880 | 3300046664 | Bacteria | 1436 |
| 457 | Ga0495661_0056198 | 3300046665 | Bacteria | 2356 |
| 458 | Ga0495588_0018157 | 3300046674 | Bacteria | 3425 |
| 459 | Ga0495588_0080669 | 3300046674 | Unclassified | 1698 |
| 460 | Ga0495657_0007642 | 3300046675 | Bacteria | 8326 |
| 461 | Ga0495657_0172100 | 3300046675 | Unclassified | 1333 |
| 462 | Ga0495599_0002064 | 3300046678 | Bacteria | 11642 |
| 463 | Ga0495599_0002943 | 3300046678 | Bacteria | 9902 |
| 464 | Ga0495599_0003364 | 3300046678 | Bacteria | 9345 |
| 465 | Ga0495623_0002286 | 3300046679 | Bacteria | 12776 |
| 466 | Ga0495623_0159369 | 3300046679 | Bacteria | 1327 |
| 467 | Ga0495646_0000229 | 3300046680 | Bacteria | 27971 |
| 468 | Ga0495646_0006372 | 3300046680 | Bacteria | 7484 |
| 469 | Ga0495647_0004269 | 3300046681 | Bacteria | 4629 |
| 470 | Ga0495647_0185620 | 3300046681 | Bacteria | 906 |
| 471 | Ga0495658_0002748 | 3300046683 | Bacteria | 8846 |
| 472 | Ga0495613_0143415 | 3300046689 | Bacteria | 1705 |
| 473 | Ga0495613_0182060 | 3300046689 | Unclassified | 1487 |
| 474 | Ga0495624_0117309 | 3300046690 | Bacteria | 1635 |
| 475 | Ga0495624_0234738 | 3300046690 | Bacteria | 1110 |
| 476 | Ga0495624_0561834 | 3300046690 | Bacteria | 681 |
| 477 | Ga0495670_0009490 | 3300046691 | Bacteria | 4782 |
| 478 | Ga0495671_0220449 | 3300046692 | Unclassified | 918 |
| 479 | Ga0495600_0003589 | 3300046809 | Bacteria | 9137 |
| 480 | Ga0495600_0032196 | 3300046809 | Bacteria | 3401 |
| 481 | Ga0495600_0073671 | 3300046809 | Unclassified | 2230 |
| 482 | Ga0495600_0121281 | 3300046809 | Unclassified | 1700 |
| 483 | Ga0495581_0005348 | 3300047315 | Bacteria | 7424 |
| 484 | Ga0495581_0260995 | 3300047315 | Bacteria | 1013 |
| 485 | Ga0495581_0301288 | 3300047315 | Unclassified | 937 |
| 486 | Ga0495604_0009381 | 3300047317 | Bacteria | 7740 |
| 487 | Ga0495604_0119859 | 3300047317 | Bacteria | 1906 |
| 488 | Ga0495604_0243196 | 3300047317 | Unclassified | 1229 |
| 489 | Ga0495674_0013071 | 3300047319 | Bacteria | 7811 |
| 490 | Ga0495674_0030389 | 3300047319 | Bacteria | 4912 |
| 491 | Ga0495674_0039235 | 3300047319 | Bacteria | 4246 |
| 492 | Ga0495676_0122104 | 3300047321 | Unclassified | 1893 |
| 493 | Ga0495676_0159434 | 3300047321 | Bacteria | 1597 |
| 494 | Ga0495680_0005567 | 3300047322 | Bacteria | 11823 |
| 495 | Ga0495680_0029672 | 3300047322 | Bacteria | 4476 |
| 496 | Ga0495680_0047393 | 3300047322 | Bacteria | 3381 |
| 497 | Ga0495680_0118574 | 3300047322 | Bacteria | 1955 |
| 498 | Ga0495675_0013037 | 3300047444 | Bacteria | 5241 |
| 499 | Ga0495675_0030741 | 3300047444 | Bacteria | 3427 |
| 500 | Ga0495684_0006324 | 3300047471 | Bacteria | 9204 |
| 501 | Ga0495684_0139589 | 3300047471 | Unclassified | 1817 |
| 502 | Ga0495593_0122577 | 3300047673 | Unclassified | 1322 |
| 503 | Ga0495602_0006950 | 3300048088 | Bacteria | 11884 |
| 504 | Ga0495602_0253115 | 3300048088 | Bacteria | 1311 |
| 505 | Ga0496100_0000057 | 3300048903 | Bacteria | 67216 |
| 506 | Ga0496101_0001297 | 3300048904 | Bacteria | 14944 |
| 507 | Ga0496101_0097328 | 3300048904 | Bacteria | 2197 |
| 508 | Ga0496102_0001628 | 3300048905 | Bacteria | 19791 |
| 509 | Ga0496102_0018224 | 3300048905 | Bacteria | 6164 |
| 510 | Ga0496103_0003173 | 3300048906 | Bacteria | 10102 |
| 511 | Ga0496103_0011059 | 3300048906 | Bacteria | 5344 |
| 512 | Ga0496104_0000932 | 3300048907 | Bacteria | 25092 |
| 513 | Ga0496104_0041108 | 3300048907 | Bacteria | 4334 |
| 514 | Ga0496104_0388188 | 3300048907 | Bacteria | 1308 |
| 515 | Ga0496105_0019215 | 3300048908 | Bacteria | 5510 |
| 516 | Ga0496105_0021279 | 3300048908 | Bacteria | 5248 |
| 517 | Ga0496106_0000518 | 3300048909 | Bacteria | 27401 |
| 518 | Ga0496107_0001129 | 3300048910 | Bacteria | 16115 |
| 519 | Ga0496107_0005941 | 3300048910 | Bacteria | 8366 |
| 520 | Ga0496107_0116749 | 3300048910 | Bacteria | 1965 |
| 521 | Ga0496107_0255663 | 3300048910 | Bacteria | 1303 |
| 522 | Ga0496108_0004254 | 3300048911 | Bacteria | 11528 |
| 523 | Ga0496108_0021395 | 3300048911 | Bacteria | 5316 |
| 524 | Ga0496108_0051769 | 3300048911 | Bacteria | 3440 |
| 525 | Ga0496109_0002432 | 3300048912 | Bacteria | 15587 |
| 526 | Ga0496109_0003961 | 3300048912 | Bacteria | 12362 |
| 527 | Ga0496110_0001450 | 3300048913 | Bacteria | 17181 |
| 528 | Ga0496110_0022934 | 3300048913 | Bacteria | 5305 |
| 529 | Ga0496111_0018065 | 3300048914 | Bacteria | 4879 |
| 530 | Ga0496112_0105119 | 3300048915 | Bacteria | 2793 |
| 531 | Ga0496112_0254183 | 3300048915 | Bacteria | 1708 |
| 532 | Ga0496112_0555072 | 3300048915 | Bacteria | 1082 |
| 533 | Ga0496113_0016626 | 3300048916 | Bacteria | 5086 |
| 534 | Ga0496113_0030441 | 3300048916 | Bacteria | 3907 |
| 535 | Ga0496113_0388473 | 3300048916 | Bacteria | 1120 |
| 536 | Ga0496114_0002944 | 3300048917 | Bacteria | 13059 |
| 537 | Ga0496114_0355728 | 3300048917 | Bacteria | 1295 |
| 538 | Ga0496115_0002786 | 3300048918 | Bacteria | 12565 |
| 539 | Ga0496115_0014635 | 3300048918 | Bacteria | 5941 |
| 540 | Ga0496115_0032489 | 3300048918 | Bacteria | 4116 |
| 541 | Ga0496115_0203225 | 3300048918 | Bacteria | 1636 |
| 542 | Ga0501032_0048692 | 3300049569 | Bacteria | 2861 |
| 543 | Ga0501032_0494396 | 3300049569 | Bacteria | 782 |
| 544 | Ga0501033_0055047 | 3300049570 | Bacteria | 2941 |
| 545 | Ga0501033_0496149 | 3300049570 | Unclassified | 845 |
| 546 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 547 | Ga0501034_0010486 | 3300049571 | Bacteria | 9648 |
| 548 | Ga0501034_0329514 | 3300049571 | Bacteria | 1458 |
| 549 | Ga0501036_0018617 | 3300049572 | Bacteria | 5822 |
| 550 | Ga0501036_0252883 | 3300049572 | Bacteria | 1476 |
| 551 | Ga0501036_0361312 | 3300049572 | Bacteria | 1212 |
| 552 | Ga0501037_0044551 | 3300049573 | Bacteria | 3258 |
| 553 | Ga0501037_0072595 | 3300049573 | Bacteria | 2502 |
| 554 | Ga0501038_0049211 | 3300049574 | Bacteria | 3645 |
| 555 | Ga0501038_0072882 | 3300049574 | Bacteria | 2909 |
| 556 | Ga0501038_0090742 | 3300049574 | Bacteria | 2560 |
| 557 | Ga0501038_0149411 | 3300049574 | Bacteria | 1905 |
| 558 | Ga0501039_0248605 | 3300049575 | Unclassified | 1398 |
| 559 | Ga0501040_0127488 | 3300049576 | Unclassified | 1788 |
| 560 | Ga0501043_0008265 | 3300049579 | Bacteria | 8200 |
| 561 | Ga0501043_0184985 | 3300049579 | Bacteria | 1622 |
| 562 | Ga0501046_0023608 | 3300049580 | Bacteria | 5055 |
| 563 | Ga0501046_0093007 | 3300049580 | Unclassified | 2318 |
| 564 | Ga0501047_0018542 | 3300049581 | Bacteria | 6674 |
| 565 | Ga0501047_0213511 | 3300049581 | Bacteria | 1787 |
| 566 | Ga0501047_0295188 | 3300049581 | Bacteria | 1464 |
| 567 | Ga0501047_0484377 | 3300049581 | Unclassified | 1064 |
| 568 | Ga0501048_0034404 | 3300049582 | Bacteria | 3655 |
| 569 | Ga0501048_0127043 | 3300049582 | Bacteria | 1803 |
| 570 | Ga0501048_0163293 | 3300049582 | Unclassified | 1577 |
| 571 | Ga0501048_0420371 | 3300049582 | Bacteria | 956 |
| 572 | Ga0501067_0077169 | 3300049583 | Bacteria | 1846 |
| 573 | Ga0501068_0078727 | 3300049584 | Bacteria | 2020 |
| 574 | Ga0501069_0029376 | 3300049585 | Bacteria | 3016 |
| 575 | Ga0501069_0224883 | 3300049585 | Bacteria | 1091 |
| 576 | Ga0501070_0002759 | 3300049586 | Bacteria | 15326 |
| 577 | Ga0501070_0008780 | 3300049586 | Bacteria | 8545 |
| 578 | Ga0501070_0087816 | 3300049586 | Bacteria | 2573 |
| 579 | Ga0501070_0119058 | 3300049586 | Bacteria | 2182 |
| 580 | Ga0501070_0171930 | 3300049586 | Bacteria | 1784 |
| 581 | Ga0501070_0198571 | 3300049586 | Bacteria | 1647 |
| 582 | Ga0501071_0023874 | 3300049587 | Bacteria | 4273 |
| 583 | Ga0501073_0178582 | 3300049589 | Bacteria | 1469 |
| 584 | Ga0501073_0182827 | 3300049589 | Bacteria | 1451 |
| 585 | Ga0501074_0068958 | 3300049590 | Bacteria | 2542 |
| 586 | Ga0501074_0071152 | 3300049590 | Bacteria | 2500 |
| 587 | Ga0501075_0123637 | 3300049591 | Bacteria | 1970 |
| 588 | Ga0501075_0128050 | 3300049591 | Bacteria | 1933 |
| 589 | Ga0501076_0114009 | 3300049592 | Bacteria | 2187 |
| 590 | Ga0501076_0344339 | 3300049592 | Bacteria | 1224 |
| 591 | Ga0501077_0006238 | 3300049593 | Bacteria | 7290 |
| 592 | Ga0501077_0037633 | 3300049593 | Bacteria | 3081 |
| 593 | Ga0501077_0415267 | 3300049593 | Bacteria | 861 |
| 594 | Ga0501079_0056842 | 3300049741 | Bacteria | 3019 |
| 595 | Ga0501079_0162003 | 3300049741 | Bacteria | 1744 |
| 596 | Ga0501079_0213286 | 3300049741 | Bacteria | 1508 |
| 597 | Ga0501079_0290421 | 3300049741 | Bacteria | 1279 |
| 598 | Ga0501079_0340247 | 3300049741 | Bacteria | 1175 |
| 599 | Ga0501080_0010850 | 3300049742 | Bacteria | 8338 |
| 600 | Ga0501080_0011076 | 3300049742 | Bacteria | 8251 |
| 601 | Ga0501080_0033206 | 3300049742 | Bacteria | 4817 |
| 602 | Ga0501080_0112526 | 3300049742 | Bacteria | 2523 |
| 603 | Ga0501080_0221649 | 3300049742 | Bacteria | 1730 |
| 604 | Ga0501080_0390695 | 3300049742 | Bacteria | 1252 |
| 605 | Ga0501080_0465967 | 3300049742 | Bacteria | 1131 |
| 606 | Ga0501081_0111528 | 3300049743 | Unclassified | 1941 |
| 607 | Ga0501081_0135744 | 3300049743 | Bacteria | 1761 |
| 608 | Ga0501081_0153227 | 3300049743 | Bacteria | 1657 |
| 609 | Ga0501083_0031088 | 3300049744 | Bacteria | 3664 |
| 610 | Ga0501035_0006636 | 3300049822 | Bacteria | 10831 |
| 611 | Ga0501035_0014779 | 3300049822 | Bacteria | 7209 |
| 612 | Ga0501035_0054697 | 3300049822 | Bacteria | 3565 |
| 613 | Ga0501044_0145021 | 3300049823 | Bacteria | 2360 |
| 614 | Ga0501044_0212639 | 3300049823 | Bacteria | 1887 |
| 615 | Ga0501044_0593938 | 3300049823 | Unclassified | 1001 |
| 616 | nmdc:mga03n38_151576_c1 | 3300050490 | Bacteria | 1167 |
| 617 | nmdc:mga03n38_343496_c1 | 3300050490 | Bacteria | 811 |
| 618 | nmdc:mga00v17_22620_c1 | 3300050491 | Bacteria | 3629 |
| 619 | nmdc:mga0yw44_30618_c1 | 3300050492 | Bacteria | 3121 |
| 620 | nmdc:mga06z11_258810_c1 | 3300050494 | Bacteria | 1026 |
| 621 | nmdc:mga06z11_4530_c1 | 3300050494 | Bacteria | 5475 |
| 622 | nmdc:mga06z11_4532_c1 | 3300050494 | Bacteria | 5473 |
| 623 | nmdc:mga04h51_1364_c1 | 3300050495 | Bacteria | 5619 |
| 624 | nmdc:mga04h51_5630_c1 | 3300050495 | Bacteria | 3203 |
| 625 | nmdc:mga04h51_5885_c1 | 3300050495 | Bacteria | 3146 |
| 626 | nmdc:mga05p37_215357_c1 | 3300050507 | Bacteria | 2320 |
| 627 | nmdc:mga05p37_237562_c1 | 3300050507 | Bacteria | 2193 |
| 628 | nmdc:mga05p37_262753_c1 | 3300050507 | Bacteria | 2065 |
| 629 | nmdc:mga05p37_30390_c1 | 3300050507 | Bacteria | 6592 |
| 630 | nmdc:mga05p37_45_c2 | 3300050507 | Bacteria | 24882 |
| 631 | nmdc:mga05p37_754683_c1 | 3300050507 | Bacteria | 1072 |
| 632 | nmdc:mga09592_1055_c1 | 3300050508 | Bacteria | 21846 |
| 633 | nmdc:mga09592_155375_c1 | 3300050508 | Bacteria | 1975 |
| 634 | nmdc:mga09592_167284_c1 | 3300050508 | Bacteria | 1901 |
| 635 | nmdc:mga09592_255888_c1 | 3300050508 | Bacteria | 1518 |
| 636 | nmdc:mga09592_62062_c1 | 3300050508 | Bacteria | 3161 |
| 637 | nmdc:mga0qj67_11495_c1 | 3300050509 | Bacteria | 6634 |
| 638 | nmdc:mga0qj67_195263_c1 | 3300050509 | Bacteria | 1645 |
| 639 | nmdc:mga0qj67_263608_c1 | 3300050509 | Bacteria | 1398 |
| 640 | nmdc:mga0qj67_336435_c1 | 3300050509 | Bacteria | 1221 |
| 641 | nmdc:mga0qj67_53714_c1 | 3300050509 | Bacteria | 3190 |
| 642 | nmdc:mga0qj67_701_c1 | 3300050509 | Bacteria | 22836 |
| 643 | nmdc:mga06r32_101841_c1 | 3300050510 | Bacteria | 2819 |
| 644 | nmdc:mga06r32_12918_c1 | 3300050510 | Bacteria | 7549 |
| 645 | nmdc:mga06r32_170835_c1 | 3300050510 | Bacteria | 2158 |
| 646 | nmdc:mga06r32_227_c1 | 3300050510 | Bacteria | 45651 |
| 647 | nmdc:mga06r32_295679_c1 | 3300050510 | Bacteria | 1606 |
| 648 | nmdc:mga06r32_368433_c1 | 3300050510 | Bacteria | 1420 |
| 649 | nmdc:mga06r32_443833_c1 | 3300050510 | Bacteria | 1278 |
| 650 | nmdc:mga08y16_1134_c1 | 3300050511 | Bacteria | 26246 |
| 651 | nmdc:mga08y16_12172_c1 | 3300050511 | Bacteria | 9043 |
| 652 | nmdc:mga08y16_190186_c1 | 3300050511 | Bacteria | 2129 |
| 653 | nmdc:mga08y16_1989_c1 | 3300050511 | Bacteria | 20867 |
| 654 | nmdc:mga08y16_278261_c1 | 3300050511 | Bacteria | 1727 |
| 655 | nmdc:mga0n895_20617_c1 | 3300050512 | Bacteria | 6151 |
| 656 | nmdc:mga0n895_3165_c1 | 3300050512 | Bacteria | 13152 |
| 657 | nmdc:mga0n895_50_c1 | 3300050512 | Bacteria | 71634 |
| 658 | nmdc:mga0rr50_12507_c1 | 3300050513 | Bacteria | 5490 |
| 659 | nmdc:mga0rr50_2855_c1 | 3300050513 | Bacteria | 9829 |
| 660 | nmdc:mga0rr50_68891_c1 | 3300050513 | Bacteria | 2691 |
| 661 | nmdc:mga0a205_2228_c1 | 3300050515 | Bacteria | 17060 |
| 662 | nmdc:mga0a205_5479_c1 | 3300050515 | Bacteria | 11429 |
| 663 | nmdc:mga0a205_77964_c1 | 3300050515 | Bacteria | 3201 |
| 664 | Ga0495601_0004041 | 3300053077 | Bacteria | 8454 |
| 665 | Ga0495601_0005795 | 3300053077 | Bacteria | 7201 |
| 666 | Ga0495601_0032428 | 3300053077 | Bacteria | 3252 |
| 667 | Ga0495601_0066837 | 3300053077 | Unclassified | 2288 |
| 668 | Ga0495612_0006019 | 3300053078 | Bacteria | 4997 |
| 669 | Ga0495612_0007152 | 3300053078 | Bacteria | 4566 |
| 670 | Ga0495612_0023069 | 3300053078 | Bacteria | 2495 |
| 671 | Ga0495595_0000577 | 3300053084 | Bacteria | 14028 |
| 672 | Ga0495595_0002620 | 3300053084 | Bacteria | 7052 |
| 673 | Ga0495595_0005520 | 3300053084 | Bacteria | 5121 |
| 674 | Ga0495619_0000260 | 3300053085 | Bacteria | 38574 |
| 675 | Ga0495619_0000655 | 3300053085 | Bacteria | 22730 |
| 676 | Ga0495619_0014245 | 3300053085 | Bacteria | 5023 |
| 677 | Ga0495619_0021990 | 3300053085 | Bacteria | 4076 |
| 678 | Ga0495619_0064595 | 3300053085 | Bacteria | 2440 |
| 679 | Ga0500643_006415 | 3300053087 | Bacteria | 4918 |
| 680 | Ga0500644_0000301 | 3300053088 | Bacteria | 26471 |
| 681 | Ga0500646_0084823 | 3300053090 | Bacteria | 972 |
| 682 | Ga0500651_0032130 | 3300053093 | Bacteria | 3308 |
| 683 | Ga0500566_0008779 | 3300053094 | Bacteria | 5977 |
| 684 | Ga0500555_019795 | 3300053103 | Bacteria | 1938 |
| 685 | Ga0500595_000144 | 3300053119 | Bacteria | 46478 |
| 686 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 687 | Ga0500645_000946 | 3300053730 | Bacteria | 16529 |
| 688 | Ga0501084_0003952 | 3300054114 | Bacteria | 12073 |
| 689 | Ga0501084_0084712 | 3300054114 | Bacteria | 2661 |
| 690 | Ga0501084_0336514 | 3300054114 | Unclassified | 1275 |
| 691 | Ga0501082_0075827 | 3300060353 | Bacteria | 2897 |
| 692 | Ga0501082_0168739 | 3300060353 | Bacteria | 1902 |
| 693 | Ga0501082_0672856 | 3300060353 | Bacteria | 906 |
| 694 | Ga0501082_0955700 | 3300060353 | Bacteria | 749 |
| 695 | Ga0530510_0021687 | 3300061734 | Bacteria | 4570 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050494 | nmdc:mga06z11_258810_c1 | nmdc:mga06z11_258810_c1_230_838 | 178 |
| 2 | 3300049571 | Ga0501034_0010486 | Ga0501034_0010486_6636_7271 | 192 |
| 3 | 3300049589 | Ga0501073_0182827 | Ga0501073_0182827_268_867 | 192 |
| 4 | 3300049744 | Ga0501083_0031088 | Ga0501083_0031088_777_1412 | 192 |
| 5 | 3300050508 | nmdc:mga09592_62062_c1 | nmdc:mga09592_62062_c1_414_1013 | 192 |
| 6 | 3300060353 | Ga0501082_0955700 | Ga0501082_0955700_100_735 | 192 |
| 7 | 3300031711 | Ga0265314_10000279 | Ga0265314_1000027955 | 194 |
| 8 | 3300005341 | Ga0070691_10014449 | Ga0070691_100144493 | 195 |
| 9 | 3300005459 | Ga0068867_100701373 | Ga0068867_1007013731 | 195 |
| 10 | 3300005545 | Ga0070695_100001734 | Ga0070695_1000017342 | 195 |
| 11 | 3300006038 | Ga0075365_10077232 | Ga0075365_100772322 | 195 |
| 12 | 3300026089 | Ga0207648_10739767 | Ga0207648_107397671 | 195 |
| 13 | 3300046642 | Ga0495634_0096170 | Ga0495634_0096170_53_658 | 195 |
| 14 | 3300046664 | Ga0495659_0056880 | Ga0495659_0056880_799_1410 | 195 |
| 15 | 3300046690 | Ga0495624_0561834 | Ga0495624_0561834_16_621 | 195 |
| 16 | 3300049572 | Ga0501036_0018617 | Ga0501036_0018617_5122_5784 | 195 |
| 17 | 3300049574 | Ga0501038_0072882 | Ga0501038_0072882_423_1085 | 195 |
| 18 | 3300049580 | Ga0501046_0023608 | Ga0501046_0023608_699_1361 | 195 |
| 19 | 3300049581 | Ga0501047_0018542 | Ga0501047_0018542_1750_2412 | 195 |
| 20 | 3300049582 | Ga0501048_0163293 | Ga0501048_0163293_60_689 | 195 |
| 21 | 3300049586 | Ga0501070_0008780 | Ga0501070_0008780_7698_8360 | 195 |
| 22 | 3300049741 | Ga0501079_0213286 | Ga0501079_0213286_779_1450 | 195 |
| 23 | 3300049742 | Ga0501080_0010850 | Ga0501080_0010850_2235_2897 | 195 |
| 24 | 3300049822 | Ga0501035_0014779 | Ga0501035_0014779_2890_3552 | 195 |
| 25 | 3300053103 | Ga0500555_019795 | Ga0500555_019795_600_1229 | 195 |
| 26 | 3300054114 | Ga0501084_0336514 | Ga0501084_0336514_578_1249 | 195 |
| 27 | 3300006048 | Ga0075363_100064868 | Ga0075363_1000648683 | 196 |
| 28 | 3300049589 | Ga0501073_0178582 | Ga0501073_0178582_50_712 | 196 |
| 29 | 3300049823 | Ga0501044_0145021 | Ga0501044_0145021_116_778 | 196 |
| 30 | 3300050512 | nmdc:mga0n895_20617_c1 | nmdc:mga0n895_20617_c1_5355_6053 | 196 |
| 31 | 3300006844 | Ga0075428_100610672 | Ga0075428_1006106722 | 197 |
| 32 | 3300006871 | Ga0075434_100017596 | Ga0075434_1000175968 | 197 |
| 33 | 3300007076 | Ga0075435_100262238 | Ga0075435_1002622382 | 197 |
| 34 | 3300025916 | Ga0207663_10193802 | Ga0207663_101938022 | 197 |
| 35 | 3300039453 | Ga0436362_0112778 | Ga0436362_0112778_52_714 | 197 |
| 36 | 3300050507 | nmdc:mga05p37_30390_c1 | nmdc:mga05p37_30390_c1_1920_2621 | 197 |
| 37 | 3300050513 | nmdc:mga0rr50_12507_c1 | nmdc:mga0rr50_12507_c1_600_1301 | 197 |
| 38 | 3300050515 | nmdc:mga0a205_77964_c1 | nmdc:mga0a205_77964_c1_2445_3146 | 197 |
| 39 | 3300005289 | Ga0065704_10139579 | Ga0065704_101395792 | 198 |
| 40 | 3300005335 | Ga0070666_10184690 | Ga0070666_101846902 | 198 |
| 41 | 3300005440 | Ga0070705_100102590 | Ga0070705_1001025903 | 198 |
| 42 | 3300005536 | Ga0070697_100201328 | Ga0070697_1002013281 | 198 |
| 43 | 3300005545 | Ga0070695_100012588 | Ga0070695_1000125884 | 198 |
| 44 | 3300009553 | Ga0105249_10018811 | Ga0105249_100188116 | 198 |
| 45 | 3300014968 | Ga0157379_10228435 | Ga0157379_102284352 | 198 |
| 46 | 3300025917 | Ga0207660_10050417 | Ga0207660_100504173 | 198 |
| 47 | 3300025932 | Ga0207690_10176703 | Ga0207690_101767033 | 198 |
| 48 | 3300025933 | Ga0207706_10023602 | Ga0207706_100236023 | 198 |
| 49 | 3300025961 | Ga0207712_10313237 | Ga0207712_103132371 | 198 |
| 50 | 3300027695 | Ga0209966_1000761 | Ga0209966_10007616 | 198 |
| 51 | 3300027717 | Ga0209998_10001920 | Ga0209998_100019203 | 198 |
| 52 | 3300035089 | Ga0373944_0000522 | Ga0373944_0000522_3961_4659 | 198 |
| 53 | 3300035114 | Ga0373939_0044377 | Ga0373939_0044377_324_941 | 198 |
| 54 | 3300035121 | Ga0373960_0002095 | Ga0373960_0002095_55_753 | 198 |
| 55 | 3300035171 | Ga0373946_0070176 | Ga0373946_0070176_215_913 | 198 |
| 56 | 3300035242 | Ga0373962_0060521 | Ga0373962_0060521_53_670 | 198 |
| 57 | 3300035410 | Ga0373924_0027294 | Ga0373924_0027294_538_1236 | 198 |
| 58 | 3300035691 | Ga0373931_0001154 | Ga0373931_0001154_6882_7499 | 198 |
| 59 | 3300035724 | Ga0373933_0012736 | Ga0373933_0012736_3552_4250 | 198 |
| 60 | 3300035725 | Ga0373947_0039335 | Ga0373947_0039335_2061_2759 | 198 |
| 61 | 3300037068 | Ga0373925_0040062 | Ga0373925_0040062_2364_3062 | 198 |
| 62 | 3300039450 | Ga0436363_0770944 | Ga0436363_0770944_548_1180 | 198 |
| 63 | 3300045051 | Ga0451576_0052484 | Ga0451576_0052484_3520_4218 | 198 |
| 64 | 3300046454 | Ga0495592_0028640 | Ga0495592_0028640_82_780 | 198 |
| 65 | 3300046455 | Ga0495603_0008589 | Ga0495603_0008589_5425_6123 | 198 |
| 66 | 3300046459 | Ga0495629_0162800 | Ga0495629_0162800_408_1106 | 198 |
| 67 | 3300046461 | Ga0495641_0021653 | Ga0495641_0021653_120_818 | 198 |
| 68 | 3300046472 | Ga0495580_0021831 | Ga0495580_0021831_217_915 | 198 |
| 69 | 3300046473 | Ga0495582_0001705 | Ga0495582_0001705_8092_8790 | 198 |
| 70 | 3300046477 | Ga0495664_0001609 | Ga0495664_0001609_3658_4356 | 198 |
| 71 | 3300046492 | Ga0495585_0003281 | Ga0495585_0003281_5123_5821 | 198 |
| 72 | 3300046499 | Ga0495594_0022175 | Ga0495594_0022175_2061_2759 | 198 |
| 73 | 3300046501 | Ga0495607_0004288 | Ga0495607_0004288_9641_10339 | 198 |
| 74 | 3300046523 | Ga0495644_0000514 | Ga0495644_0000514_1206_1904 | 198 |
| 75 | 3300046526 | Ga0495666_0001847 | Ga0495666_0001847_34_732 | 198 |
| 76 | 3300046531 | Ga0495665_0026043 | Ga0495665_0026043_837_1535 | 198 |
| 77 | 3300046615 | Ga0495656_0001283 | Ga0495656_0001283_2428_3126 | 198 |
| 78 | 3300046665 | Ga0495661_0056198 | Ga0495661_0056198_598_1296 | 198 |
| 79 | 3300046674 | Ga0495588_0018157 | Ga0495588_0018157_635_1333 | 198 |
| 80 | 3300046683 | Ga0495658_0002748 | Ga0495658_0002748_7084_7782 | 198 |
| 81 | 3300046691 | Ga0495670_0009490 | Ga0495670_0009490_2090_2788 | 198 |
| 82 | 3300046692 | Ga0495671_0220449 | Ga0495671_0220449_196_894 | 198 |
| 83 | 3300047317 | Ga0495604_0243196 | Ga0495604_0243196_316_1014 | 198 |
| 84 | 3300047319 | Ga0495674_0030389 | Ga0495674_0030389_3807_4505 | 198 |
| 85 | 3300047321 | Ga0495676_0159434 | Ga0495676_0159434_63_761 | 198 |
| 86 | 3300048916 | Ga0496113_0388473 | Ga0496113_0388473_222_920 | 198 |
| 87 | 3300049569 | Ga0501032_0494396 | Ga0501032_0494396_104_748 | 198 |
| 88 | 3300049581 | Ga0501047_0295188 | Ga0501047_0295188_625_1269 | 198 |
| 89 | 3300049586 | Ga0501070_0198571 | Ga0501070_0198571_423_1067 | 198 |
| 90 | 3300049742 | Ga0501080_0465967 | Ga0501080_0465967_423_1067 | 198 |
| 91 | 3300049823 | Ga0501044_0593938 | Ga0501044_0593938_25_669 | 198 |
| 92 | 3300060353 | Ga0501082_0672856 | Ga0501082_0672856_152_796 | 198 |
| 93 | 3300005983 | Ga0081540_1029769 | Ga0081540_10297693 | 199 |
| 94 | 3300006042 | Ga0075368_10009591 | Ga0075368_100095913 | 199 |
| 95 | 3300006048 | Ga0075363_100082581 | Ga0075363_1000825811 | 199 |
| 96 | 3300006178 | Ga0075367_10126994 | Ga0075367_101269942 | 199 |
| 97 | 3300006844 | Ga0075428_100156309 | Ga0075428_1001563092 | 199 |
| 98 | 3300006846 | Ga0075430_100006793 | Ga0075430_1000067936 | 199 |
| 99 | 3300006847 | Ga0075431_100002999 | Ga0075431_10000299915 | 199 |
| 100 | 3300006847 | Ga0075431_100395587 | Ga0075431_1003955872 | 199 |
| 101 | 3300006880 | Ga0075429_100291621 | Ga0075429_1002916212 | 199 |
| 102 | 3300009147 | Ga0114129_10151517 | Ga0114129_101515173 | 199 |
| 103 | 3300009147 | Ga0114129_10743347 | Ga0114129_107433472 | 199 |
| 104 | 3300027543 | Ga0209999_1021261 | Ga0209999_10212611 | 199 |
| 105 | 3300027866 | Ga0209813_10004851 | Ga0209813_100048513 | 199 |
| 106 | 3300049570 | Ga0501033_0496149 | Ga0501033_0496149_127_780 | 199 |
| 107 | 3300049576 | Ga0501040_0127488 | Ga0501040_0127488_46_699 | 199 |
| 108 | 3300049580 | Ga0501046_0093007 | Ga0501046_0093007_1567_2220 | 199 |
| 109 | 3300049582 | Ga0501048_0127043 | Ga0501048_0127043_870_1595 | 199 |
| 110 | 3300049591 | Ga0501075_0128050 | Ga0501075_0128050_318_1043 | 199 |
| 111 | 3300049593 | Ga0501077_0006238 | Ga0501077_0006238_90_815 | 199 |
| 112 | 3300049593 | Ga0501077_0037633 | Ga0501077_0037633_464_1117 | 199 |
| 113 | 3300049742 | Ga0501080_0033206 | Ga0501080_0033206_319_1044 | 199 |
| 114 | 3300049743 | Ga0501081_0111528 | Ga0501081_0111528_924_1577 | 199 |
| 115 | 3300050490 | nmdc:mga03n38_151576_c1 | nmdc:mga03n38_151576_c1_56_736 | 199 |
| 116 | 3300050491 | nmdc:mga00v17_22620_c1 | nmdc:mga00v17_22620_c1_1216_1896 | 199 |
| 117 | 3300050492 | nmdc:mga0yw44_30618_c1 | nmdc:mga0yw44_30618_c1_2332_3012 | 199 |
| 118 | 3300050494 | nmdc:mga06z11_4530_c1 | nmdc:mga06z11_4530_c1_262_942 | 199 |
| 119 | 3300050495 | nmdc:mga04h51_5885_c1 | nmdc:mga04h51_5885_c1_624_1304 | 199 |
| 120 | 3300050507 | nmdc:mga05p37_215357_c1 | nmdc:mga05p37_215357_c1_453_1106 | 199 |
| 121 | 3300050507 | nmdc:mga05p37_754683_c1 | nmdc:mga05p37_754683_c1_317_988 | 199 |
| 122 | 3300050508 | nmdc:mga09592_167284_c1 | nmdc:mga09592_167284_c1_684_1355 | 199 |
| 123 | 3300050508 | nmdc:mga09592_255888_c1 | nmdc:mga09592_255888_c1_434_1135 | 199 |
| 124 | 3300050509 | nmdc:mga0qj67_11495_c1 | nmdc:mga0qj67_11495_c1_4346_5017 | 199 |
| 125 | 3300050509 | nmdc:mga0qj67_263608_c1 | nmdc:mga0qj67_263608_c1_391_1044 | 199 |
| 126 | 3300050510 | nmdc:mga06r32_101841_c1 | nmdc:mga06r32_101841_c1_476_1147 | 199 |
| 127 | 3300050510 | nmdc:mga06r32_12918_c1 | nmdc:mga06r32_12918_c1_6136_6789 | 199 |
| 128 | 3300050510 | nmdc:mga06r32_368433_c1 | nmdc:mga06r32_368433_c1_415_1116 | 199 |
| 129 | 3300054114 | Ga0501084_0003952 | Ga0501084_0003952_3561_4286 | 199 |
| 130 | 3300060353 | Ga0501082_0075827 | Ga0501082_0075827_574_1227 | 199 |
| 131 | 3300061734 | Ga0530510_0021687 | Ga0530510_0021687_2107_2760 | 199 |
| 132 | 3300006058 | Ga0075432_10000464 | Ga0075432_100004647 | 200 |
| 133 | 3300006178 | Ga0075367_10309065 | Ga0075367_103090652 | 200 |
| 134 | 3300006844 | Ga0075428_100016761 | Ga0075428_1000167614 | 200 |
| 135 | 3300006846 | Ga0075430_100005590 | Ga0075430_1000055904 | 200 |
| 136 | 3300006847 | Ga0075431_100004052 | Ga0075431_10000405210 | 200 |
| 137 | 3300006852 | Ga0075433_10000774 | Ga0075433_1000077416 | 200 |
| 138 | 3300006871 | Ga0075434_100005910 | Ga0075434_1000059104 | 200 |
| 139 | 3300006880 | Ga0075429_100007130 | Ga0075429_1000071304 | 200 |
| 140 | 3300009093 | Ga0105240_10412735 | Ga0105240_104127352 | 200 |
| 141 | 3300009094 | Ga0111539_10010377 | Ga0111539_100103774 | 200 |
| 142 | 3300009147 | Ga0114129_10072966 | Ga0114129_100729664 | 200 |
| 143 | 3300009174 | Ga0105241_10300667 | Ga0105241_103006672 | 200 |
| 144 | 3300012506 | Ga0157324_1000372 | Ga0157324_10003723 | 200 |
| 145 | 3300013100 | Ga0157373_10122264 | Ga0157373_101222642 | 200 |
| 146 | 3300013306 | Ga0163162_10238564 | Ga0163162_102385642 | 200 |
| 147 | 3300027682 | Ga0209971_1007895 | Ga0209971_10078953 | 200 |
| 148 | 3300027717 | Ga0209998_10005097 | Ga0209998_100050974 | 200 |
| 149 | 3300027907 | Ga0207428_10000124 | Ga0207428_1000012490 | 200 |
| 150 | 3300035120 | Ga0373957_0118942 | Ga0373957_0118942_191_889 | 200 |
| 151 | 3300036401 | Ga0373937_0019099 | Ga0373937_0019099_779_1477 | 200 |
| 152 | 3300037068 | Ga0373925_0402059 | Ga0373925_0402059_237_935 | 200 |
| 153 | 3300042001 | Ga0439441_015523 | Ga0439441_015523_602_1213 | 200 |
| 154 | 3300046454 | Ga0495592_0169115 | Ga0495592_0169115_111_809 | 200 |
| 155 | 3300046460 | Ga0495638_0041088 | Ga0495638_0041088_1875_2567 | 200 |
| 156 | 3300046463 | Ga0495653_0174008 | Ga0495653_0174008_13_711 | 200 |
| 157 | 3300046511 | Ga0495608_0088519 | Ga0495608_0088519_75_773 | 200 |
| 158 | 3300046529 | Ga0495652_0325251 | Ga0495652_0325251_344_1042 | 200 |
| 159 | 3300046559 | Ga0495667_0052769 | Ga0495667_0052769_1189_1887 | 200 |
| 160 | 3300046642 | Ga0495634_0088224 | Ga0495634_0088224_1177_1875 | 200 |
| 161 | 3300046809 | Ga0495600_0073671 | Ga0495600_0073671_747_1445 | 200 |
| 162 | 3300047315 | Ga0495581_0260995 | Ga0495581_0260995_145_843 | 200 |
| 163 | 3300047322 | Ga0495680_0047393 | Ga0495680_0047393_104_802 | 200 |
| 164 | 3300048088 | Ga0495602_0253115 | Ga0495602_0253115_293_991 | 200 |
| 165 | 3300049585 | Ga0501069_0224883 | Ga0501069_0224883_45_677 | 200 |
| 166 | 3300049586 | Ga0501070_0171930 | Ga0501070_0171930_724_1356 | 200 |
| 167 | 3300049741 | Ga0501079_0290421 | Ga0501079_0290421_51_683 | 200 |
| 168 | 3300049822 | Ga0501035_0006636 | Ga0501035_0006636_5707_6339 | 200 |
| 169 | 3300050495 | nmdc:mga04h51_5630_c1 | nmdc:mga04h51_5630_c1_2441_3100 | 200 |
| 170 | 3300050507 | nmdc:mga05p37_45_c2 | nmdc:mga05p37_45_c2_2607_3305 | 200 |
| 171 | 3300050508 | nmdc:mga09592_1055_c1 | nmdc:mga09592_1055_c1_12724_13422 | 200 |
| 172 | 3300050509 | nmdc:mga0qj67_701_c1 | nmdc:mga0qj67_701_c1_19342_20040 | 200 |
| 173 | 3300050510 | nmdc:mga06r32_227_c1 | nmdc:mga06r32_227_c1_4786_5484 | 200 |
| 174 | 3300050511 | nmdc:mga08y16_1134_c1 | nmdc:mga08y16_1134_c1_22075_22773 | 200 |
| 175 | 3300050512 | nmdc:mga0n895_50_c1 | nmdc:mga0n895_50_c1_62304_63002 | 200 |
| 176 | 3300050513 | nmdc:mga0rr50_2855_c1 | nmdc:mga0rr50_2855_c1_4182_4880 | 200 |
| 177 | 3300050515 | nmdc:mga0a205_5479_c1 | nmdc:mga0a205_5479_c1_6832_7530 | 200 |
| 178 | 3300053085 | Ga0495619_0000260 | Ga0495619_0000260_28679_29377 | 200 |
| 179 | 3300053088 | Ga0500644_0000301 | Ga0500644_0000301_24663_25355 | 200 |
| 180 | 3300053093 | Ga0500651_0032130 | Ga0500651_0032130_749_1441 | 200 |
| 181 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_423245_423937 | 200 |
| 182 | 3300005354 | Ga0070675_100280831 | Ga0070675_1002808312 | 201 |
| 183 | 3300005364 | Ga0070673_100027376 | Ga0070673_1000273766 | 201 |
| 184 | 3300005436 | Ga0070713_100538902 | Ga0070713_1005389021 | 201 |
| 185 | 3300005437 | Ga0070710_10036184 | Ga0070710_100361842 | 201 |
| 186 | 3300005439 | Ga0070711_100090906 | Ga0070711_1000909063 | 201 |
| 187 | 3300005439 | Ga0070711_100367936 | Ga0070711_1003679362 | 201 |
| 188 | 3300005440 | Ga0070705_100166578 | Ga0070705_1001665782 | 201 |
| 189 | 3300005459 | Ga0068867_100290654 | Ga0068867_1002906543 | 201 |
| 190 | 3300005530 | Ga0070679_100697948 | Ga0070679_1006979482 | 201 |
| 191 | 3300005543 | Ga0070672_100406113 | Ga0070672_1004061132 | 201 |
| 192 | 3300005546 | Ga0070696_100040533 | Ga0070696_1000405334 | 201 |
| 193 | 3300005564 | Ga0070664_100031100 | Ga0070664_1000311003 | 201 |
| 194 | 3300005614 | Ga0068856_100478856 | Ga0068856_1004788562 | 201 |
| 195 | 3300005843 | Ga0068860_100126276 | Ga0068860_1001262763 | 201 |
| 196 | 3300006028 | Ga0070717_10421408 | Ga0070717_104214081 | 201 |
| 197 | 3300006163 | Ga0070715_10063192 | Ga0070715_100631922 | 201 |
| 198 | 3300006175 | Ga0070712_100365350 | Ga0070712_1003653501 | 201 |
| 199 | 3300006237 | Ga0097621_100038380 | Ga0097621_1000383802 | 201 |
| 200 | 3300006847 | Ga0075431_100619943 | Ga0075431_1006199431 | 201 |
| 201 | 3300009147 | Ga0114129_10026350 | Ga0114129_100263506 | 201 |
| 202 | 3300025898 | Ga0207692_10196855 | Ga0207692_101968552 | 201 |
| 203 | 3300025899 | Ga0207642_10043751 | Ga0207642_100437513 | 201 |
| 204 | 3300025905 | Ga0207685_10026415 | Ga0207685_100264152 | 201 |
| 205 | 3300025906 | Ga0207699_10043874 | Ga0207699_100438744 | 201 |
| 206 | 3300025915 | Ga0207693_10009823 | Ga0207693_100098233 | 201 |
| 207 | 3300025929 | Ga0207664_10470213 | Ga0207664_104702132 | 201 |
| 208 | 3300025935 | Ga0207709_10047675 | Ga0207709_100476753 | 201 |
| 209 | 3300025937 | Ga0207669_10082800 | Ga0207669_100828003 | 201 |
| 210 | 3300025939 | Ga0207665_10103561 | Ga0207665_101035613 | 201 |
| 211 | 3300025941 | Ga0207711_10235409 | Ga0207711_102354092 | 201 |
| 212 | 3300026078 | Ga0207702_10421742 | Ga0207702_104217423 | 201 |
| 213 | 3300027876 | Ga0209974_10004757 | Ga0209974_100047576 | 201 |
| 214 | 3300027907 | Ga0207428_10040025 | Ga0207428_100400251 | 201 |
| 215 | 3300035083 | Ga0373926_0002897 | Ga0373926_0002897_3188_3886 | 201 |
| 216 | 3300035113 | Ga0373936_0013341 | Ga0373936_0013341_2330_3028 | 201 |
| 217 | 3300035113 | Ga0373936_0017209 | Ga0373936_0017209_681_1382 | 201 |
| 218 | 3300035170 | Ga0373943_0078240 | Ga0373943_0078240_837_1535 | 201 |
| 219 | 3300035692 | Ga0373935_0032811 | Ga0373935_0032811_1103_1804 | 201 |
| 220 | 3300036401 | Ga0373937_0020009 | Ga0373937_0020009_3194_3892 | 201 |
| 221 | 3300046455 | Ga0495603_0040127 | Ga0495603_0040127_1191_1892 | 201 |
| 222 | 3300046459 | Ga0495629_0061155 | Ga0495629_0061155_498_1199 | 201 |
| 223 | 3300046462 | Ga0495651_0003892 | Ga0495651_0003892_5352_6050 | 201 |
| 224 | 3300046473 | Ga0495582_0024557 | Ga0495582_0024557_2290_2991 | 201 |
| 225 | 3300046475 | Ga0495639_0047948 | Ga0495639_0047948_1065_1763 | 201 |
| 226 | 3300046476 | Ga0495662_0009334 | Ga0495662_0009334_437_1135 | 201 |
| 227 | 3300046517 | Ga0495630_0065419 | Ga0495630_0065419_1305_2003 | 201 |
| 228 | 3300046526 | Ga0495666_0016564 | Ga0495666_0016564_1448_2149 | 201 |
| 229 | 3300046529 | Ga0495652_0143441 | Ga0495652_0143441_590_1288 | 201 |
| 230 | 3300046533 | Ga0495640_0019454 | Ga0495640_0019454_952_1653 | 201 |
| 231 | 3300046533 | Ga0495640_0153691 | Ga0495640_0153691_571_1269 | 201 |
| 232 | 3300046536 | Ga0495587_0016309 | Ga0495587_0016309_2954_3652 | 201 |
| 233 | 3300046543 | Ga0495645_0312691 | Ga0495645_0312691_155_856 | 201 |
| 234 | 3300046557 | Ga0495622_0012353 | Ga0495622_0012353_2237_2935 | 201 |
| 235 | 3300046559 | Ga0495667_0002342 | Ga0495667_0002342_4946_5644 | 201 |
| 236 | 3300046663 | Ga0495635_0004379 | Ga0495635_0004379_9059_9757 | 201 |
| 237 | 3300046674 | Ga0495588_0080669 | Ga0495588_0080669_342_1043 | 201 |
| 238 | 3300046681 | Ga0495647_0004269 | Ga0495647_0004269_3550_4248 | 201 |
| 239 | 3300046689 | Ga0495613_0143415 | Ga0495613_0143415_695_1393 | 201 |
| 240 | 3300046689 | Ga0495613_0182060 | Ga0495613_0182060_431_1132 | 201 |
| 241 | 3300046690 | Ga0495624_0117309 | Ga0495624_0117309_856_1554 | 201 |
| 242 | 3300046809 | Ga0495600_0003589 | Ga0495600_0003589_1427_2125 | 201 |
| 243 | 3300047315 | Ga0495581_0005348 | Ga0495581_0005348_6185_6883 | 201 |
| 244 | 3300047319 | Ga0495674_0039235 | Ga0495674_0039235_2994_3695 | 201 |
| 245 | 3300047321 | Ga0495676_0122104 | Ga0495676_0122104_259_960 | 201 |
| 246 | 3300047322 | Ga0495680_0029672 | Ga0495680_0029672_2274_2972 | 201 |
| 247 | 3300047471 | Ga0495684_0006324 | Ga0495684_0006324_8063_8761 | 201 |
| 248 | 3300047673 | Ga0495593_0122577 | Ga0495593_0122577_75_776 | 201 |
| 249 | 3300053077 | Ga0495601_0005795 | Ga0495601_0005795_6462_7163 | 201 |
| 250 | 3300053077 | Ga0495601_0032428 | Ga0495601_0032428_588_1286 | 201 |
| 251 | 3300053078 | Ga0495612_0006019 | Ga0495612_0006019_681_1382 | 201 |
| 252 | 3300053078 | Ga0495612_0023069 | Ga0495612_0023069_1773_2471 | 201 |
| 253 | 3300053084 | Ga0495595_0002620 | Ga0495595_0002620_217_915 | 201 |
| 254 | 3300053085 | Ga0495619_0021990 | Ga0495619_0021990_2966_3667 | 201 |
| 255 | 3300053085 | Ga0495619_0064595 | Ga0495619_0064595_22_720 | 201 |
| 256 | 3300001976 | JGI24752J21851_1003948 | JGI24752J21851_10039482 | 202 |
| 257 | 3300001977 | JGI24746J21847_1000185 | JGI24746J21847_10001857 | 202 |
| 258 | 3300001978 | JGI24747J21853_1002365 | JGI24747J21853_10023652 | 202 |
| 259 | 3300001989 | JGI24739J22299_10000164 | JGI24739J22299_1000016417 | 202 |
| 260 | 3300002073 | JGI24745J21846_1000369 | JGI24745J21846_10003694 | 202 |
| 261 | 3300002076 | JGI24749J21850_1005843 | JGI24749J21850_10058433 | 202 |
| 262 | 3300002077 | JGI24744J21845_10011578 | JGI24744J21845_100115782 | 202 |
| 263 | 3300002155 | JGI24033J26618_1002322 | JGI24033J26618_10023222 | 202 |
| 264 | 3300002459 | JGI24751J29686_10011012 | JGI24751J29686_100110122 | 202 |
| 265 | 3300005293 | Ga0065715_10001682 | Ga0065715_100016822 | 202 |
| 266 | 3300005329 | Ga0070683_100000376 | Ga0070683_10000037625 | 202 |
| 267 | 3300005336 | Ga0070680_100500512 | Ga0070680_1005005122 | 202 |
| 268 | 3300005337 | Ga0070682_100000141 | Ga0070682_10000014119 | 202 |
| 269 | 3300005340 | Ga0070689_100003974 | Ga0070689_1000039746 | 202 |
| 270 | 3300005344 | Ga0070661_100000242 | Ga0070661_10000024246 | 202 |
| 271 | 3300005354 | Ga0070675_100000165 | Ga0070675_10000016535 | 202 |
| 272 | 3300005355 | Ga0070671_100001907 | Ga0070671_10000190718 | 202 |
| 273 | 3300005364 | Ga0070673_100001190 | Ga0070673_10000119011 | 202 |
| 274 | 3300005365 | Ga0070688_100002746 | Ga0070688_1000027466 | 202 |
| 275 | 3300005406 | Ga0070703_10010312 | Ga0070703_100103123 | 202 |
| 276 | 3300005445 | Ga0070708_100038832 | Ga0070708_1000388322 | 202 |
| 277 | 3300005456 | Ga0070678_100001012 | Ga0070678_1000010128 | 202 |
| 278 | 3300005466 | Ga0070685_10000547 | Ga0070685_1000054715 | 202 |
| 279 | 3300005468 | Ga0070707_101018000 | Ga0070707_1010180001 | 202 |
| 280 | 3300005543 | Ga0070672_100000527 | Ga0070672_10000052714 | 202 |
| 281 | 3300005545 | Ga0070695_100007154 | Ga0070695_1000071541 | 202 |
| 282 | 3300005547 | Ga0070693_100000199 | Ga0070693_10000019913 | 202 |
| 283 | 3300005563 | Ga0068855_100004444 | Ga0068855_1000044449 | 202 |
| 284 | 3300005564 | Ga0070664_100000895 | Ga0070664_10000089511 | 202 |
| 285 | 3300005577 | Ga0068857_100001816 | Ga0068857_10000181610 | 202 |
| 286 | 3300005578 | Ga0068854_100001666 | Ga0068854_1000016663 | 202 |
| 287 | 3300005614 | Ga0068856_100001538 | Ga0068856_1000015383 | 202 |
| 288 | 3300005615 | Ga0070702_100001415 | Ga0070702_1000014158 | 202 |
| 289 | 3300005616 | Ga0068852_100002972 | Ga0068852_10000297213 | 202 |
| 290 | 3300005618 | Ga0068864_100000227 | Ga0068864_10000022754 | 202 |
| 291 | 3300005840 | Ga0068870_10000155 | Ga0068870_100001557 | 202 |
| 292 | 3300005841 | Ga0068863_100000495 | Ga0068863_10000049532 | 202 |
| 293 | 3300005842 | Ga0068858_100000783 | Ga0068858_10000078329 | 202 |
| 294 | 3300005983 | Ga0081540_1067389 | Ga0081540_10673893 | 202 |
| 295 | 3300006237 | Ga0097621_100000010 | Ga0097621_10000001035 | 202 |
| 296 | 3300006358 | Ga0068871_100000034 | Ga0068871_10000003436 | 202 |
| 297 | 3300006852 | Ga0075433_10009145 | Ga0075433_100091453 | 202 |
| 298 | 3300006871 | Ga0075434_100001700 | Ga0075434_10000170010 | 202 |
| 299 | 3300006881 | Ga0068865_100000230 | Ga0068865_10000023022 | 202 |
| 300 | 3300007076 | Ga0075435_100018036 | Ga0075435_1000180362 | 202 |
| 301 | 3300009094 | Ga0111539_10134890 | Ga0111539_101348902 | 202 |
| 302 | 3300014326 | Ga0157380_10156672 | Ga0157380_101566721 | 202 |
| 303 | 3300017792 | Ga0163161_10000523 | Ga0163161_1000052316 | 202 |
| 304 | 3300025271 | Ga0207666_1000010 | Ga0207666_100001014 | 202 |
| 305 | 3300025290 | Ga0207673_1000265 | Ga0207673_10002653 | 202 |
| 306 | 3300025315 | Ga0207697_10000186 | Ga0207697_1000018624 | 202 |
| 307 | 3300025885 | Ga0207653_10006329 | Ga0207653_100063293 | 202 |
| 308 | 3300025893 | Ga0207682_10000123 | Ga0207682_1000012332 | 202 |
| 309 | 3300025900 | Ga0207710_10002765 | Ga0207710_100027659 | 202 |
| 310 | 3300025901 | Ga0207688_10000889 | Ga0207688_1000088910 | 202 |
| 311 | 3300025907 | Ga0207645_10000023 | Ga0207645_1000002322 | 202 |
| 312 | 3300025908 | Ga0207643_10000007 | Ga0207643_1000000713 | 202 |
| 313 | 3300025911 | Ga0207654_10006607 | Ga0207654_100066074 | 202 |
| 314 | 3300025912 | Ga0207707_10002015 | Ga0207707_100020157 | 202 |
| 315 | 3300025914 | Ga0207671_10053873 | Ga0207671_100538731 | 202 |
| 316 | 3300025917 | Ga0207660_10000393 | Ga0207660_1000039320 | 202 |
| 317 | 3300025918 | Ga0207662_10000136 | Ga0207662_1000013629 | 202 |
| 318 | 3300025920 | Ga0207649_10000434 | Ga0207649_1000043410 | 202 |
| 319 | 3300025921 | Ga0207652_10001720 | Ga0207652_1000172010 | 202 |
| 320 | 3300025923 | Ga0207681_10000273 | Ga0207681_1000027332 | 202 |
| 321 | 3300025926 | Ga0207659_10000097 | Ga0207659_1000009724 | 202 |
| 322 | 3300025927 | Ga0207687_10001031 | Ga0207687_100010317 | 202 |
| 323 | 3300025931 | Ga0207644_10005450 | Ga0207644_100054509 | 202 |
| 324 | 3300025932 | Ga0207690_10000962 | Ga0207690_1000096210 | 202 |
| 325 | 3300025933 | Ga0207706_10000867 | Ga0207706_1000086722 | 202 |
| 326 | 3300025934 | Ga0207686_10002591 | Ga0207686_1000259110 | 202 |
| 327 | 3300025935 | Ga0207709_10007329 | Ga0207709_100073291 | 202 |
| 328 | 3300025936 | Ga0207670_10000536 | Ga0207670_1000053613 | 202 |
| 329 | 3300025937 | Ga0207669_10001135 | Ga0207669_1000113513 | 202 |
| 330 | 3300025938 | Ga0207704_10000119 | Ga0207704_1000011945 | 202 |
| 331 | 3300025940 | Ga0207691_10000544 | Ga0207691_1000054414 | 202 |
| 332 | 3300025941 | Ga0207711_10002468 | Ga0207711_1000246810 | 202 |
| 333 | 3300025942 | Ga0207689_10001743 | Ga0207689_1000174310 | 202 |
| 334 | 3300025944 | Ga0207661_10000785 | Ga0207661_100007851 | 202 |
| 335 | 3300025945 | Ga0207679_10000029 | Ga0207679_10000029185 | 202 |
| 336 | 3300025949 | Ga0207667_10016422 | Ga0207667_100164229 | 202 |
| 337 | 3300025960 | Ga0207651_10000083 | Ga0207651_1000008314 | 202 |
| 338 | 3300025961 | Ga0207712_10000471 | Ga0207712_1000047110 | 202 |
| 339 | 3300025972 | Ga0207668_10000862 | Ga0207668_1000086213 | 202 |
| 340 | 3300025986 | Ga0207658_10002203 | Ga0207658_1000220310 | 202 |
| 341 | 3300026023 | Ga0207677_10000992 | Ga0207677_100009929 | 202 |
| 342 | 3300026035 | Ga0207703_10088692 | Ga0207703_100886923 | 202 |
| 343 | 3300026041 | Ga0207639_10004451 | Ga0207639_1000445110 | 202 |
| 344 | 3300026067 | Ga0207678_10001568 | Ga0207678_1000156813 | 202 |
| 345 | 3300026075 | Ga0207708_10002060 | Ga0207708_1000206014 | 202 |
| 346 | 3300026078 | Ga0207702_10003639 | Ga0207702_100036391 | 202 |
| 347 | 3300026088 | Ga0207641_10000510 | Ga0207641_1000051013 | 202 |
| 348 | 3300026089 | Ga0207648_10002351 | Ga0207648_1000235122 | 202 |
| 349 | 3300026095 | Ga0207676_10003788 | Ga0207676_100037884 | 202 |
| 350 | 3300026116 | Ga0207674_10000608 | Ga0207674_1000060814 | 202 |
| 351 | 3300026118 | Ga0207675_100000805 | Ga0207675_10000080514 | 202 |
| 352 | 3300026121 | Ga0207683_10000082 | Ga0207683_1000008252 | 202 |
| 353 | 3300026142 | Ga0207698_10000377 | Ga0207698_1000037721 | 202 |
| 354 | 3300027907 | Ga0207428_10000703 | Ga0207428_1000070335 | 202 |
| 355 | 3300028380 | Ga0268265_10001170 | Ga0268265_1000117016 | 202 |
| 356 | 3300028381 | Ga0268264_10001878 | Ga0268264_1000187814 | 202 |
| 357 | 3300034818 | Ga0373950_0042416 | Ga0373950_0042416_47_664 | 202 |
| 358 | 3300034820 | Ga0373959_0005481 | Ga0373959_0005481_1311_1928 | 202 |
| 359 | 3300034957 | Ga0373938_0000092 | Ga0373938_0000092_7504_8121 | 202 |
| 360 | 3300035085 | Ga0373929_0019904 | Ga0373929_0019904_542_1159 | 202 |
| 361 | 3300035090 | Ga0373949_0003185 | Ga0373949_0003185_2687_3304 | 202 |
| 362 | 3300035091 | Ga0373951_0005474 | Ga0373951_0005474_1930_2547 | 202 |
| 363 | 3300035092 | Ga0373952_0002122 | Ga0373952_0002122_286_903 | 202 |
| 364 | 3300035115 | Ga0373941_0000855 | Ga0373941_0000855_719_1336 | 202 |
| 365 | 3300035119 | Ga0373956_0017796 | Ga0373956_0017796_1939_2574 | 202 |
| 366 | 3300035121 | Ga0373960_0051174 | Ga0373960_0051174_288_905 | 202 |
| 367 | 3300035241 | Ga0373961_0005849 | Ga0373961_0005849_1957_2574 | 202 |
| 368 | 3300035410 | Ga0373924_0089884 | Ga0373924_0089884_471_1106 | 202 |
| 369 | 3300035691 | Ga0373931_0000186 | Ga0373931_0000186_5328_5945 | 202 |
| 370 | 3300036401 | Ga0373937_0019441 | Ga0373937_0019441_4016_4651 | 202 |
| 371 | 3300037068 | Ga0373925_0033046 | Ga0373925_0033046_867_1502 | 202 |
| 372 | 3300042012 | Ga0439455_0010858 | Ga0439455_0010858_586_1203 | 202 |
| 373 | 3300046454 | Ga0495592_0001116 | Ga0495592_0001116_5588_6223 | 202 |
| 374 | 3300046462 | Ga0495651_0006050 | Ga0495651_0006050_3163_3798 | 202 |
| 375 | 3300046516 | Ga0495628_0014402 | Ga0495628_0014402_152_787 | 202 |
| 376 | 3300046536 | Ga0495587_0020228 | Ga0495587_0020228_2774_3409 | 202 |
| 377 | 3300046543 | Ga0495645_0001781 | Ga0495645_0001781_10908_11543 | 202 |
| 378 | 3300046559 | Ga0495667_0011331 | Ga0495667_0011331_5206_5841 | 202 |
| 379 | 3300046675 | Ga0495657_0172100 | Ga0495657_0172100_348_983 | 202 |
| 380 | 3300046678 | Ga0495599_0002943 | Ga0495599_0002943_5611_6246 | 202 |
| 381 | 3300046679 | Ga0495623_0159369 | Ga0495623_0159369_378_1013 | 202 |
| 382 | 3300046809 | Ga0495600_0032196 | Ga0495600_0032196_1149_1784 | 202 |
| 383 | 3300047317 | Ga0495604_0119859 | Ga0495604_0119859_1004_1639 | 202 |
| 384 | 3300047322 | Ga0495680_0118574 | Ga0495680_0118574_734_1369 | 202 |
| 385 | 3300047444 | Ga0495675_0030741 | Ga0495675_0030741_2400_3035 | 202 |
| 386 | 3300048903 | Ga0496100_0000057 | Ga0496100_0000057_8189_8806 | 202 |
| 387 | 3300048904 | Ga0496101_0001297 | Ga0496101_0001297_9000_9617 | 202 |
| 388 | 3300048905 | Ga0496102_0001628 | Ga0496102_0001628_12804_13421 | 202 |
| 389 | 3300048906 | Ga0496103_0003173 | Ga0496103_0003173_4110_4727 | 202 |
| 390 | 3300048907 | Ga0496104_0388188 | Ga0496104_0388188_350_967 | 202 |
| 391 | 3300048909 | Ga0496106_0000518 | Ga0496106_0000518_5328_5945 | 202 |
| 392 | 3300048910 | Ga0496107_0001129 | Ga0496107_0001129_9000_9617 | 202 |
| 393 | 3300048911 | Ga0496108_0004254 | Ga0496108_0004254_2644_3261 | 202 |
| 394 | 3300048912 | Ga0496109_0002432 | Ga0496109_0002432_6249_6866 | 202 |
| 395 | 3300048913 | Ga0496110_0022934 | Ga0496110_0022934_3581_4198 | 202 |
| 396 | 3300048915 | Ga0496112_0555072 | Ga0496112_0555072_288_905 | 202 |
| 397 | 3300048916 | Ga0496113_0030441 | Ga0496113_0030441_1930_2547 | 202 |
| 398 | 3300048917 | Ga0496114_0002944 | Ga0496114_0002944_6357_6974 | 202 |
| 399 | 3300048918 | Ga0496115_0002786 | Ga0496115_0002786_8610_9227 | 202 |
| 400 | 3300048918 | Ga0496115_0203225 | Ga0496115_0203225_26_727 | 202 |
| 401 | 3300050490 | nmdc:mga03n38_343496_c1 | nmdc:mga03n38_343496_c1_24_641 | 202 |
| 402 | 3300050511 | nmdc:mga08y16_12172_c1 | nmdc:mga08y16_12172_c1_8266_8883 | 202 |
| 403 | 3300050511 | nmdc:mga08y16_190186_c1 | nmdc:mga08y16_190186_c1_991_1713 | 202 |
| 404 | 3300050512 | nmdc:mga0n895_3165_c1 | nmdc:mga0n895_3165_c1_3920_4537 | 202 |
| 405 | 3300050513 | nmdc:mga0rr50_68891_c1 | nmdc:mga0rr50_68891_c1_1128_1745 | 202 |
| 406 | 3300050515 | nmdc:mga0a205_2228_c1 | nmdc:mga0a205_2228_c1_6680_7297 | 202 |
| 407 | 3300053077 | Ga0495601_0004041 | Ga0495601_0004041_6456_7091 | 202 |
| 408 | 3300053084 | Ga0495595_0000577 | Ga0495595_0000577_8012_8647 | 202 |
| 409 | 3300053085 | Ga0495619_0000655 | Ga0495619_0000655_15784_16419 | 202 |
| 410 | 3300003911 | JGI25405J52794_10058386 | JGI25405J52794_100583862 | 203 |
| 411 | 3300005434 | Ga0070709_10633969 | Ga0070709_106339691 | 203 |
| 412 | 3300005436 | Ga0070713_100010515 | Ga0070713_1000105156 | 203 |
| 413 | 3300005437 | Ga0070710_10013868 | Ga0070710_100138683 | 203 |
| 414 | 3300005937 | Ga0081455_10169393 | Ga0081455_101693932 | 203 |
| 415 | 3300006028 | Ga0070717_10440499 | Ga0070717_104404991 | 203 |
| 416 | 3300006175 | Ga0070712_100849664 | Ga0070712_1008496641 | 203 |
| 417 | 3300025915 | Ga0207693_10062939 | Ga0207693_100629391 | 203 |
| 418 | 3300025916 | Ga0207663_10059523 | Ga0207663_100595231 | 203 |
| 419 | 3300025928 | Ga0207700_10019506 | Ga0207700_100195066 | 203 |
| 420 | 3300031241 | Ga0265325_10026904 | Ga0265325_100269041 | 203 |
| 421 | 3300031249 | Ga0265339_10002938 | Ga0265339_100029387 | 203 |
| 422 | 3300031595 | Ga0265313_10005622 | Ga0265313_100056224 | 203 |
| 423 | 3300048907 | Ga0496104_0000932 | Ga0496104_0000932_23345_24112 | 203 |
| 424 | 3300048908 | Ga0496105_0019215 | Ga0496105_0019215_722_1489 | 203 |
| 425 | 3300048911 | Ga0496108_0021395 | Ga0496108_0021395_2877_3644 | 203 |
| 426 | 3300048912 | Ga0496109_0003961 | Ga0496109_0003961_1132_1899 | 203 |
| 427 | 3300048913 | Ga0496110_0001450 | Ga0496110_0001450_12080_12847 | 203 |
| 428 | 3300048914 | Ga0496111_0018065 | Ga0496111_0018065_1496_2263 | 203 |
| 429 | 3300048915 | Ga0496112_0105119 | Ga0496112_0105119_1448_2215 | 203 |
| 430 | 3300048916 | Ga0496113_0016626 | Ga0496113_0016626_1854_2621 | 203 |
| 431 | 3300049573 | Ga0501037_0072595 | Ga0501037_0072595_609_1277 | 203 |
| 432 | 3300049579 | Ga0501043_0008265 | Ga0501043_0008265_5677_6345 | 203 |
| 433 | 3300049581 | Ga0501047_0484377 | Ga0501047_0484377_67_735 | 203 |
| 434 | 3300049582 | Ga0501048_0034404 | Ga0501048_0034404_240_908 | 203 |
| 435 | 3300049583 | Ga0501067_0077169 | Ga0501067_0077169_365_1033 | 203 |
| 436 | 3300049584 | Ga0501068_0078727 | Ga0501068_0078727_113_781 | 203 |
| 437 | 3300049586 | Ga0501070_0087816 | Ga0501070_0087816_958_1626 | 203 |
| 438 | 3300049587 | Ga0501071_0023874 | Ga0501071_0023874_620_1288 | 203 |
| 439 | 3300049590 | Ga0501074_0071152 | Ga0501074_0071152_51_719 | 203 |
| 440 | 3300049592 | Ga0501076_0344339 | Ga0501076_0344339_385_1053 | 203 |
| 441 | 3300049741 | Ga0501079_0056842 | Ga0501079_0056842_909_1577 | 203 |
| 442 | 3300049742 | Ga0501080_0221649 | Ga0501080_0221649_873_1541 | 203 |
| 443 | 3300049743 | Ga0501081_0135744 | Ga0501081_0135744_574_1242 | 203 |
| 444 | 3300049822 | Ga0501035_0054697 | Ga0501035_0054697_667_1335 | 203 |
| 445 | 3300006844 | Ga0075428_100507572 | Ga0075428_1005075722 | 204 |
| 446 | 3300006847 | Ga0075431_100260622 | Ga0075431_1002606222 | 204 |
| 447 | 3300006880 | Ga0075429_100208466 | Ga0075429_1002084661 | 204 |
| 448 | 3300050508 | nmdc:mga09592_155375_c1 | nmdc:mga09592_155375_c1_143_847 | 204 |
| 449 | 3300050509 | nmdc:mga0qj67_53714_c1 | nmdc:mga0qj67_53714_c1_926_1630 | 204 |
| 450 | 3300050510 | nmdc:mga06r32_443833_c1 | nmdc:mga06r32_443833_c1_12_716 | 204 |
| 451 | 3300005328 | Ga0070676_10136131 | Ga0070676_101361313 | 205 |
| 452 | 3300005336 | Ga0070680_100172825 | Ga0070680_1001728253 | 205 |
| 453 | 3300005338 | Ga0068868_100379489 | Ga0068868_1003794892 | 205 |
| 454 | 3300005339 | Ga0070660_100100076 | Ga0070660_1001000763 | 205 |
| 455 | 3300005356 | Ga0070674_100142637 | Ga0070674_1001426373 | 205 |
| 456 | 3300005455 | Ga0070663_100130562 | Ga0070663_1001305622 | 205 |
| 457 | 3300005457 | Ga0070662_100235133 | Ga0070662_1002351332 | 205 |
| 458 | 3300005547 | Ga0070693_100013889 | Ga0070693_1000138893 | 205 |
| 459 | 3300005615 | Ga0070702_100700950 | Ga0070702_1007009501 | 205 |
| 460 | 3300005844 | Ga0068862_100313808 | Ga0068862_1003138081 | 205 |
| 461 | 3300005937 | Ga0081455_10006948 | Ga0081455_100069486 | 205 |
| 462 | 3300006881 | Ga0068865_100460130 | Ga0068865_1004601302 | 205 |
| 463 | 3300009094 | Ga0111539_10361669 | Ga0111539_103616691 | 205 |
| 464 | 3300009551 | Ga0105238_10287562 | Ga0105238_102875622 | 205 |
| 465 | 3300009553 | Ga0105249_10080288 | Ga0105249_100802883 | 205 |
| 466 | 3300010375 | Ga0105239_10074122 | Ga0105239_100741222 | 205 |
| 467 | 3300021388 | Ga0213875_10000567 | Ga0213875_1000056730 | 205 |
| 468 | 3300025907 | Ga0207645_10141903 | Ga0207645_101419033 | 205 |
| 469 | 3300025911 | Ga0207654_10059928 | Ga0207654_100599283 | 205 |
| 470 | 3300025914 | Ga0207671_10317139 | Ga0207671_103171392 | 205 |
| 471 | 3300025917 | Ga0207660_10136260 | Ga0207660_101362603 | 205 |
| 472 | 3300025919 | Ga0207657_10035478 | Ga0207657_100354785 | 205 |
| 473 | 3300025921 | Ga0207652_10065502 | Ga0207652_100655023 | 205 |
| 474 | 3300025933 | Ga0207706_10271666 | Ga0207706_102716661 | 205 |
| 475 | 3300025934 | Ga0207686_10020419 | Ga0207686_100204194 | 205 |
| 476 | 3300028380 | Ga0268265_10335815 | Ga0268265_103358151 | 205 |
| 477 | 3300028381 | Ga0268264_10646488 | Ga0268264_106464881 | 205 |
| 478 | 3300035086 | Ga0373934_0014603 | Ga0373934_0014603_2220_2855 | 205 |
| 479 | 3300035111 | Ga0373923_0012499 | Ga0373923_0012499_267_902 | 205 |
| 480 | 3300035112 | Ga0373932_0076146 | Ga0373932_0076146_34_669 | 205 |
| 481 | 3300035119 | Ga0373956_0003018 | Ga0373956_0003018_820_1455 | 205 |
| 482 | 3300035172 | Ga0373955_0006189 | Ga0373955_0006189_4637_5272 | 205 |
| 483 | 3300035241 | Ga0373961_0079517 | Ga0373961_0079517_197_898 | 205 |
| 484 | 3300035242 | Ga0373962_0054149 | Ga0373962_0054149_442_1077 | 205 |
| 485 | 3300035691 | Ga0373931_0032737 | Ga0373931_0032737_52_753 | 205 |
| 486 | 3300035724 | Ga0373933_0004423 | Ga0373933_0004423_6282_6917 | 205 |
| 487 | 3300036401 | Ga0373937_0011291 | Ga0373937_0011291_5191_5826 | 205 |
| 488 | 3300037068 | Ga0373925_0334949 | Ga0373925_0334949_543_1178 | 205 |
| 489 | 3300037853 | Ga0436364_0045028 | Ga0436364_0045028_7063_7725 | 205 |
| 490 | 3300046454 | Ga0495592_0008124 | Ga0495592_0008124_1923_2558 | 205 |
| 491 | 3300046462 | Ga0495651_0000493 | Ga0495651_0000493_29480_30115 | 205 |
| 492 | 3300046463 | Ga0495653_0004657 | Ga0495653_0004657_10238_10873 | 205 |
| 493 | 3300046514 | Ga0495618_0015490 | Ga0495618_0015490_3011_3646 | 205 |
| 494 | 3300046516 | Ga0495628_0002046 | Ga0495628_0002046_10238_10873 | 205 |
| 495 | 3300046517 | Ga0495630_0036431 | Ga0495630_0036431_2339_2974 | 205 |
| 496 | 3300046529 | Ga0495652_0011016 | Ga0495652_0011016_2363_2998 | 205 |
| 497 | 3300046533 | Ga0495640_0036686 | Ga0495640_0036686_2123_2758 | 205 |
| 498 | 3300046536 | Ga0495587_0016489 | Ga0495587_0016489_3591_4226 | 205 |
| 499 | 3300046543 | Ga0495645_0009419 | Ga0495645_0009419_5471_6106 | 205 |
| 500 | 3300046557 | Ga0495622_0148178 | Ga0495622_0148178_184_819 | 205 |
| 501 | 3300046559 | Ga0495667_0037159 | Ga0495667_0037159_1039_1674 | 205 |
| 502 | 3300046642 | Ga0495634_0063424 | Ga0495634_0063424_1476_2111 | 205 |
| 503 | 3300046663 | Ga0495635_0000736 | Ga0495635_0000736_11313_11948 | 205 |
| 504 | 3300046675 | Ga0495657_0007642 | Ga0495657_0007642_3244_3879 | 205 |
| 505 | 3300046678 | Ga0495599_0002064 | Ga0495599_0002064_5196_5831 | 205 |
| 506 | 3300046679 | Ga0495623_0002286 | Ga0495623_0002286_5661_6296 | 205 |
| 507 | 3300046680 | Ga0495646_0000229 | Ga0495646_0000229_2272_2907 | 205 |
| 508 | 3300046681 | Ga0495647_0185620 | Ga0495647_0185620_44_679 | 205 |
| 509 | 3300046690 | Ga0495624_0234738 | Ga0495624_0234738_446_1081 | 205 |
| 510 | 3300046809 | Ga0495600_0121281 | Ga0495600_0121281_688_1323 | 205 |
| 511 | 3300047317 | Ga0495604_0009381 | Ga0495604_0009381_3515_4150 | 205 |
| 512 | 3300047319 | Ga0495674_0013071 | Ga0495674_0013071_1427_2062 | 205 |
| 513 | 3300047322 | Ga0495680_0005567 | Ga0495680_0005567_3141_3776 | 205 |
| 514 | 3300047444 | Ga0495675_0013037 | Ga0495675_0013037_2455_3090 | 205 |
| 515 | 3300047471 | Ga0495684_0139589 | Ga0495684_0139589_409_1044 | 205 |
| 516 | 3300048088 | Ga0495602_0006950 | Ga0495602_0006950_9501_10136 | 205 |
| 517 | 3300048904 | Ga0496101_0097328 | Ga0496101_0097328_1193_1828 | 205 |
| 518 | 3300048905 | Ga0496102_0018224 | Ga0496102_0018224_3320_3955 | 205 |
| 519 | 3300048906 | Ga0496103_0011059 | Ga0496103_0011059_3394_4029 | 205 |
| 520 | 3300048907 | Ga0496104_0041108 | Ga0496104_0041108_243_878 | 205 |
| 521 | 3300048908 | Ga0496105_0021279 | Ga0496105_0021279_3559_4194 | 205 |
| 522 | 3300048910 | Ga0496107_0005941 | Ga0496107_0005941_4106_4807 | 205 |
| 523 | 3300048911 | Ga0496108_0051769 | Ga0496108_0051769_631_1266 | 205 |
| 524 | 3300048915 | Ga0496112_0254183 | Ga0496112_0254183_892_1527 | 205 |
| 525 | 3300048917 | Ga0496114_0355728 | Ga0496114_0355728_290_925 | 205 |
| 526 | 3300048918 | Ga0496115_0014635 | Ga0496115_0014635_4009_4710 | 205 |
| 527 | 3300048918 | Ga0496115_0032489 | Ga0496115_0032489_1743_2378 | 205 |
| 528 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_187147_187788 | 205 |
| 529 | 3300053077 | Ga0495601_0066837 | Ga0495601_0066837_733_1368 | 205 |
| 530 | 3300053078 | Ga0495612_0007152 | Ga0495612_0007152_2009_2644 | 205 |
| 531 | 3300053084 | Ga0495595_0005520 | Ga0495595_0005520_1927_2562 | 205 |
| 532 | 3300053085 | Ga0495619_0014245 | Ga0495619_0014245_2561_3196 | 205 |
| 533 | 3300006353 | Ga0075370_10099418 | Ga0075370_100994183 | 206 |
| 534 | 3300009147 | Ga0114129_10124834 | Ga0114129_101248343 | 206 |
| 535 | 3300046660 | Ga0495625_0193799 | Ga0495625_0193799_273_1031 | 206 |
| 536 | 3300049585 | Ga0501069_0029376 | Ga0501069_0029376_36_704 | 206 |
| 537 | 3300049586 | Ga0501070_0002759 | Ga0501070_0002759_11392_12060 | 206 |
| 538 | 3300049741 | Ga0501079_0340247 | Ga0501079_0340247_376_1101 | 206 |
| 539 | 3300050507 | nmdc:mga05p37_262753_c1 | nmdc:mga05p37_262753_c1_943_1842 | 206 |
| 540 | 3300009147 | Ga0114129_10646036 | Ga0114129_106460361 | 207 |
| 541 | 3300006844 | Ga0075428_100410294 | Ga0075428_1004102942 | 208 |
| 542 | 3300006846 | Ga0075430_100074585 | Ga0075430_1000745855 | 208 |
| 543 | 3300006846 | Ga0075430_100092819 | Ga0075430_1000928192 | 208 |
| 544 | 3300006846 | Ga0075430_100281040 | Ga0075430_1002810401 | 208 |
| 545 | 3300006847 | Ga0075431_100171407 | Ga0075431_1001714072 | 208 |
| 546 | 3300009147 | Ga0114129_10970007 | Ga0114129_109700071 | 208 |
| 547 | 3300009553 | Ga0105249_11226388 | Ga0105249_112263882 | 208 |
| 548 | 3300026078 | Ga0207702_11047310 | Ga0207702_110473102 | 208 |
| 549 | 3300031595 | Ga0265313_10000041 | Ga0265313_1000004165 | 208 |
| 550 | 3300031711 | Ga0265314_10010302 | Ga0265314_100103029 | 208 |
| 551 | 3300035115 | Ga0373941_0003910 | Ga0373941_0003910_220_885 | 208 |
| 552 | 3300049569 | Ga0501032_0048692 | Ga0501032_0048692_1784_2449 | 208 |
| 553 | 3300049570 | Ga0501033_0055047 | Ga0501033_0055047_1783_2448 | 208 |
| 554 | 3300049571 | Ga0501034_0329514 | Ga0501034_0329514_494_1159 | 208 |
| 555 | 3300049572 | Ga0501036_0252883 | Ga0501036_0252883_247_915 | 208 |
| 556 | 3300049572 | Ga0501036_0361312 | Ga0501036_0361312_355_1020 | 208 |
| 557 | 3300049573 | Ga0501037_0044551 | Ga0501037_0044551_571_1236 | 208 |
| 558 | 3300049574 | Ga0501038_0049211 | Ga0501038_0049211_238_903 | 208 |
| 559 | 3300049574 | Ga0501038_0090742 | Ga0501038_0090742_1368_2033 | 208 |
| 560 | 3300049574 | Ga0501038_0149411 | Ga0501038_0149411_909_1577 | 208 |
| 561 | 3300049575 | Ga0501039_0248605 | Ga0501039_0248605_564_1229 | 208 |
| 562 | 3300049579 | Ga0501043_0184985 | Ga0501043_0184985_214_879 | 208 |
| 563 | 3300049581 | Ga0501047_0213511 | Ga0501047_0213511_43_708 | 208 |
| 564 | 3300049586 | Ga0501070_0119058 | Ga0501070_0119058_1286_1951 | 208 |
| 565 | 3300049590 | Ga0501074_0068958 | Ga0501074_0068958_1722_2387 | 208 |
| 566 | 3300049593 | Ga0501077_0415267 | Ga0501077_0415267_41_709 | 208 |
| 567 | 3300049741 | Ga0501079_0162003 | Ga0501079_0162003_90_755 | 208 |
| 568 | 3300049742 | Ga0501080_0011076 | Ga0501080_0011076_1722_2387 | 208 |
| 569 | 3300049742 | Ga0501080_0112526 | Ga0501080_0112526_70_738 | 208 |
| 570 | 3300049742 | Ga0501080_0390695 | Ga0501080_0390695_241_909 | 208 |
| 571 | 3300049823 | Ga0501044_0212639 | Ga0501044_0212639_285_950 | 208 |
| 572 | 3300050507 | nmdc:mga05p37_237562_c1 | nmdc:mga05p37_237562_c1_603_1313 | 208 |
| 573 | 3300050511 | nmdc:mga08y16_278261_c1 | nmdc:mga08y16_278261_c1_80_790 | 208 |
| 574 | 3300053730 | Ga0500645_000946 | Ga0500645_000946_3421_4104 | 208 |
| 575 | 3300060353 | Ga0501082_0168739 | Ga0501082_0168739_456_1124 | 208 |
| 576 | 3300005347 | Ga0070668_100192735 | Ga0070668_1001927352 | 209 |
| 577 | 3300005439 | Ga0070711_100282896 | Ga0070711_1002828962 | 209 |
| 578 | 3300005530 | Ga0070679_100024204 | Ga0070679_1000242043 | 209 |
| 579 | 3300005548 | Ga0070665_100374166 | Ga0070665_1003741661 | 209 |
| 580 | 3300005614 | Ga0068856_100622010 | Ga0068856_1006220102 | 209 |
| 581 | 3300005843 | Ga0068860_100312604 | Ga0068860_1003126042 | 209 |
| 582 | 3300005981 | Ga0081538_10006317 | Ga0081538_100063177 | 209 |
| 583 | 3300006042 | Ga0075368_10000202 | Ga0075368_100002028 | 209 |
| 584 | 3300006048 | Ga0075363_100015552 | Ga0075363_1000155523 | 209 |
| 585 | 3300006178 | Ga0075367_10000448 | Ga0075367_1000044813 | 209 |
| 586 | 3300006847 | Ga0075431_100010695 | Ga0075431_10001069510 | 209 |
| 587 | 3300006880 | Ga0075429_100249590 | Ga0075429_1002495902 | 209 |
| 588 | 3300009174 | Ga0105241_10052670 | Ga0105241_100526702 | 209 |
| 589 | 3300013104 | Ga0157370_10038246 | Ga0157370_100382464 | 209 |
| 590 | 3300025917 | Ga0207660_10109916 | Ga0207660_101099162 | 209 |
| 591 | 3300025921 | Ga0207652_10066943 | Ga0207652_100669433 | 209 |
| 592 | 3300026075 | Ga0207708_10163360 | Ga0207708_101633601 | 209 |
| 593 | 3300026118 | Ga0207675_100049572 | Ga0207675_1000495722 | 209 |
| 594 | 3300026142 | Ga0207698_10257026 | Ga0207698_102570261 | 209 |
| 595 | 3300028380 | Ga0268265_10322200 | Ga0268265_103222001 | 209 |
| 596 | 3300028381 | Ga0268264_10080791 | Ga0268264_100807912 | 209 |
| 597 | 3300031235 | Ga0265330_10048431 | Ga0265330_100484312 | 209 |
| 598 | 3300031238 | Ga0265332_10001311 | Ga0265332_1000131113 | 209 |
| 599 | 3300031249 | Ga0265339_10004703 | Ga0265339_100047037 | 209 |
| 600 | 3300031712 | Ga0265342_10000287 | Ga0265342_100002879 | 209 |
| 601 | 3300032002 | Ga0307416_100252012 | Ga0307416_1002520123 | 209 |
| 602 | 3300034816 | Ga0373930_0003558 | Ga0373930_0003558_954_1661 | 209 |
| 603 | 3300035692 | Ga0373935_0124844 | Ga0373935_0124844_358_1089 | 209 |
| 604 | 3300035695 | Ga0373927_0123446 | Ga0373927_0123446_427_1158 | 209 |
| 605 | 3300037068 | Ga0373925_0115602 | Ga0373925_0115602_988_1719 | 209 |
| 606 | 3300039447 | Ga0436361_0405803 | Ga0436361_0405803_157_861 | 209 |
| 607 | 3300046517 | Ga0495630_0143743 | Ga0495630_0143743_921_1652 | 209 |
| 608 | 3300046533 | Ga0495640_0038267 | Ga0495640_0038267_1353_2084 | 209 |
| 609 | 3300047315 | Ga0495581_0301288 | Ga0495581_0301288_17_748 | 209 |
| 610 | 3300050494 | nmdc:mga06z11_4532_c1 | nmdc:mga06z11_4532_c1_3921_4733 | 209 |
| 611 | 3300050495 | nmdc:mga04h51_1364_c1 | nmdc:mga04h51_1364_c1_2462_3274 | 209 |
| 612 | 3300050509 | nmdc:mga0qj67_336435_c1 | nmdc:mga0qj67_336435_c1_162_1046 | 209 |
| 613 | 3300050510 | nmdc:mga06r32_170835_c1 | nmdc:mga06r32_170835_c1_849_1733 | 209 |
| 614 | iso_pu_bacteria | 2643221547 | 2643755554 | 209 |
| 615 | 3300000041 | ARcpr5oldR_c000444 | ARcpr5oldR_0004446 | 210 |
| 616 | 3300000042 | ARSoilYngRDRAFT_c00409 | ARSoilYngRDRAFT_004093 | 210 |
| 617 | 3300000043 | ARcpr5yngRDRAFT_c000424 | ARcpr5yngRDRAFT_0004246 | 210 |
| 618 | 3300000044 | ARSoilOldRDRAFT_c000395 | ARSoilOldRDRAFT_0003953 | 210 |
| 619 | 3300000045 | ARCol0oldRDRAFT_c01154 | ARCol0oldRDRAFT_011542 | 210 |
| 620 | 3300000652 | ARCol0yngRDRAFT_1000418 | ARCol0yngRDRAFT_10004186 | 210 |
| 621 | 3300005290 | Ga0065712_10105365 | Ga0065712_101053653 | 210 |
| 622 | 3300005293 | Ga0065715_10121240 | Ga0065715_101212403 | 210 |
| 623 | 3300005329 | Ga0070683_100022026 | Ga0070683_1000220264 | 210 |
| 624 | 3300005455 | Ga0070663_100012645 | Ga0070663_1000126453 | 210 |
| 625 | 3300005459 | Ga0068867_100050314 | Ga0068867_1000503143 | 210 |
| 626 | 3300005530 | Ga0070679_100641681 | Ga0070679_1006416811 | 210 |
| 627 | 3300005535 | Ga0070684_100382482 | Ga0070684_1003824822 | 210 |
| 628 | 3300005564 | Ga0070664_100006659 | Ga0070664_1000066597 | 210 |
| 629 | 3300005842 | Ga0068858_100286720 | Ga0068858_1002867201 | 210 |
| 630 | 3300005843 | Ga0068860_100022860 | Ga0068860_1000228604 | 210 |
| 631 | 3300006058 | Ga0075432_10058773 | Ga0075432_100587731 | 210 |
| 632 | 3300006846 | Ga0075430_100178157 | Ga0075430_1001781571 | 210 |
| 633 | 3300006847 | Ga0075431_100252069 | Ga0075431_1002520691 | 210 |
| 634 | 3300007788 | Ga0099795_10020516 | Ga0099795_100205161 | 210 |
| 635 | 3300009094 | Ga0111539_10000932 | Ga0111539_100009329 | 210 |
| 636 | 3300009147 | Ga0114129_10097472 | Ga0114129_100974724 | 210 |
| 637 | 3300010159 | Ga0099796_10075690 | Ga0099796_100756901 | 210 |
| 638 | 3300010375 | Ga0105239_10528203 | Ga0105239_105282032 | 210 |
| 639 | 3300012513 | Ga0157326_1001336 | Ga0157326_10013363 | 210 |
| 640 | 3300012515 | Ga0157338_1004402 | Ga0157338_10044023 | 210 |
| 641 | 3300013104 | Ga0157370_10501211 | Ga0157370_105012111 | 210 |
| 642 | 3300013307 | Ga0157372_10085368 | Ga0157372_100853684 | 210 |
| 643 | 3300014326 | Ga0157380_10031602 | Ga0157380_100316024 | 210 |
| 644 | 3300025315 | Ga0207697_10003939 | Ga0207697_100039398 | 210 |
| 645 | 3300025906 | Ga0207699_10003769 | Ga0207699_100037694 | 210 |
| 646 | 3300025912 | Ga0207707_10454637 | Ga0207707_104546372 | 210 |
| 647 | 3300025916 | Ga0207663_10243886 | Ga0207663_102438862 | 210 |
| 648 | 3300025937 | Ga0207669_10094150 | Ga0207669_100941503 | 210 |
| 649 | 3300025944 | Ga0207661_10080161 | Ga0207661_100801613 | 210 |
| 650 | 3300026118 | Ga0207675_100172777 | Ga0207675_1001727772 | 210 |
| 651 | 3300027907 | Ga0207428_10000420 | Ga0207428_1000042038 | 210 |
| 652 | 3300028381 | Ga0268264_10196448 | Ga0268264_101964482 | 210 |
| 653 | 3300031241 | Ga0265325_10000105 | Ga0265325_1000010549 | 210 |
| 654 | 3300031241 | Ga0265325_10007640 | Ga0265325_100076404 | 210 |
| 655 | 3300031247 | Ga0265340_10069909 | Ga0265340_100699093 | 210 |
| 656 | 3300031344 | Ga0265316_10133683 | Ga0265316_101336833 | 210 |
| 657 | 3300031595 | Ga0265313_10014009 | Ga0265313_100140095 | 210 |
| 658 | 3300034816 | Ga0373930_0000557 | Ga0373930_0000557_469_1164 | 210 |
| 659 | 3300034819 | Ga0373958_0001091 | Ga0373958_0001091_222_917 | 210 |
| 660 | 3300034820 | Ga0373959_0001344 | Ga0373959_0001344_557_1252 | 210 |
| 661 | 3300034957 | Ga0373938_0004552 | Ga0373938_0004552_49_744 | 210 |
| 662 | 3300035084 | Ga0373928_0000404 | Ga0373928_0000404_3469_4164 | 210 |
| 663 | 3300035085 | Ga0373929_0000856 | Ga0373929_0000856_5123_5818 | 210 |
| 664 | 3300035088 | Ga0373940_0000069 | Ga0373940_0000069_10840_11535 | 210 |
| 665 | 3300035090 | Ga0373949_0002201 | Ga0373949_0002201_3727_4422 | 210 |
| 666 | 3300035092 | Ga0373952_0001123 | Ga0373952_0001123_184_879 | 210 |
| 667 | 3300035111 | Ga0373923_0000908 | Ga0373923_0000908_3768_4466 | 210 |
| 668 | 3300035112 | Ga0373932_0000510 | Ga0373932_0000510_5388_6083 | 210 |
| 669 | 3300035114 | Ga0373939_0002803 | Ga0373939_0002803_709_1404 | 210 |
| 670 | 3300035115 | Ga0373941_0002011 | Ga0373941_0002011_848_1543 | 210 |
| 671 | 3300035116 | Ga0373945_0000687 | Ga0373945_0000687_7176_7874 | 210 |
| 672 | 3300035170 | Ga0373943_0094844 | Ga0373943_0094844_83_805 | 210 |
| 673 | 3300035207 | Ga0373942_0001103 | Ga0373942_0001103_3544_4239 | 210 |
| 674 | 3300035241 | Ga0373961_0000636 | Ga0373961_0000636_575_1270 | 210 |
| 675 | 3300035691 | Ga0373931_0003707 | Ga0373931_0003707_6032_6727 | 210 |
| 676 | 3300035695 | Ga0373927_0006188 | Ga0373927_0006188_1166_1888 | 210 |
| 677 | 3300036401 | Ga0373937_0062979 | Ga0373937_0062979_859_1545 | 210 |
| 678 | 3300038996 | Ga0242420_004233 | Ga0242420_004233_674_1369 | 210 |
| 679 | 3300042876 | Ga0451577_0048381 | Ga0451577_0048381_627_1322 | 210 |
| 680 | 3300046461 | Ga0495641_0110662 | Ga0495641_0110662_45_743 | 210 |
| 681 | 3300046678 | Ga0495599_0003364 | Ga0495599_0003364_5692_6390 | 210 |
| 682 | 3300046680 | Ga0495646_0006372 | Ga0495646_0006372_852_1550 | 210 |
| 683 | 3300048910 | Ga0496107_0116749 | Ga0496107_0116749_707_1402 | 210 |
| 684 | 3300048910 | Ga0496107_0255663 | Ga0496107_0255663_433_1140 | 210 |
| 685 | 3300049582 | Ga0501048_0420371 | Ga0501048_0420371_166_822 | 210 |
| 686 | 3300049591 | Ga0501075_0123637 | Ga0501075_0123637_1057_1713 | 210 |
| 687 | 3300049592 | Ga0501076_0114009 | Ga0501076_0114009_1484_2140 | 210 |
| 688 | 3300049743 | Ga0501081_0153227 | Ga0501081_0153227_181_837 | 210 |
| 689 | 3300050509 | nmdc:mga0qj67_195263_c1 | nmdc:mga0qj67_195263_c1_82_750 | 210 |
| 690 | 3300050510 | nmdc:mga06r32_295679_c1 | nmdc:mga06r32_295679_c1_846_1514 | 210 |
| 691 | 3300050511 | nmdc:mga08y16_1989_c1 | nmdc:mga08y16_1989_c1_17232_17927 | 210 |
| 692 | 3300053087 | Ga0500643_006415 | Ga0500643_006415_3829_4521 | 210 |
| 693 | 3300053090 | Ga0500646_0084823 | Ga0500646_0084823_231_911 | 210 |
| 694 | 3300053094 | Ga0500566_0008779 | Ga0500566_0008779_1146_1838 | 210 |
| 695 | 3300053119 | Ga0500595_000144 | Ga0500595_000144_32397_33089 | 210 |
| 696 | 3300054114 | Ga0501084_0084712 | Ga0501084_0084712_1094_1750 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6azh-assembly1.cif.gz_B | clostridium perfringens putative fatty acid metabolism regulator | 0.8216 | 24 | 203 |
| 3whc-assembly2.cif.gz_D | crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa | 0.8148 | 22 | 205 |
| 5gpa-assembly1.cif.gz_A | structural analysis of fatty acid degradation regulator fadr from bacillus halodurans | 0.8104 | 22 | 208 |
| 5gpa-assembly1.cif.gz_B | structural analysis of fatty acid degradation regulator fadr from bacillus halodurans | 0.8053 | 25 | 210 |
| 4x1e-assembly1.cif.gz_B | crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant | 0.8024 | 24 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5gp9B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9264 | 25 | 63 | 1.10.10.60 |
| 5gpaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9239 | 25 | 63 | 1.10.10.60 |
| 6azhB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.917 | 24 | 66 | 1.10.10.60 |
| 3whcD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9165 | 25 | 63 | 1.10.10.60 |
| 3whcC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9118 | 27 | 63 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7TPG1-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9532 | 14 | 210 |
GO:0000976
GO:0003700 |
| AF-A0A327L488-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9466 | 14 | 210 |
GO:0000976
GO:0003700 |
| AF-A0A6L5FGY3-F1-model_v4 | TetR family transcriptional regulator | 0.9459 | 22 | 210 |
GO:0000976
GO:0003700 |
| AF-A0A127EWI0-F1-model_v4 | Transcriptional regulator, TetR family | 0.9379 | 11 | 210 |
GO:0000976
GO:0003700 |
| AF-A0A371BD66-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9367 | 15 | 208 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar