F475841

General Info

Members Datasets Scaffolds Average Seq Length
696 365 695 211

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10048431|Ga0265330_100484312
Length 246
Sequence MPDRTPQSLSIAQRMRSLHKAASGVENASPAKFVPAKTKARRKPGPRGPRKEKSAARRDAILAAALAEFAERGFEAARLDDVARRANVAKGTIYLYFRDKQALFQELLRQMLTPIIGGIEALGAADLPVHAFVEQLVELFVREVYETPRKDVIRLMITEGRRFPKLAEFYYREVLSRIIAAVRALLSRAAARGEVPAGLVDFPQIIVAPGLLAIVWSGLFDKYEPLDVRAMMKAHVELLFAPRRAA

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
103 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
199 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
235 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.31
Nodule 0
Rhizoplane 5.32
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000444 3300000041 Bacteria 5518
2 ARSoilYngRDRAFT_c00409 3300000042 Bacteria 5538
3 ARcpr5yngRDRAFT_c000424 3300000043 Bacteria 5559
4 ARSoilOldRDRAFT_c000395 3300000044 Bacteria 5402
5 ARCol0oldRDRAFT_c01154 3300000045 Bacteria 1926
6 ARCol0yngRDRAFT_1000418 3300000652 Bacteria 5543
7 JGI24752J21851_1003948 3300001976 Bacteria 1952
8 JGI24746J21847_1000185 3300001977 Bacteria 8237
9 JGI24747J21853_1002365 3300001978 Bacteria 1531
10 JGI24739J22299_10000164 3300001989 Bacteria 21825
11 JGI24745J21846_1000369 3300002073 Bacteria 3934
12 JGI24749J21850_1005843 3300002076 Bacteria 1716
13 JGI24744J21845_10011578 3300002077 Bacteria 1802
14 JGI24033J26618_1002322 3300002155 Bacteria 1938
15 JGI24751J29686_10011012 3300002459 Unclassified 1865
16 JGI25405J52794_10058386 3300003911 Bacteria 832
17 Ga0065704_10139579 3300005289 Bacteria 1532
18 Ga0065712_10105365 3300005290 Bacteria 1941
19 Ga0065715_10001682 3300005293 Bacteria 8090
20 Ga0065715_10121240 3300005293 Bacteria 2235
21 Ga0070676_10136131 3300005328 Bacteria 1559
22 Ga0070683_100000376 3300005329 Bacteria 31004
23 Ga0070683_100022026 3300005329 Bacteria 5690
24 Ga0070666_10184690 3300005335 Bacteria 1463
25 Ga0070680_100172825 3300005336 Unclassified 1819
26 Ga0070680_100500512 3300005336 Bacteria 1040
27 Ga0070682_100000141 3300005337 Bacteria 57251
28 Ga0068868_100379489 3300005338 Bacteria 1216
29 Ga0070660_100100076 3300005339 Unclassified 2295
30 Ga0070689_100003974 3300005340 Bacteria 9929
31 Ga0070691_10014449 3300005341 Bacteria 3623
32 Ga0070661_100000242 3300005344 Bacteria 44945
33 Ga0070668_100192735 3300005347 Bacteria 1670
34 Ga0070675_100000165 3300005354 Bacteria 40656
35 Ga0070675_100280831 3300005354 Bacteria 1463
36 Ga0070671_100001907 3300005355 Bacteria 15957
37 Ga0070674_100142637 3300005356 Bacteria 1799
38 Ga0070673_100001190 3300005364 Bacteria 14967
39 Ga0070673_100027376 3300005364 Bacteria 4225
40 Ga0070688_100002746 3300005365 Bacteria 8940
41 Ga0070703_10010312 3300005406 Bacteria 2632
42 Ga0070709_10633969 3300005434 Bacteria 826
43 Ga0070713_100010515 3300005436 Bacteria 6688
44 Ga0070713_100538902 3300005436 Bacteria 1104
45 Ga0070710_10013868 3300005437 Bacteria 4046
46 Ga0070710_10036184 3300005437 Bacteria 2697
47 Ga0070711_100090906 3300005439 Bacteria 2199
48 Ga0070711_100282896 3300005439 Bacteria 1313
49 Ga0070711_100367936 3300005439 Bacteria 1159
50 Ga0070705_100102590 3300005440 Bacteria 1809
51 Ga0070705_100166578 3300005440 Bacteria 1479
52 Ga0070708_100038832 3300005445 Bacteria 4162
53 Ga0070663_100012645 3300005455 Bacteria 5348
54 Ga0070663_100130562 3300005455 Bacteria 1907
55 Ga0070678_100001012 3300005456 Bacteria 14620
56 Ga0070662_100235133 3300005457 Unclassified 1467
57 Ga0068867_100050314 3300005459 Bacteria 3070
58 Ga0068867_100290654 3300005459 Unclassified 1344
59 Ga0068867_100701373 3300005459 Bacteria 893
60 Ga0070685_10000547 3300005466 Bacteria 21062
61 Ga0070707_101018000 3300005468 Bacteria 794
62 Ga0070679_100024204 3300005530 Bacteria 5950
63 Ga0070679_100641681 3300005530 Bacteria 1005
64 Ga0070679_100697948 3300005530 Bacteria 957
65 Ga0070684_100382482 3300005535 Bacteria 1296
66 Ga0070697_100201328 3300005536 Bacteria 1693
67 Ga0070672_100000527 3300005543 Bacteria 22399
68 Ga0070672_100406113 3300005543 Bacteria 1168
69 Ga0070695_100001734 3300005545 Bacteria 12268
70 Ga0070695_100007154 3300005545 Bacteria 6616
71 Ga0070695_100012588 3300005545 Bacteria 5079
72 Ga0070696_100040533 3300005546 Bacteria 3215
73 Ga0070693_100000199 3300005547 Bacteria 28265
74 Ga0070693_100013889 3300005547 Bacteria 4113
75 Ga0070665_100374166 3300005548 Bacteria 1432
76 Ga0068855_100004444 3300005563 Bacteria 17127
77 Ga0070664_100000895 3300005564 Bacteria 23168
78 Ga0070664_100006659 3300005564 Bacteria 9319
79 Ga0070664_100031100 3300005564 Bacteria 4457
80 Ga0068857_100001816 3300005577 Bacteria 17161
81 Ga0068854_100001666 3300005578 Bacteria 13522
82 Ga0068856_100001538 3300005614 Bacteria 24179
83 Ga0068856_100478856 3300005614 Bacteria 1266
84 Ga0068856_100622010 3300005614 Bacteria 1101
85 Ga0070702_100001415 3300005615 Bacteria 9801
86 Ga0070702_100700950 3300005615 Unclassified 772
87 Ga0068852_100002972 3300005616 Bacteria 11773
88 Ga0068864_100000227 3300005618 Bacteria 50765
89 Ga0068870_10000155 3300005840 Bacteria 23940
90 Ga0068863_100000495 3300005841 Bacteria 39957
91 Ga0068858_100000783 3300005842 Bacteria 33229
92 Ga0068858_100286720 3300005842 Bacteria 1569
93 Ga0068860_100022860 3300005843 Bacteria 6046
94 Ga0068860_100126276 3300005843 Bacteria 2452
95 Ga0068860_100312604 3300005843 Bacteria 1541
96 Ga0068862_100313808 3300005844 Unclassified 1445
97 Ga0081455_10006948 3300005937 Bacteria 12035
98 Ga0081455_10169393 3300005937 Bacteria 1665
99 Ga0081538_10006317 3300005981 Bacteria 10463
100 Ga0081540_1029769 3300005983 Bacteria 3036
101 Ga0081540_1067389 3300005983 Bacteria 1673
102 Ga0070717_10421408 3300006028 Bacteria 1201
103 Ga0070717_10440499 3300006028 Bacteria 1173
104 Ga0075365_10077232 3300006038 Bacteria 2250
105 Ga0075368_10000202 3300006042 Bacteria 16522
106 Ga0075368_10009591 3300006042 Bacteria 3483
107 Ga0075363_100015552 3300006048 Bacteria 3743
108 Ga0075363_100064868 3300006048 Bacteria 1973
109 Ga0075363_100082581 3300006048 Bacteria 1759
110 Ga0075432_10000464 3300006058 Bacteria 12026
111 Ga0075432_10058773 3300006058 Bacteria 1366
112 Ga0070715_10063192 3300006163 Bacteria 1631
113 Ga0070712_100365350 3300006175 Bacteria 1184
114 Ga0070712_100849664 3300006175 Bacteria 785
115 Ga0075367_10000448 3300006178 Bacteria 15330
116 Ga0075367_10126994 3300006178 Bacteria 1574
117 Ga0075367_10309065 3300006178 Bacteria 996
118 Ga0097621_100000010 3300006237 Bacteria 112867
119 Ga0097621_100038380 3300006237 Bacteria 3843
120 Ga0075370_10099418 3300006353 Bacteria 1683
121 Ga0068871_100000034 3300006358 Bacteria 71462
122 Ga0075428_100016761 3300006844 Bacteria 8090
123 Ga0075428_100156309 3300006844 Bacteria 2477
124 Ga0075428_100410294 3300006844 Bacteria 1451
125 Ga0075428_100507572 3300006844 Bacteria 1290
126 Ga0075428_100610672 3300006844 Bacteria 1164
127 Ga0075430_100005590 3300006846 Bacteria 10623
128 Ga0075430_100006793 3300006846 Bacteria 9642
129 Ga0075430_100074585 3300006846 Bacteria 2844
130 Ga0075430_100092819 3300006846 Bacteria 2523
131 Ga0075430_100178157 3300006846 Bacteria 1768
132 Ga0075430_100281040 3300006846 Bacteria 1377
133 Ga0075431_100002999 3300006847 Bacteria 16342
134 Ga0075431_100004052 3300006847 Bacteria 14278
135 Ga0075431_100010695 3300006847 Bacteria 9221
136 Ga0075431_100171407 3300006847 Bacteria 2229
137 Ga0075431_100252069 3300006847 Bacteria 1793
138 Ga0075431_100260622 3300006847 Bacteria 1759
139 Ga0075431_100395587 3300006847 Bacteria 1384
140 Ga0075431_100619943 3300006847 Bacteria 1064
141 Ga0075433_10000774 3300006852 Bacteria 21997
142 Ga0075433_10009145 3300006852 Bacteria 7912
143 Ga0075434_100001700 3300006871 Bacteria 18837
144 Ga0075434_100005910 3300006871 Bacteria 11193
145 Ga0075434_100017596 3300006871 Bacteria 6890
146 Ga0075429_100007130 3300006880 Bacteria 9709
147 Ga0075429_100208466 3300006880 Bacteria 1712
148 Ga0075429_100249590 3300006880 Bacteria 1554
149 Ga0075429_100291621 3300006880 Bacteria 1428
150 Ga0068865_100000230 3300006881 Bacteria 31147
151 Ga0068865_100460130 3300006881 Unclassified 1054
152 Ga0075435_100018036 3300007076 Bacteria 5355
153 Ga0075435_100262238 3300007076 Bacteria 1472
154 Ga0099795_10020516 3300007788 Bacteria 2154
155 Ga0105240_10412735 3300009093 Unclassified 1518
156 Ga0111539_10000932 3300009094 Bacteria 38323
157 Ga0111539_10010377 3300009094 Bacteria 11726
158 Ga0111539_10134890 3300009094 Bacteria 2891
159 Ga0111539_10361669 3300009094 Bacteria 1689
160 Ga0114129_10026350 3300009147 Bacteria 8231
161 Ga0114129_10072966 3300009147 Bacteria 4783
162 Ga0114129_10097472 3300009147 Bacteria 4071
163 Ga0114129_10124834 3300009147 Bacteria 3540
164 Ga0114129_10151517 3300009147 Bacteria 3173
165 Ga0114129_10646036 3300009147 Bacteria 1366
166 Ga0114129_10743347 3300009147 Bacteria 1256
167 Ga0114129_10970007 3300009147 Bacteria 1072
168 Ga0105241_10052670 3300009174 Bacteria 3109
169 Ga0105241_10300667 3300009174 Bacteria 1377
170 Ga0105238_10287562 3300009551 Bacteria 1626
171 Ga0105249_10018811 3300009553 Bacteria 6157
172 Ga0105249_10080288 3300009553 Bacteria 3029
173 Ga0105249_11226388 3300009553 Bacteria 821
174 Ga0099796_10075690 3300010159 Unclassified 1224
175 Ga0105239_10074122 3300010375 Bacteria 3742
176 Ga0105239_10528203 3300010375 Bacteria 1343
177 Ga0157324_1000372 3300012506 Bacteria 2076
178 Ga0157326_1001336 3300012513 Bacteria 2725
179 Ga0157338_1004402 3300012515 Bacteria 1216
180 Ga0157373_10122264 3300013100 Bacteria 1829
181 Ga0157370_10038246 3300013104 Bacteria 4642
182 Ga0157370_10501211 3300013104 Bacteria 1115
183 Ga0163162_10238564 3300013306 Bacteria 1949
184 Ga0157372_10085368 3300013307 Bacteria 3580
185 Ga0157380_10031602 3300014326 Bacteria 4065
186 Ga0157380_10156672 3300014326 Bacteria 1975
187 Ga0157379_10228435 3300014968 Bacteria 1687
188 Ga0163161_10000523 3300017792 Bacteria 31363
189 Ga0213875_10000567 3300021388 Bacteria 30137
190 Ga0207666_1000010 3300025271 Bacteria 46973
191 Ga0207673_1000265 3300025290 Bacteria 5342
192 Ga0207697_10000186 3300025315 Bacteria 32405
193 Ga0207697_10003939 3300025315 Bacteria 7220
194 Ga0207653_10006329 3300025885 Bacteria 3693
195 Ga0207682_10000123 3300025893 Bacteria 34953
196 Ga0207692_10196855 3300025898 Bacteria 1182
197 Ga0207642_10043751 3300025899 Unclassified 1978
198 Ga0207710_10002765 3300025900 Bacteria 8022
199 Ga0207688_10000889 3300025901 Bacteria 15094
200 Ga0207685_10026415 3300025905 Bacteria 2019
201 Ga0207699_10003769 3300025906 Bacteria 7238
202 Ga0207699_10043874 3300025906 Bacteria 2600
203 Ga0207645_10000023 3300025907 Bacteria 98724
204 Ga0207645_10141903 3300025907 Unclassified 1566
205 Ga0207643_10000007 3300025908 Bacteria 171706
206 Ga0207654_10006607 3300025911 Bacteria 5831
207 Ga0207654_10059928 3300025911 Unclassified 2222
208 Ga0207707_10002015 3300025912 Bacteria 18441
209 Ga0207707_10454637 3300025912 Bacteria 1095
210 Ga0207671_10053873 3300025914 Bacteria 2981
211 Ga0207671_10317139 3300025914 Bacteria 1233
212 Ga0207693_10009823 3300025915 Bacteria 7788
213 Ga0207693_10062939 3300025915 Bacteria 2907
214 Ga0207663_10059523 3300025916 Bacteria 2417
215 Ga0207663_10193802 3300025916 Bacteria 1461
216 Ga0207663_10243886 3300025916 Bacteria 1319
217 Ga0207660_10000393 3300025917 Bacteria 28822
218 Ga0207660_10050417 3300025917 Bacteria 2955
219 Ga0207660_10109916 3300025917 Bacteria 2073
220 Ga0207660_10136260 3300025917 Bacteria 1874
221 Ga0207662_10000136 3300025918 Bacteria 35258
222 Ga0207657_10035478 3300025919 Bacteria 4471
223 Ga0207649_10000434 3300025920 Bacteria 30314
224 Ga0207652_10001720 3300025921 Bacteria 19098
225 Ga0207652_10065502 3300025921 Bacteria 3146
226 Ga0207652_10066943 3300025921 Bacteria 3114
227 Ga0207681_10000273 3300025923 Bacteria 38704
228 Ga0207659_10000097 3300025926 Bacteria 51545
229 Ga0207687_10001031 3300025927 Bacteria 18938
230 Ga0207700_10019506 3300025928 Bacteria 4580
231 Ga0207664_10470213 3300025929 Bacteria 1124
232 Ga0207644_10005450 3300025931 Bacteria 8289
233 Ga0207690_10000962 3300025932 Bacteria 18398
234 Ga0207690_10176703 3300025932 Bacteria 1604
235 Ga0207706_10000867 3300025933 Bacteria 31142
236 Ga0207706_10023602 3300025933 Bacteria 5522
237 Ga0207706_10271666 3300025933 Unclassified 1479
238 Ga0207686_10002591 3300025934 Bacteria 9812
239 Ga0207686_10020419 3300025934 Bacteria 3784
240 Ga0207709_10007329 3300025935 Bacteria 6150
241 Ga0207709_10047675 3300025935 Bacteria 2606
242 Ga0207670_10000536 3300025936 Bacteria 20898
243 Ga0207669_10001135 3300025937 Bacteria 11370
244 Ga0207669_10082800 3300025937 Bacteria 2061
245 Ga0207669_10094150 3300025937 Bacteria 1959
246 Ga0207704_10000119 3300025938 Bacteria 43208
247 Ga0207665_10103561 3300025939 Bacteria 1991
248 Ga0207691_10000544 3300025940 Bacteria 37754
249 Ga0207711_10002468 3300025941 Bacteria 16502
250 Ga0207711_10235409 3300025941 Bacteria 1678
251 Ga0207689_10001743 3300025942 Bacteria 20521
252 Ga0207661_10000785 3300025944 Bacteria 20682
253 Ga0207661_10080161 3300025944 Bacteria 2693
254 Ga0207679_10000029 3300025945 Bacteria 183002
255 Ga0207667_10016422 3300025949 Bacteria 8368
256 Ga0207651_10000083 3300025960 Bacteria 42310
257 Ga0207712_10000471 3300025961 Bacteria 33929
258 Ga0207712_10313237 3300025961 Bacteria 1292
259 Ga0207668_10000862 3300025972 Bacteria 18292
260 Ga0207658_10002203 3300025986 Bacteria 14473
261 Ga0207677_10000992 3300026023 Bacteria 15647
262 Ga0207703_10088692 3300026035 Bacteria 2596
263 Ga0207639_10004451 3300026041 Bacteria 9457
264 Ga0207678_10001568 3300026067 Bacteria 21015
265 Ga0207708_10002060 3300026075 Bacteria 14813
266 Ga0207708_10163360 3300026075 Bacteria 1759
267 Ga0207702_10003639 3300026078 Bacteria 13965
268 Ga0207702_10421742 3300026078 Bacteria 1290
269 Ga0207702_11047310 3300026078 Bacteria 809
270 Ga0207641_10000510 3300026088 Bacteria 43699
271 Ga0207648_10002351 3300026089 Bacteria 20407
272 Ga0207648_10739767 3300026089 Bacteria 913
273 Ga0207676_10003788 3300026095 Bacteria 10694
274 Ga0207674_10000608 3300026116 Bacteria 46971
275 Ga0207675_100000805 3300026118 Bacteria 31142
276 Ga0207675_100049572 3300026118 Bacteria 3918
277 Ga0207675_100172777 3300026118 Bacteria 2066
278 Ga0207683_10000082 3300026121 Bacteria 74842
279 Ga0207698_10000377 3300026142 Bacteria 25983
280 Ga0207698_10257026 3300026142 Bacteria 1602
281 Ga0209999_1021261 3300027543 Unclassified 1191
282 Ga0209971_1007895 3300027682 Bacteria 2525
283 Ga0209966_1000761 3300027695 Bacteria 6647
284 Ga0209998_10001920 3300027717 Bacteria 4889
285 Ga0209998_10005097 3300027717 Bacteria 2759
286 Ga0209813_10004851 3300027866 Bacteria 3233
287 Ga0209974_10004757 3300027876 Bacteria 4820
288 Ga0207428_10000124 3300027907 Bacteria 105795
289 Ga0207428_10000420 3300027907 Bacteria 52679
290 Ga0207428_10000703 3300027907 Bacteria 38851
291 Ga0207428_10040025 3300027907 Bacteria 3804
292 Ga0268265_10001170 3300028380 Bacteria 22993
293 Ga0268265_10322200 3300028380 Bacteria 1400
294 Ga0268265_10335815 3300028380 Bacteria 1374
295 Ga0268264_10001878 3300028381 Bacteria 19073
296 Ga0268264_10080791 3300028381 Bacteria 2777
297 Ga0268264_10196448 3300028381 Bacteria 1842
298 Ga0268264_10646488 3300028381 Bacteria 1046
299 Ga0265330_10048431 3300031235 Bacteria 1869
300 Ga0265332_10001311 3300031238 Bacteria 14161
301 Ga0265325_10000105 3300031241 Bacteria 59642
302 Ga0265325_10007640 3300031241 Bacteria 6463
303 Ga0265325_10026904 3300031241 Bacteria 3112
304 Ga0265340_10069909 3300031247 Bacteria 1666
305 Ga0265339_10002938 3300031249 Bacteria 12049
306 Ga0265339_10004703 3300031249 Bacteria 9264
307 Ga0265316_10133683 3300031344 Bacteria 1867
308 Ga0265313_10000041 3300031595 Bacteria 119119
309 Ga0265313_10005622 3300031595 Bacteria 9166
310 Ga0265313_10014009 3300031595 Bacteria 4774
311 Ga0265314_10000279 3300031711 Bacteria 74300
312 Ga0265314_10010302 3300031711 Bacteria 7807
313 Ga0265342_10000287 3300031712 Bacteria 57222
314 Ga0307416_100252012 3300032002 Bacteria 1719
315 Ga0373930_0000557 3300034816 Bacteria 5130
316 Ga0373930_0003558 3300034816 Bacteria 2478
317 Ga0373950_0042416 3300034818 Bacteria 874
318 Ga0373958_0001091 3300034819 Bacteria 3577
319 Ga0373959_0001344 3300034820 Bacteria 3926
320 Ga0373959_0005481 3300034820 Bacteria 2081
321 Ga0373938_0000092 3300034957 Bacteria 12211
322 Ga0373938_0004552 3300034957 Bacteria 2323
323 Ga0373926_0002897 3300035083 Bacteria 5500
324 Ga0373928_0000404 3300035084 Bacteria 8588
325 Ga0373929_0000856 3300035085 Bacteria 5927
326 Ga0373929_0019904 3300035085 Unclassified 1348
327 Ga0373934_0014603 3300035086 Bacteria 2977
328 Ga0373940_0000069 3300035088 Bacteria 11756
329 Ga0373944_0000522 3300035089 Bacteria 9004
330 Ga0373949_0002201 3300035090 Bacteria 5100
331 Ga0373949_0003185 3300035090 Bacteria 3988
332 Ga0373951_0005474 3300035091 Bacteria 2950
333 Ga0373952_0001123 3300035092 Bacteria 4891
334 Ga0373952_0002122 3300035092 Bacteria 3563
335 Ga0373923_0000908 3300035111 Bacteria 7900
336 Ga0373923_0012499 3300035111 Bacteria 3139
337 Ga0373932_0000510 3300035112 Bacteria 11939
338 Ga0373932_0076146 3300035112 Unclassified 1051
339 Ga0373936_0013341 3300035113 Bacteria 3136
340 Ga0373936_0017209 3300035113 Bacteria 2782
341 Ga0373939_0002803 3300035114 Bacteria 4090
342 Ga0373939_0044377 3300035114 Bacteria 1353
343 Ga0373941_0000855 3300035115 Bacteria 6273
344 Ga0373941_0002011 3300035115 Bacteria 4408
345 Ga0373941_0003910 3300035115 Bacteria 3413
346 Ga0373945_0000687 3300035116 Bacteria 9768
347 Ga0373956_0003018 3300035119 Bacteria 6820
348 Ga0373956_0017796 3300035119 Bacteria 3002
349 Ga0373957_0118942 3300035120 Bacteria 1068
350 Ga0373960_0002095 3300035121 Bacteria 4490
351 Ga0373960_0051174 3300035121 Bacteria 1226
352 Ga0373943_0078240 3300035170 Bacteria 1690
353 Ga0373943_0094844 3300035170 Bacteria 1551
354 Ga0373946_0070176 3300035171 Unclassified 1511
355 Ga0373955_0006189 3300035172 Bacteria 5443
356 Ga0373942_0001103 3300035207 Bacteria 7179
357 Ga0373961_0000636 3300035241 Bacteria 12674
358 Ga0373961_0005849 3300035241 Bacteria 2954
359 Ga0373961_0079517 3300035241 Unclassified 1029
360 Ga0373962_0054149 3300035242 Bacteria 1163
361 Ga0373962_0060521 3300035242 Bacteria 1111
362 Ga0373924_0027294 3300035410 Bacteria 2270
363 Ga0373924_0089884 3300035410 Bacteria 1313
364 Ga0373931_0000186 3300035691 Bacteria 26950
365 Ga0373931_0001154 3300035691 Bacteria 11223
366 Ga0373931_0003707 3300035691 Bacteria 6911
367 Ga0373931_0032737 3300035691 Bacteria 2691
368 Ga0373935_0032811 3300035692 Bacteria 3228
369 Ga0373935_0124844 3300035692 Bacteria 1723
370 Ga0373927_0006188 3300035695 Bacteria 8178
371 Ga0373927_0123446 3300035695 Bacteria 1690
372 Ga0373933_0004423 3300035724 Bacteria 7714
373 Ga0373933_0012736 3300035724 Bacteria 4650
374 Ga0373947_0039335 3300035725 Bacteria 2813
375 Ga0373937_0011291 3300036401 Bacteria 7833
376 Ga0373937_0019099 3300036401 Bacteria 6133
377 Ga0373937_0019441 3300036401 Bacteria 6080
378 Ga0373937_0020009 3300036401 Bacteria 5995
379 Ga0373937_0062979 3300036401 Bacteria 3410
380 Ga0373925_0033046 3300037068 Bacteria 3812
381 Ga0373925_0040062 3300037068 Bacteria 3467
382 Ga0373925_0115602 3300037068 Bacteria 2077
383 Ga0373925_0334949 3300037068 Unclassified 1226
384 Ga0373925_0402059 3300037068 Bacteria 1117
385 Ga0436364_0045028 3300037853 Bacteria 9121
386 Ga0242420_004233 3300038996 Bacteria 2161
387 Ga0436361_0405803 3300039447 Bacteria 1009
388 Ga0436363_0770944 3300039450 Bacteria 1322
389 Ga0436362_0112778 3300039453 Bacteria 755
390 Ga0439441_015523 3300042001 Unclassified 1348
391 Ga0439455_0010858 3300042012 Bacteria 2013
392 Ga0451577_0048381 3300042876 Bacteria 3799
393 Ga0451576_0052484 3300045051 Bacteria 4272
394 Ga0495592_0001116 3300046454 Bacteria 18677
395 Ga0495592_0008124 3300046454 Bacteria 7881
396 Ga0495592_0028640 3300046454 Bacteria 4217
397 Ga0495592_0169115 3300046454 Bacteria 1498
398 Ga0495603_0008589 3300046455 Bacteria 6173
399 Ga0495603_0040127 3300046455 Bacteria 2803
400 Ga0495629_0061155 3300046459 Bacteria 2631
401 Ga0495629_0162800 3300046459 Bacteria 1549
402 Ga0495638_0041088 3300046460 Bacteria 2928
403 Ga0495641_0021653 3300046461 Bacteria 3230
404 Ga0495641_0110662 3300046461 Bacteria 1226
405 Ga0495651_0000493 3300046462 Bacteria 30523
406 Ga0495651_0003892 3300046462 Bacteria 11420
407 Ga0495651_0006050 3300046462 Bacteria 9238
408 Ga0495653_0004657 3300046463 Bacteria 11097
409 Ga0495653_0174008 3300046463 Bacteria 1483
410 Ga0495580_0021831 3300046472 Bacteria 4721
411 Ga0495582_0001705 3300046473 Bacteria 12400
412 Ga0495582_0024557 3300046473 Bacteria 3299
413 Ga0495639_0047948 3300046475 Bacteria 1936
414 Ga0495662_0009334 3300046476 Bacteria 4811
415 Ga0495664_0001609 3300046477 Bacteria 12011
416 Ga0495585_0003281 3300046492 Bacteria 11009
417 Ga0495594_0022175 3300046499 Bacteria 3395
418 Ga0495607_0004288 3300046501 Bacteria 10532
419 Ga0495608_0088519 3300046511 Bacteria 2004
420 Ga0495618_0015490 3300046514 Bacteria 4653
421 Ga0495628_0002046 3300046516 Bacteria 18273
422 Ga0495628_0014402 3300046516 Bacteria 6630
423 Ga0495630_0036431 3300046517 Bacteria 3678
424 Ga0495630_0065419 3300046517 Bacteria 2732
425 Ga0495630_0143743 3300046517 Bacteria 1814
426 Ga0495644_0000514 3300046523 Bacteria 16546
427 Ga0495666_0001847 3300046526 Bacteria 10463
428 Ga0495666_0016564 3300046526 Bacteria 3672
429 Ga0495652_0011016 3300046529 Bacteria 8193
430 Ga0495652_0143441 3300046529 Bacteria 1875
431 Ga0495652_0325251 3300046529 Bacteria 1109
432 Ga0495665_0026043 3300046531 Bacteria 3141
433 Ga0495640_0019454 3300046533 Bacteria 5011
434 Ga0495640_0036686 3300046533 Bacteria 3462
435 Ga0495640_0038267 3300046533 Bacteria 3375
436 Ga0495640_0153691 3300046533 Bacteria 1477
437 Ga0495587_0016309 3300046536 Bacteria 4623
438 Ga0495587_0016489 3300046536 Bacteria 4595
439 Ga0495587_0020228 3300046536 Bacteria 4111
440 Ga0495645_0001781 3300046543 Bacteria 14625
441 Ga0495645_0009419 3300046543 Bacteria 6824
442 Ga0495645_0312691 3300046543 Bacteria 1022
443 Ga0495622_0012353 3300046557 Bacteria 3952
444 Ga0495622_0148178 3300046557 Bacteria 1063
445 Ga0495667_0002342 3300046559 Bacteria 12672
446 Ga0495667_0011331 3300046559 Bacteria 6037
447 Ga0495667_0037159 3300046559 Bacteria 3246
448 Ga0495667_0052769 3300046559 Bacteria 2678
449 Ga0495656_0001283 3300046615 Bacteria 8165
450 Ga0495634_0063424 3300046642 Bacteria 2452
451 Ga0495634_0088224 3300046642 Bacteria 2018
452 Ga0495634_0096170 3300046642 Bacteria 1918
453 Ga0495625_0193799 3300046660 Bacteria 1345
454 Ga0495635_0000736 3300046663 Bacteria 21173
455 Ga0495635_0004379 3300046663 Bacteria 9778
456 Ga0495659_0056880 3300046664 Bacteria 1436
457 Ga0495661_0056198 3300046665 Bacteria 2356
458 Ga0495588_0018157 3300046674 Bacteria 3425
459 Ga0495588_0080669 3300046674 Unclassified 1698
460 Ga0495657_0007642 3300046675 Bacteria 8326
461 Ga0495657_0172100 3300046675 Unclassified 1333
462 Ga0495599_0002064 3300046678 Bacteria 11642
463 Ga0495599_0002943 3300046678 Bacteria 9902
464 Ga0495599_0003364 3300046678 Bacteria 9345
465 Ga0495623_0002286 3300046679 Bacteria 12776
466 Ga0495623_0159369 3300046679 Bacteria 1327
467 Ga0495646_0000229 3300046680 Bacteria 27971
468 Ga0495646_0006372 3300046680 Bacteria 7484
469 Ga0495647_0004269 3300046681 Bacteria 4629
470 Ga0495647_0185620 3300046681 Bacteria 906
471 Ga0495658_0002748 3300046683 Bacteria 8846
472 Ga0495613_0143415 3300046689 Bacteria 1705
473 Ga0495613_0182060 3300046689 Unclassified 1487
474 Ga0495624_0117309 3300046690 Bacteria 1635
475 Ga0495624_0234738 3300046690 Bacteria 1110
476 Ga0495624_0561834 3300046690 Bacteria 681
477 Ga0495670_0009490 3300046691 Bacteria 4782
478 Ga0495671_0220449 3300046692 Unclassified 918
479 Ga0495600_0003589 3300046809 Bacteria 9137
480 Ga0495600_0032196 3300046809 Bacteria 3401
481 Ga0495600_0073671 3300046809 Unclassified 2230
482 Ga0495600_0121281 3300046809 Unclassified 1700
483 Ga0495581_0005348 3300047315 Bacteria 7424
484 Ga0495581_0260995 3300047315 Bacteria 1013
485 Ga0495581_0301288 3300047315 Unclassified 937
486 Ga0495604_0009381 3300047317 Bacteria 7740
487 Ga0495604_0119859 3300047317 Bacteria 1906
488 Ga0495604_0243196 3300047317 Unclassified 1229
489 Ga0495674_0013071 3300047319 Bacteria 7811
490 Ga0495674_0030389 3300047319 Bacteria 4912
491 Ga0495674_0039235 3300047319 Bacteria 4246
492 Ga0495676_0122104 3300047321 Unclassified 1893
493 Ga0495676_0159434 3300047321 Bacteria 1597
494 Ga0495680_0005567 3300047322 Bacteria 11823
495 Ga0495680_0029672 3300047322 Bacteria 4476
496 Ga0495680_0047393 3300047322 Bacteria 3381
497 Ga0495680_0118574 3300047322 Bacteria 1955
498 Ga0495675_0013037 3300047444 Bacteria 5241
499 Ga0495675_0030741 3300047444 Bacteria 3427
500 Ga0495684_0006324 3300047471 Bacteria 9204
501 Ga0495684_0139589 3300047471 Unclassified 1817
502 Ga0495593_0122577 3300047673 Unclassified 1322
503 Ga0495602_0006950 3300048088 Bacteria 11884
504 Ga0495602_0253115 3300048088 Bacteria 1311
505 Ga0496100_0000057 3300048903 Bacteria 67216
506 Ga0496101_0001297 3300048904 Bacteria 14944
507 Ga0496101_0097328 3300048904 Bacteria 2197
508 Ga0496102_0001628 3300048905 Bacteria 19791
509 Ga0496102_0018224 3300048905 Bacteria 6164
510 Ga0496103_0003173 3300048906 Bacteria 10102
511 Ga0496103_0011059 3300048906 Bacteria 5344
512 Ga0496104_0000932 3300048907 Bacteria 25092
513 Ga0496104_0041108 3300048907 Bacteria 4334
514 Ga0496104_0388188 3300048907 Bacteria 1308
515 Ga0496105_0019215 3300048908 Bacteria 5510
516 Ga0496105_0021279 3300048908 Bacteria 5248
517 Ga0496106_0000518 3300048909 Bacteria 27401
518 Ga0496107_0001129 3300048910 Bacteria 16115
519 Ga0496107_0005941 3300048910 Bacteria 8366
520 Ga0496107_0116749 3300048910 Bacteria 1965
521 Ga0496107_0255663 3300048910 Bacteria 1303
522 Ga0496108_0004254 3300048911 Bacteria 11528
523 Ga0496108_0021395 3300048911 Bacteria 5316
524 Ga0496108_0051769 3300048911 Bacteria 3440
525 Ga0496109_0002432 3300048912 Bacteria 15587
526 Ga0496109_0003961 3300048912 Bacteria 12362
527 Ga0496110_0001450 3300048913 Bacteria 17181
528 Ga0496110_0022934 3300048913 Bacteria 5305
529 Ga0496111_0018065 3300048914 Bacteria 4879
530 Ga0496112_0105119 3300048915 Bacteria 2793
531 Ga0496112_0254183 3300048915 Bacteria 1708
532 Ga0496112_0555072 3300048915 Bacteria 1082
533 Ga0496113_0016626 3300048916 Bacteria 5086
534 Ga0496113_0030441 3300048916 Bacteria 3907
535 Ga0496113_0388473 3300048916 Bacteria 1120
536 Ga0496114_0002944 3300048917 Bacteria 13059
537 Ga0496114_0355728 3300048917 Bacteria 1295
538 Ga0496115_0002786 3300048918 Bacteria 12565
539 Ga0496115_0014635 3300048918 Bacteria 5941
540 Ga0496115_0032489 3300048918 Bacteria 4116
541 Ga0496115_0203225 3300048918 Bacteria 1636
542 Ga0501032_0048692 3300049569 Bacteria 2861
543 Ga0501032_0494396 3300049569 Bacteria 782
544 Ga0501033_0055047 3300049570 Bacteria 2941
545 Ga0501033_0496149 3300049570 Unclassified 845
546 Ga0501034_0000032 3300049571 Bacteria 243763
547 Ga0501034_0010486 3300049571 Bacteria 9648
548 Ga0501034_0329514 3300049571 Bacteria 1458
549 Ga0501036_0018617 3300049572 Bacteria 5822
550 Ga0501036_0252883 3300049572 Bacteria 1476
551 Ga0501036_0361312 3300049572 Bacteria 1212
552 Ga0501037_0044551 3300049573 Bacteria 3258
553 Ga0501037_0072595 3300049573 Bacteria 2502
554 Ga0501038_0049211 3300049574 Bacteria 3645
555 Ga0501038_0072882 3300049574 Bacteria 2909
556 Ga0501038_0090742 3300049574 Bacteria 2560
557 Ga0501038_0149411 3300049574 Bacteria 1905
558 Ga0501039_0248605 3300049575 Unclassified 1398
559 Ga0501040_0127488 3300049576 Unclassified 1788
560 Ga0501043_0008265 3300049579 Bacteria 8200
561 Ga0501043_0184985 3300049579 Bacteria 1622
562 Ga0501046_0023608 3300049580 Bacteria 5055
563 Ga0501046_0093007 3300049580 Unclassified 2318
564 Ga0501047_0018542 3300049581 Bacteria 6674
565 Ga0501047_0213511 3300049581 Bacteria 1787
566 Ga0501047_0295188 3300049581 Bacteria 1464
567 Ga0501047_0484377 3300049581 Unclassified 1064
568 Ga0501048_0034404 3300049582 Bacteria 3655
569 Ga0501048_0127043 3300049582 Bacteria 1803
570 Ga0501048_0163293 3300049582 Unclassified 1577
571 Ga0501048_0420371 3300049582 Bacteria 956
572 Ga0501067_0077169 3300049583 Bacteria 1846
573 Ga0501068_0078727 3300049584 Bacteria 2020
574 Ga0501069_0029376 3300049585 Bacteria 3016
575 Ga0501069_0224883 3300049585 Bacteria 1091
576 Ga0501070_0002759 3300049586 Bacteria 15326
577 Ga0501070_0008780 3300049586 Bacteria 8545
578 Ga0501070_0087816 3300049586 Bacteria 2573
579 Ga0501070_0119058 3300049586 Bacteria 2182
580 Ga0501070_0171930 3300049586 Bacteria 1784
581 Ga0501070_0198571 3300049586 Bacteria 1647
582 Ga0501071_0023874 3300049587 Bacteria 4273
583 Ga0501073_0178582 3300049589 Bacteria 1469
584 Ga0501073_0182827 3300049589 Bacteria 1451
585 Ga0501074_0068958 3300049590 Bacteria 2542
586 Ga0501074_0071152 3300049590 Bacteria 2500
587 Ga0501075_0123637 3300049591 Bacteria 1970
588 Ga0501075_0128050 3300049591 Bacteria 1933
589 Ga0501076_0114009 3300049592 Bacteria 2187
590 Ga0501076_0344339 3300049592 Bacteria 1224
591 Ga0501077_0006238 3300049593 Bacteria 7290
592 Ga0501077_0037633 3300049593 Bacteria 3081
593 Ga0501077_0415267 3300049593 Bacteria 861
594 Ga0501079_0056842 3300049741 Bacteria 3019
595 Ga0501079_0162003 3300049741 Bacteria 1744
596 Ga0501079_0213286 3300049741 Bacteria 1508
597 Ga0501079_0290421 3300049741 Bacteria 1279
598 Ga0501079_0340247 3300049741 Bacteria 1175
599 Ga0501080_0010850 3300049742 Bacteria 8338
600 Ga0501080_0011076 3300049742 Bacteria 8251
601 Ga0501080_0033206 3300049742 Bacteria 4817
602 Ga0501080_0112526 3300049742 Bacteria 2523
603 Ga0501080_0221649 3300049742 Bacteria 1730
604 Ga0501080_0390695 3300049742 Bacteria 1252
605 Ga0501080_0465967 3300049742 Bacteria 1131
606 Ga0501081_0111528 3300049743 Unclassified 1941
607 Ga0501081_0135744 3300049743 Bacteria 1761
608 Ga0501081_0153227 3300049743 Bacteria 1657
609 Ga0501083_0031088 3300049744 Bacteria 3664
610 Ga0501035_0006636 3300049822 Bacteria 10831
611 Ga0501035_0014779 3300049822 Bacteria 7209
612 Ga0501035_0054697 3300049822 Bacteria 3565
613 Ga0501044_0145021 3300049823 Bacteria 2360
614 Ga0501044_0212639 3300049823 Bacteria 1887
615 Ga0501044_0593938 3300049823 Unclassified 1001
616 nmdc:mga03n38_151576_c1 3300050490 Bacteria 1167
617 nmdc:mga03n38_343496_c1 3300050490 Bacteria 811
618 nmdc:mga00v17_22620_c1 3300050491 Bacteria 3629
619 nmdc:mga0yw44_30618_c1 3300050492 Bacteria 3121
620 nmdc:mga06z11_258810_c1 3300050494 Bacteria 1026
621 nmdc:mga06z11_4530_c1 3300050494 Bacteria 5475
622 nmdc:mga06z11_4532_c1 3300050494 Bacteria 5473
623 nmdc:mga04h51_1364_c1 3300050495 Bacteria 5619
624 nmdc:mga04h51_5630_c1 3300050495 Bacteria 3203
625 nmdc:mga04h51_5885_c1 3300050495 Bacteria 3146
626 nmdc:mga05p37_215357_c1 3300050507 Bacteria 2320
627 nmdc:mga05p37_237562_c1 3300050507 Bacteria 2193
628 nmdc:mga05p37_262753_c1 3300050507 Bacteria 2065
629 nmdc:mga05p37_30390_c1 3300050507 Bacteria 6592
630 nmdc:mga05p37_45_c2 3300050507 Bacteria 24882
631 nmdc:mga05p37_754683_c1 3300050507 Bacteria 1072
632 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
633 nmdc:mga09592_155375_c1 3300050508 Bacteria 1975
634 nmdc:mga09592_167284_c1 3300050508 Bacteria 1901
635 nmdc:mga09592_255888_c1 3300050508 Bacteria 1518
636 nmdc:mga09592_62062_c1 3300050508 Bacteria 3161
637 nmdc:mga0qj67_11495_c1 3300050509 Bacteria 6634
638 nmdc:mga0qj67_195263_c1 3300050509 Bacteria 1645
639 nmdc:mga0qj67_263608_c1 3300050509 Bacteria 1398
640 nmdc:mga0qj67_336435_c1 3300050509 Bacteria 1221
641 nmdc:mga0qj67_53714_c1 3300050509 Bacteria 3190
642 nmdc:mga0qj67_701_c1 3300050509 Bacteria 22836
643 nmdc:mga06r32_101841_c1 3300050510 Bacteria 2819
644 nmdc:mga06r32_12918_c1 3300050510 Bacteria 7549
645 nmdc:mga06r32_170835_c1 3300050510 Bacteria 2158
646 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
647 nmdc:mga06r32_295679_c1 3300050510 Bacteria 1606
648 nmdc:mga06r32_368433_c1 3300050510 Bacteria 1420
649 nmdc:mga06r32_443833_c1 3300050510 Bacteria 1278
650 nmdc:mga08y16_1134_c1 3300050511 Bacteria 26246
651 nmdc:mga08y16_12172_c1 3300050511 Bacteria 9043
652 nmdc:mga08y16_190186_c1 3300050511 Bacteria 2129
653 nmdc:mga08y16_1989_c1 3300050511 Bacteria 20867
654 nmdc:mga08y16_278261_c1 3300050511 Bacteria 1727
655 nmdc:mga0n895_20617_c1 3300050512 Bacteria 6151
656 nmdc:mga0n895_3165_c1 3300050512 Bacteria 13152
657 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
658 nmdc:mga0rr50_12507_c1 3300050513 Bacteria 5490
659 nmdc:mga0rr50_2855_c1 3300050513 Bacteria 9829
660 nmdc:mga0rr50_68891_c1 3300050513 Bacteria 2691
661 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
662 nmdc:mga0a205_5479_c1 3300050515 Bacteria 11429
663 nmdc:mga0a205_77964_c1 3300050515 Bacteria 3201
664 Ga0495601_0004041 3300053077 Bacteria 8454
665 Ga0495601_0005795 3300053077 Bacteria 7201
666 Ga0495601_0032428 3300053077 Bacteria 3252
667 Ga0495601_0066837 3300053077 Unclassified 2288
668 Ga0495612_0006019 3300053078 Bacteria 4997
669 Ga0495612_0007152 3300053078 Bacteria 4566
670 Ga0495612_0023069 3300053078 Bacteria 2495
671 Ga0495595_0000577 3300053084 Bacteria 14028
672 Ga0495595_0002620 3300053084 Bacteria 7052
673 Ga0495595_0005520 3300053084 Bacteria 5121
674 Ga0495619_0000260 3300053085 Bacteria 38574
675 Ga0495619_0000655 3300053085 Bacteria 22730
676 Ga0495619_0014245 3300053085 Bacteria 5023
677 Ga0495619_0021990 3300053085 Bacteria 4076
678 Ga0495619_0064595 3300053085 Bacteria 2440
679 Ga0500643_006415 3300053087 Bacteria 4918
680 Ga0500644_0000301 3300053088 Bacteria 26471
681 Ga0500646_0084823 3300053090 Bacteria 972
682 Ga0500651_0032130 3300053093 Bacteria 3308
683 Ga0500566_0008779 3300053094 Bacteria 5977
684 Ga0500555_019795 3300053103 Bacteria 1938
685 Ga0500595_000144 3300053119 Bacteria 46478
686 Ga0500616_0000006 3300053153 Bacteria 944738
687 Ga0500645_000946 3300053730 Bacteria 16529
688 Ga0501084_0003952 3300054114 Bacteria 12073
689 Ga0501084_0084712 3300054114 Bacteria 2661
690 Ga0501084_0336514 3300054114 Unclassified 1275
691 Ga0501082_0075827 3300060353 Bacteria 2897
692 Ga0501082_0168739 3300060353 Bacteria 1902
693 Ga0501082_0672856 3300060353 Bacteria 906
694 Ga0501082_0955700 3300060353 Bacteria 749
695 Ga0530510_0021687 3300061734 Bacteria 4570

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_258810_c1 nmdc:mga06z11_258810_c1_230_838 178
2 3300049571 Ga0501034_0010486 Ga0501034_0010486_6636_7271 192
3 3300049589 Ga0501073_0182827 Ga0501073_0182827_268_867 192
4 3300049744 Ga0501083_0031088 Ga0501083_0031088_777_1412 192
5 3300050508 nmdc:mga09592_62062_c1 nmdc:mga09592_62062_c1_414_1013 192
6 3300060353 Ga0501082_0955700 Ga0501082_0955700_100_735 192
7 3300031711 Ga0265314_10000279 Ga0265314_1000027955 194
8 3300005341 Ga0070691_10014449 Ga0070691_100144493 195
9 3300005459 Ga0068867_100701373 Ga0068867_1007013731 195
10 3300005545 Ga0070695_100001734 Ga0070695_1000017342 195
11 3300006038 Ga0075365_10077232 Ga0075365_100772322 195
12 3300026089 Ga0207648_10739767 Ga0207648_107397671 195
13 3300046642 Ga0495634_0096170 Ga0495634_0096170_53_658 195
14 3300046664 Ga0495659_0056880 Ga0495659_0056880_799_1410 195
15 3300046690 Ga0495624_0561834 Ga0495624_0561834_16_621 195
16 3300049572 Ga0501036_0018617 Ga0501036_0018617_5122_5784 195
17 3300049574 Ga0501038_0072882 Ga0501038_0072882_423_1085 195
18 3300049580 Ga0501046_0023608 Ga0501046_0023608_699_1361 195
19 3300049581 Ga0501047_0018542 Ga0501047_0018542_1750_2412 195
20 3300049582 Ga0501048_0163293 Ga0501048_0163293_60_689 195
21 3300049586 Ga0501070_0008780 Ga0501070_0008780_7698_8360 195
22 3300049741 Ga0501079_0213286 Ga0501079_0213286_779_1450 195
23 3300049742 Ga0501080_0010850 Ga0501080_0010850_2235_2897 195
24 3300049822 Ga0501035_0014779 Ga0501035_0014779_2890_3552 195
25 3300053103 Ga0500555_019795 Ga0500555_019795_600_1229 195
26 3300054114 Ga0501084_0336514 Ga0501084_0336514_578_1249 195
27 3300006048 Ga0075363_100064868 Ga0075363_1000648683 196
28 3300049589 Ga0501073_0178582 Ga0501073_0178582_50_712 196
29 3300049823 Ga0501044_0145021 Ga0501044_0145021_116_778 196
30 3300050512 nmdc:mga0n895_20617_c1 nmdc:mga0n895_20617_c1_5355_6053 196
31 3300006844 Ga0075428_100610672 Ga0075428_1006106722 197
32 3300006871 Ga0075434_100017596 Ga0075434_1000175968 197
33 3300007076 Ga0075435_100262238 Ga0075435_1002622382 197
34 3300025916 Ga0207663_10193802 Ga0207663_101938022 197
35 3300039453 Ga0436362_0112778 Ga0436362_0112778_52_714 197
36 3300050507 nmdc:mga05p37_30390_c1 nmdc:mga05p37_30390_c1_1920_2621 197
37 3300050513 nmdc:mga0rr50_12507_c1 nmdc:mga0rr50_12507_c1_600_1301 197
38 3300050515 nmdc:mga0a205_77964_c1 nmdc:mga0a205_77964_c1_2445_3146 197
39 3300005289 Ga0065704_10139579 Ga0065704_101395792 198
40 3300005335 Ga0070666_10184690 Ga0070666_101846902 198
41 3300005440 Ga0070705_100102590 Ga0070705_1001025903 198
42 3300005536 Ga0070697_100201328 Ga0070697_1002013281 198
43 3300005545 Ga0070695_100012588 Ga0070695_1000125884 198
44 3300009553 Ga0105249_10018811 Ga0105249_100188116 198
45 3300014968 Ga0157379_10228435 Ga0157379_102284352 198
46 3300025917 Ga0207660_10050417 Ga0207660_100504173 198
47 3300025932 Ga0207690_10176703 Ga0207690_101767033 198
48 3300025933 Ga0207706_10023602 Ga0207706_100236023 198
49 3300025961 Ga0207712_10313237 Ga0207712_103132371 198
50 3300027695 Ga0209966_1000761 Ga0209966_10007616 198
51 3300027717 Ga0209998_10001920 Ga0209998_100019203 198
52 3300035089 Ga0373944_0000522 Ga0373944_0000522_3961_4659 198
53 3300035114 Ga0373939_0044377 Ga0373939_0044377_324_941 198
54 3300035121 Ga0373960_0002095 Ga0373960_0002095_55_753 198
55 3300035171 Ga0373946_0070176 Ga0373946_0070176_215_913 198
56 3300035242 Ga0373962_0060521 Ga0373962_0060521_53_670 198
57 3300035410 Ga0373924_0027294 Ga0373924_0027294_538_1236 198
58 3300035691 Ga0373931_0001154 Ga0373931_0001154_6882_7499 198
59 3300035724 Ga0373933_0012736 Ga0373933_0012736_3552_4250 198
60 3300035725 Ga0373947_0039335 Ga0373947_0039335_2061_2759 198
61 3300037068 Ga0373925_0040062 Ga0373925_0040062_2364_3062 198
62 3300039450 Ga0436363_0770944 Ga0436363_0770944_548_1180 198
63 3300045051 Ga0451576_0052484 Ga0451576_0052484_3520_4218 198
64 3300046454 Ga0495592_0028640 Ga0495592_0028640_82_780 198
65 3300046455 Ga0495603_0008589 Ga0495603_0008589_5425_6123 198
66 3300046459 Ga0495629_0162800 Ga0495629_0162800_408_1106 198
67 3300046461 Ga0495641_0021653 Ga0495641_0021653_120_818 198
68 3300046472 Ga0495580_0021831 Ga0495580_0021831_217_915 198
69 3300046473 Ga0495582_0001705 Ga0495582_0001705_8092_8790 198
70 3300046477 Ga0495664_0001609 Ga0495664_0001609_3658_4356 198
71 3300046492 Ga0495585_0003281 Ga0495585_0003281_5123_5821 198
72 3300046499 Ga0495594_0022175 Ga0495594_0022175_2061_2759 198
73 3300046501 Ga0495607_0004288 Ga0495607_0004288_9641_10339 198
74 3300046523 Ga0495644_0000514 Ga0495644_0000514_1206_1904 198
75 3300046526 Ga0495666_0001847 Ga0495666_0001847_34_732 198
76 3300046531 Ga0495665_0026043 Ga0495665_0026043_837_1535 198
77 3300046615 Ga0495656_0001283 Ga0495656_0001283_2428_3126 198
78 3300046665 Ga0495661_0056198 Ga0495661_0056198_598_1296 198
79 3300046674 Ga0495588_0018157 Ga0495588_0018157_635_1333 198
80 3300046683 Ga0495658_0002748 Ga0495658_0002748_7084_7782 198
81 3300046691 Ga0495670_0009490 Ga0495670_0009490_2090_2788 198
82 3300046692 Ga0495671_0220449 Ga0495671_0220449_196_894 198
83 3300047317 Ga0495604_0243196 Ga0495604_0243196_316_1014 198
84 3300047319 Ga0495674_0030389 Ga0495674_0030389_3807_4505 198
85 3300047321 Ga0495676_0159434 Ga0495676_0159434_63_761 198
86 3300048916 Ga0496113_0388473 Ga0496113_0388473_222_920 198
87 3300049569 Ga0501032_0494396 Ga0501032_0494396_104_748 198
88 3300049581 Ga0501047_0295188 Ga0501047_0295188_625_1269 198
89 3300049586 Ga0501070_0198571 Ga0501070_0198571_423_1067 198
90 3300049742 Ga0501080_0465967 Ga0501080_0465967_423_1067 198
91 3300049823 Ga0501044_0593938 Ga0501044_0593938_25_669 198
92 3300060353 Ga0501082_0672856 Ga0501082_0672856_152_796 198
93 3300005983 Ga0081540_1029769 Ga0081540_10297693 199
94 3300006042 Ga0075368_10009591 Ga0075368_100095913 199
95 3300006048 Ga0075363_100082581 Ga0075363_1000825811 199
96 3300006178 Ga0075367_10126994 Ga0075367_101269942 199
97 3300006844 Ga0075428_100156309 Ga0075428_1001563092 199
98 3300006846 Ga0075430_100006793 Ga0075430_1000067936 199
99 3300006847 Ga0075431_100002999 Ga0075431_10000299915 199
100 3300006847 Ga0075431_100395587 Ga0075431_1003955872 199
101 3300006880 Ga0075429_100291621 Ga0075429_1002916212 199
102 3300009147 Ga0114129_10151517 Ga0114129_101515173 199
103 3300009147 Ga0114129_10743347 Ga0114129_107433472 199
104 3300027543 Ga0209999_1021261 Ga0209999_10212611 199
105 3300027866 Ga0209813_10004851 Ga0209813_100048513 199
106 3300049570 Ga0501033_0496149 Ga0501033_0496149_127_780 199
107 3300049576 Ga0501040_0127488 Ga0501040_0127488_46_699 199
108 3300049580 Ga0501046_0093007 Ga0501046_0093007_1567_2220 199
109 3300049582 Ga0501048_0127043 Ga0501048_0127043_870_1595 199
110 3300049591 Ga0501075_0128050 Ga0501075_0128050_318_1043 199
111 3300049593 Ga0501077_0006238 Ga0501077_0006238_90_815 199
112 3300049593 Ga0501077_0037633 Ga0501077_0037633_464_1117 199
113 3300049742 Ga0501080_0033206 Ga0501080_0033206_319_1044 199
114 3300049743 Ga0501081_0111528 Ga0501081_0111528_924_1577 199
115 3300050490 nmdc:mga03n38_151576_c1 nmdc:mga03n38_151576_c1_56_736 199
116 3300050491 nmdc:mga00v17_22620_c1 nmdc:mga00v17_22620_c1_1216_1896 199
117 3300050492 nmdc:mga0yw44_30618_c1 nmdc:mga0yw44_30618_c1_2332_3012 199
118 3300050494 nmdc:mga06z11_4530_c1 nmdc:mga06z11_4530_c1_262_942 199
119 3300050495 nmdc:mga04h51_5885_c1 nmdc:mga04h51_5885_c1_624_1304 199
120 3300050507 nmdc:mga05p37_215357_c1 nmdc:mga05p37_215357_c1_453_1106 199
121 3300050507 nmdc:mga05p37_754683_c1 nmdc:mga05p37_754683_c1_317_988 199
122 3300050508 nmdc:mga09592_167284_c1 nmdc:mga09592_167284_c1_684_1355 199
123 3300050508 nmdc:mga09592_255888_c1 nmdc:mga09592_255888_c1_434_1135 199
124 3300050509 nmdc:mga0qj67_11495_c1 nmdc:mga0qj67_11495_c1_4346_5017 199
125 3300050509 nmdc:mga0qj67_263608_c1 nmdc:mga0qj67_263608_c1_391_1044 199
126 3300050510 nmdc:mga06r32_101841_c1 nmdc:mga06r32_101841_c1_476_1147 199
127 3300050510 nmdc:mga06r32_12918_c1 nmdc:mga06r32_12918_c1_6136_6789 199
128 3300050510 nmdc:mga06r32_368433_c1 nmdc:mga06r32_368433_c1_415_1116 199
129 3300054114 Ga0501084_0003952 Ga0501084_0003952_3561_4286 199
130 3300060353 Ga0501082_0075827 Ga0501082_0075827_574_1227 199
131 3300061734 Ga0530510_0021687 Ga0530510_0021687_2107_2760 199
132 3300006058 Ga0075432_10000464 Ga0075432_100004647 200
133 3300006178 Ga0075367_10309065 Ga0075367_103090652 200
134 3300006844 Ga0075428_100016761 Ga0075428_1000167614 200
135 3300006846 Ga0075430_100005590 Ga0075430_1000055904 200
136 3300006847 Ga0075431_100004052 Ga0075431_10000405210 200
137 3300006852 Ga0075433_10000774 Ga0075433_1000077416 200
138 3300006871 Ga0075434_100005910 Ga0075434_1000059104 200
139 3300006880 Ga0075429_100007130 Ga0075429_1000071304 200
140 3300009093 Ga0105240_10412735 Ga0105240_104127352 200
141 3300009094 Ga0111539_10010377 Ga0111539_100103774 200
142 3300009147 Ga0114129_10072966 Ga0114129_100729664 200
143 3300009174 Ga0105241_10300667 Ga0105241_103006672 200
144 3300012506 Ga0157324_1000372 Ga0157324_10003723 200
145 3300013100 Ga0157373_10122264 Ga0157373_101222642 200
146 3300013306 Ga0163162_10238564 Ga0163162_102385642 200
147 3300027682 Ga0209971_1007895 Ga0209971_10078953 200
148 3300027717 Ga0209998_10005097 Ga0209998_100050974 200
149 3300027907 Ga0207428_10000124 Ga0207428_1000012490 200
150 3300035120 Ga0373957_0118942 Ga0373957_0118942_191_889 200
151 3300036401 Ga0373937_0019099 Ga0373937_0019099_779_1477 200
152 3300037068 Ga0373925_0402059 Ga0373925_0402059_237_935 200
153 3300042001 Ga0439441_015523 Ga0439441_015523_602_1213 200
154 3300046454 Ga0495592_0169115 Ga0495592_0169115_111_809 200
155 3300046460 Ga0495638_0041088 Ga0495638_0041088_1875_2567 200
156 3300046463 Ga0495653_0174008 Ga0495653_0174008_13_711 200
157 3300046511 Ga0495608_0088519 Ga0495608_0088519_75_773 200
158 3300046529 Ga0495652_0325251 Ga0495652_0325251_344_1042 200
159 3300046559 Ga0495667_0052769 Ga0495667_0052769_1189_1887 200
160 3300046642 Ga0495634_0088224 Ga0495634_0088224_1177_1875 200
161 3300046809 Ga0495600_0073671 Ga0495600_0073671_747_1445 200
162 3300047315 Ga0495581_0260995 Ga0495581_0260995_145_843 200
163 3300047322 Ga0495680_0047393 Ga0495680_0047393_104_802 200
164 3300048088 Ga0495602_0253115 Ga0495602_0253115_293_991 200
165 3300049585 Ga0501069_0224883 Ga0501069_0224883_45_677 200
166 3300049586 Ga0501070_0171930 Ga0501070_0171930_724_1356 200
167 3300049741 Ga0501079_0290421 Ga0501079_0290421_51_683 200
168 3300049822 Ga0501035_0006636 Ga0501035_0006636_5707_6339 200
169 3300050495 nmdc:mga04h51_5630_c1 nmdc:mga04h51_5630_c1_2441_3100 200
170 3300050507 nmdc:mga05p37_45_c2 nmdc:mga05p37_45_c2_2607_3305 200
171 3300050508 nmdc:mga09592_1055_c1 nmdc:mga09592_1055_c1_12724_13422 200
172 3300050509 nmdc:mga0qj67_701_c1 nmdc:mga0qj67_701_c1_19342_20040 200
173 3300050510 nmdc:mga06r32_227_c1 nmdc:mga06r32_227_c1_4786_5484 200
174 3300050511 nmdc:mga08y16_1134_c1 nmdc:mga08y16_1134_c1_22075_22773 200
175 3300050512 nmdc:mga0n895_50_c1 nmdc:mga0n895_50_c1_62304_63002 200
176 3300050513 nmdc:mga0rr50_2855_c1 nmdc:mga0rr50_2855_c1_4182_4880 200
177 3300050515 nmdc:mga0a205_5479_c1 nmdc:mga0a205_5479_c1_6832_7530 200
178 3300053085 Ga0495619_0000260 Ga0495619_0000260_28679_29377 200
179 3300053088 Ga0500644_0000301 Ga0500644_0000301_24663_25355 200
180 3300053093 Ga0500651_0032130 Ga0500651_0032130_749_1441 200
181 3300053153 Ga0500616_0000006 Ga0500616_0000006_423245_423937 200
182 3300005354 Ga0070675_100280831 Ga0070675_1002808312 201
183 3300005364 Ga0070673_100027376 Ga0070673_1000273766 201
184 3300005436 Ga0070713_100538902 Ga0070713_1005389021 201
185 3300005437 Ga0070710_10036184 Ga0070710_100361842 201
186 3300005439 Ga0070711_100090906 Ga0070711_1000909063 201
187 3300005439 Ga0070711_100367936 Ga0070711_1003679362 201
188 3300005440 Ga0070705_100166578 Ga0070705_1001665782 201
189 3300005459 Ga0068867_100290654 Ga0068867_1002906543 201
190 3300005530 Ga0070679_100697948 Ga0070679_1006979482 201
191 3300005543 Ga0070672_100406113 Ga0070672_1004061132 201
192 3300005546 Ga0070696_100040533 Ga0070696_1000405334 201
193 3300005564 Ga0070664_100031100 Ga0070664_1000311003 201
194 3300005614 Ga0068856_100478856 Ga0068856_1004788562 201
195 3300005843 Ga0068860_100126276 Ga0068860_1001262763 201
196 3300006028 Ga0070717_10421408 Ga0070717_104214081 201
197 3300006163 Ga0070715_10063192 Ga0070715_100631922 201
198 3300006175 Ga0070712_100365350 Ga0070712_1003653501 201
199 3300006237 Ga0097621_100038380 Ga0097621_1000383802 201
200 3300006847 Ga0075431_100619943 Ga0075431_1006199431 201
201 3300009147 Ga0114129_10026350 Ga0114129_100263506 201
202 3300025898 Ga0207692_10196855 Ga0207692_101968552 201
203 3300025899 Ga0207642_10043751 Ga0207642_100437513 201
204 3300025905 Ga0207685_10026415 Ga0207685_100264152 201
205 3300025906 Ga0207699_10043874 Ga0207699_100438744 201
206 3300025915 Ga0207693_10009823 Ga0207693_100098233 201
207 3300025929 Ga0207664_10470213 Ga0207664_104702132 201
208 3300025935 Ga0207709_10047675 Ga0207709_100476753 201
209 3300025937 Ga0207669_10082800 Ga0207669_100828003 201
210 3300025939 Ga0207665_10103561 Ga0207665_101035613 201
211 3300025941 Ga0207711_10235409 Ga0207711_102354092 201
212 3300026078 Ga0207702_10421742 Ga0207702_104217423 201
213 3300027876 Ga0209974_10004757 Ga0209974_100047576 201
214 3300027907 Ga0207428_10040025 Ga0207428_100400251 201
215 3300035083 Ga0373926_0002897 Ga0373926_0002897_3188_3886 201
216 3300035113 Ga0373936_0013341 Ga0373936_0013341_2330_3028 201
217 3300035113 Ga0373936_0017209 Ga0373936_0017209_681_1382 201
218 3300035170 Ga0373943_0078240 Ga0373943_0078240_837_1535 201
219 3300035692 Ga0373935_0032811 Ga0373935_0032811_1103_1804 201
220 3300036401 Ga0373937_0020009 Ga0373937_0020009_3194_3892 201
221 3300046455 Ga0495603_0040127 Ga0495603_0040127_1191_1892 201
222 3300046459 Ga0495629_0061155 Ga0495629_0061155_498_1199 201
223 3300046462 Ga0495651_0003892 Ga0495651_0003892_5352_6050 201
224 3300046473 Ga0495582_0024557 Ga0495582_0024557_2290_2991 201
225 3300046475 Ga0495639_0047948 Ga0495639_0047948_1065_1763 201
226 3300046476 Ga0495662_0009334 Ga0495662_0009334_437_1135 201
227 3300046517 Ga0495630_0065419 Ga0495630_0065419_1305_2003 201
228 3300046526 Ga0495666_0016564 Ga0495666_0016564_1448_2149 201
229 3300046529 Ga0495652_0143441 Ga0495652_0143441_590_1288 201
230 3300046533 Ga0495640_0019454 Ga0495640_0019454_952_1653 201
231 3300046533 Ga0495640_0153691 Ga0495640_0153691_571_1269 201
232 3300046536 Ga0495587_0016309 Ga0495587_0016309_2954_3652 201
233 3300046543 Ga0495645_0312691 Ga0495645_0312691_155_856 201
234 3300046557 Ga0495622_0012353 Ga0495622_0012353_2237_2935 201
235 3300046559 Ga0495667_0002342 Ga0495667_0002342_4946_5644 201
236 3300046663 Ga0495635_0004379 Ga0495635_0004379_9059_9757 201
237 3300046674 Ga0495588_0080669 Ga0495588_0080669_342_1043 201
238 3300046681 Ga0495647_0004269 Ga0495647_0004269_3550_4248 201
239 3300046689 Ga0495613_0143415 Ga0495613_0143415_695_1393 201
240 3300046689 Ga0495613_0182060 Ga0495613_0182060_431_1132 201
241 3300046690 Ga0495624_0117309 Ga0495624_0117309_856_1554 201
242 3300046809 Ga0495600_0003589 Ga0495600_0003589_1427_2125 201
243 3300047315 Ga0495581_0005348 Ga0495581_0005348_6185_6883 201
244 3300047319 Ga0495674_0039235 Ga0495674_0039235_2994_3695 201
245 3300047321 Ga0495676_0122104 Ga0495676_0122104_259_960 201
246 3300047322 Ga0495680_0029672 Ga0495680_0029672_2274_2972 201
247 3300047471 Ga0495684_0006324 Ga0495684_0006324_8063_8761 201
248 3300047673 Ga0495593_0122577 Ga0495593_0122577_75_776 201
249 3300053077 Ga0495601_0005795 Ga0495601_0005795_6462_7163 201
250 3300053077 Ga0495601_0032428 Ga0495601_0032428_588_1286 201
251 3300053078 Ga0495612_0006019 Ga0495612_0006019_681_1382 201
252 3300053078 Ga0495612_0023069 Ga0495612_0023069_1773_2471 201
253 3300053084 Ga0495595_0002620 Ga0495595_0002620_217_915 201
254 3300053085 Ga0495619_0021990 Ga0495619_0021990_2966_3667 201
255 3300053085 Ga0495619_0064595 Ga0495619_0064595_22_720 201
256 3300001976 JGI24752J21851_1003948 JGI24752J21851_10039482 202
257 3300001977 JGI24746J21847_1000185 JGI24746J21847_10001857 202
258 3300001978 JGI24747J21853_1002365 JGI24747J21853_10023652 202
259 3300001989 JGI24739J22299_10000164 JGI24739J22299_1000016417 202
260 3300002073 JGI24745J21846_1000369 JGI24745J21846_10003694 202
261 3300002076 JGI24749J21850_1005843 JGI24749J21850_10058433 202
262 3300002077 JGI24744J21845_10011578 JGI24744J21845_100115782 202
263 3300002155 JGI24033J26618_1002322 JGI24033J26618_10023222 202
264 3300002459 JGI24751J29686_10011012 JGI24751J29686_100110122 202
265 3300005293 Ga0065715_10001682 Ga0065715_100016822 202
266 3300005329 Ga0070683_100000376 Ga0070683_10000037625 202
267 3300005336 Ga0070680_100500512 Ga0070680_1005005122 202
268 3300005337 Ga0070682_100000141 Ga0070682_10000014119 202
269 3300005340 Ga0070689_100003974 Ga0070689_1000039746 202
270 3300005344 Ga0070661_100000242 Ga0070661_10000024246 202
271 3300005354 Ga0070675_100000165 Ga0070675_10000016535 202
272 3300005355 Ga0070671_100001907 Ga0070671_10000190718 202
273 3300005364 Ga0070673_100001190 Ga0070673_10000119011 202
274 3300005365 Ga0070688_100002746 Ga0070688_1000027466 202
275 3300005406 Ga0070703_10010312 Ga0070703_100103123 202
276 3300005445 Ga0070708_100038832 Ga0070708_1000388322 202
277 3300005456 Ga0070678_100001012 Ga0070678_1000010128 202
278 3300005466 Ga0070685_10000547 Ga0070685_1000054715 202
279 3300005468 Ga0070707_101018000 Ga0070707_1010180001 202
280 3300005543 Ga0070672_100000527 Ga0070672_10000052714 202
281 3300005545 Ga0070695_100007154 Ga0070695_1000071541 202
282 3300005547 Ga0070693_100000199 Ga0070693_10000019913 202
283 3300005563 Ga0068855_100004444 Ga0068855_1000044449 202
284 3300005564 Ga0070664_100000895 Ga0070664_10000089511 202
285 3300005577 Ga0068857_100001816 Ga0068857_10000181610 202
286 3300005578 Ga0068854_100001666 Ga0068854_1000016663 202
287 3300005614 Ga0068856_100001538 Ga0068856_1000015383 202
288 3300005615 Ga0070702_100001415 Ga0070702_1000014158 202
289 3300005616 Ga0068852_100002972 Ga0068852_10000297213 202
290 3300005618 Ga0068864_100000227 Ga0068864_10000022754 202
291 3300005840 Ga0068870_10000155 Ga0068870_100001557 202
292 3300005841 Ga0068863_100000495 Ga0068863_10000049532 202
293 3300005842 Ga0068858_100000783 Ga0068858_10000078329 202
294 3300005983 Ga0081540_1067389 Ga0081540_10673893 202
295 3300006237 Ga0097621_100000010 Ga0097621_10000001035 202
296 3300006358 Ga0068871_100000034 Ga0068871_10000003436 202
297 3300006852 Ga0075433_10009145 Ga0075433_100091453 202
298 3300006871 Ga0075434_100001700 Ga0075434_10000170010 202
299 3300006881 Ga0068865_100000230 Ga0068865_10000023022 202
300 3300007076 Ga0075435_100018036 Ga0075435_1000180362 202
301 3300009094 Ga0111539_10134890 Ga0111539_101348902 202
302 3300014326 Ga0157380_10156672 Ga0157380_101566721 202
303 3300017792 Ga0163161_10000523 Ga0163161_1000052316 202
304 3300025271 Ga0207666_1000010 Ga0207666_100001014 202
305 3300025290 Ga0207673_1000265 Ga0207673_10002653 202
306 3300025315 Ga0207697_10000186 Ga0207697_1000018624 202
307 3300025885 Ga0207653_10006329 Ga0207653_100063293 202
308 3300025893 Ga0207682_10000123 Ga0207682_1000012332 202
309 3300025900 Ga0207710_10002765 Ga0207710_100027659 202
310 3300025901 Ga0207688_10000889 Ga0207688_1000088910 202
311 3300025907 Ga0207645_10000023 Ga0207645_1000002322 202
312 3300025908 Ga0207643_10000007 Ga0207643_1000000713 202
313 3300025911 Ga0207654_10006607 Ga0207654_100066074 202
314 3300025912 Ga0207707_10002015 Ga0207707_100020157 202
315 3300025914 Ga0207671_10053873 Ga0207671_100538731 202
316 3300025917 Ga0207660_10000393 Ga0207660_1000039320 202
317 3300025918 Ga0207662_10000136 Ga0207662_1000013629 202
318 3300025920 Ga0207649_10000434 Ga0207649_1000043410 202
319 3300025921 Ga0207652_10001720 Ga0207652_1000172010 202
320 3300025923 Ga0207681_10000273 Ga0207681_1000027332 202
321 3300025926 Ga0207659_10000097 Ga0207659_1000009724 202
322 3300025927 Ga0207687_10001031 Ga0207687_100010317 202
323 3300025931 Ga0207644_10005450 Ga0207644_100054509 202
324 3300025932 Ga0207690_10000962 Ga0207690_1000096210 202
325 3300025933 Ga0207706_10000867 Ga0207706_1000086722 202
326 3300025934 Ga0207686_10002591 Ga0207686_1000259110 202
327 3300025935 Ga0207709_10007329 Ga0207709_100073291 202
328 3300025936 Ga0207670_10000536 Ga0207670_1000053613 202
329 3300025937 Ga0207669_10001135 Ga0207669_1000113513 202
330 3300025938 Ga0207704_10000119 Ga0207704_1000011945 202
331 3300025940 Ga0207691_10000544 Ga0207691_1000054414 202
332 3300025941 Ga0207711_10002468 Ga0207711_1000246810 202
333 3300025942 Ga0207689_10001743 Ga0207689_1000174310 202
334 3300025944 Ga0207661_10000785 Ga0207661_100007851 202
335 3300025945 Ga0207679_10000029 Ga0207679_10000029185 202
336 3300025949 Ga0207667_10016422 Ga0207667_100164229 202
337 3300025960 Ga0207651_10000083 Ga0207651_1000008314 202
338 3300025961 Ga0207712_10000471 Ga0207712_1000047110 202
339 3300025972 Ga0207668_10000862 Ga0207668_1000086213 202
340 3300025986 Ga0207658_10002203 Ga0207658_1000220310 202
341 3300026023 Ga0207677_10000992 Ga0207677_100009929 202
342 3300026035 Ga0207703_10088692 Ga0207703_100886923 202
343 3300026041 Ga0207639_10004451 Ga0207639_1000445110 202
344 3300026067 Ga0207678_10001568 Ga0207678_1000156813 202
345 3300026075 Ga0207708_10002060 Ga0207708_1000206014 202
346 3300026078 Ga0207702_10003639 Ga0207702_100036391 202
347 3300026088 Ga0207641_10000510 Ga0207641_1000051013 202
348 3300026089 Ga0207648_10002351 Ga0207648_1000235122 202
349 3300026095 Ga0207676_10003788 Ga0207676_100037884 202
350 3300026116 Ga0207674_10000608 Ga0207674_1000060814 202
351 3300026118 Ga0207675_100000805 Ga0207675_10000080514 202
352 3300026121 Ga0207683_10000082 Ga0207683_1000008252 202
353 3300026142 Ga0207698_10000377 Ga0207698_1000037721 202
354 3300027907 Ga0207428_10000703 Ga0207428_1000070335 202
355 3300028380 Ga0268265_10001170 Ga0268265_1000117016 202
356 3300028381 Ga0268264_10001878 Ga0268264_1000187814 202
357 3300034818 Ga0373950_0042416 Ga0373950_0042416_47_664 202
358 3300034820 Ga0373959_0005481 Ga0373959_0005481_1311_1928 202
359 3300034957 Ga0373938_0000092 Ga0373938_0000092_7504_8121 202
360 3300035085 Ga0373929_0019904 Ga0373929_0019904_542_1159 202
361 3300035090 Ga0373949_0003185 Ga0373949_0003185_2687_3304 202
362 3300035091 Ga0373951_0005474 Ga0373951_0005474_1930_2547 202
363 3300035092 Ga0373952_0002122 Ga0373952_0002122_286_903 202
364 3300035115 Ga0373941_0000855 Ga0373941_0000855_719_1336 202
365 3300035119 Ga0373956_0017796 Ga0373956_0017796_1939_2574 202
366 3300035121 Ga0373960_0051174 Ga0373960_0051174_288_905 202
367 3300035241 Ga0373961_0005849 Ga0373961_0005849_1957_2574 202
368 3300035410 Ga0373924_0089884 Ga0373924_0089884_471_1106 202
369 3300035691 Ga0373931_0000186 Ga0373931_0000186_5328_5945 202
370 3300036401 Ga0373937_0019441 Ga0373937_0019441_4016_4651 202
371 3300037068 Ga0373925_0033046 Ga0373925_0033046_867_1502 202
372 3300042012 Ga0439455_0010858 Ga0439455_0010858_586_1203 202
373 3300046454 Ga0495592_0001116 Ga0495592_0001116_5588_6223 202
374 3300046462 Ga0495651_0006050 Ga0495651_0006050_3163_3798 202
375 3300046516 Ga0495628_0014402 Ga0495628_0014402_152_787 202
376 3300046536 Ga0495587_0020228 Ga0495587_0020228_2774_3409 202
377 3300046543 Ga0495645_0001781 Ga0495645_0001781_10908_11543 202
378 3300046559 Ga0495667_0011331 Ga0495667_0011331_5206_5841 202
379 3300046675 Ga0495657_0172100 Ga0495657_0172100_348_983 202
380 3300046678 Ga0495599_0002943 Ga0495599_0002943_5611_6246 202
381 3300046679 Ga0495623_0159369 Ga0495623_0159369_378_1013 202
382 3300046809 Ga0495600_0032196 Ga0495600_0032196_1149_1784 202
383 3300047317 Ga0495604_0119859 Ga0495604_0119859_1004_1639 202
384 3300047322 Ga0495680_0118574 Ga0495680_0118574_734_1369 202
385 3300047444 Ga0495675_0030741 Ga0495675_0030741_2400_3035 202
386 3300048903 Ga0496100_0000057 Ga0496100_0000057_8189_8806 202
387 3300048904 Ga0496101_0001297 Ga0496101_0001297_9000_9617 202
388 3300048905 Ga0496102_0001628 Ga0496102_0001628_12804_13421 202
389 3300048906 Ga0496103_0003173 Ga0496103_0003173_4110_4727 202
390 3300048907 Ga0496104_0388188 Ga0496104_0388188_350_967 202
391 3300048909 Ga0496106_0000518 Ga0496106_0000518_5328_5945 202
392 3300048910 Ga0496107_0001129 Ga0496107_0001129_9000_9617 202
393 3300048911 Ga0496108_0004254 Ga0496108_0004254_2644_3261 202
394 3300048912 Ga0496109_0002432 Ga0496109_0002432_6249_6866 202
395 3300048913 Ga0496110_0022934 Ga0496110_0022934_3581_4198 202
396 3300048915 Ga0496112_0555072 Ga0496112_0555072_288_905 202
397 3300048916 Ga0496113_0030441 Ga0496113_0030441_1930_2547 202
398 3300048917 Ga0496114_0002944 Ga0496114_0002944_6357_6974 202
399 3300048918 Ga0496115_0002786 Ga0496115_0002786_8610_9227 202
400 3300048918 Ga0496115_0203225 Ga0496115_0203225_26_727 202
401 3300050490 nmdc:mga03n38_343496_c1 nmdc:mga03n38_343496_c1_24_641 202
402 3300050511 nmdc:mga08y16_12172_c1 nmdc:mga08y16_12172_c1_8266_8883 202
403 3300050511 nmdc:mga08y16_190186_c1 nmdc:mga08y16_190186_c1_991_1713 202
404 3300050512 nmdc:mga0n895_3165_c1 nmdc:mga0n895_3165_c1_3920_4537 202
405 3300050513 nmdc:mga0rr50_68891_c1 nmdc:mga0rr50_68891_c1_1128_1745 202
406 3300050515 nmdc:mga0a205_2228_c1 nmdc:mga0a205_2228_c1_6680_7297 202
407 3300053077 Ga0495601_0004041 Ga0495601_0004041_6456_7091 202
408 3300053084 Ga0495595_0000577 Ga0495595_0000577_8012_8647 202
409 3300053085 Ga0495619_0000655 Ga0495619_0000655_15784_16419 202
410 3300003911 JGI25405J52794_10058386 JGI25405J52794_100583862 203
411 3300005434 Ga0070709_10633969 Ga0070709_106339691 203
412 3300005436 Ga0070713_100010515 Ga0070713_1000105156 203
413 3300005437 Ga0070710_10013868 Ga0070710_100138683 203
414 3300005937 Ga0081455_10169393 Ga0081455_101693932 203
415 3300006028 Ga0070717_10440499 Ga0070717_104404991 203
416 3300006175 Ga0070712_100849664 Ga0070712_1008496641 203
417 3300025915 Ga0207693_10062939 Ga0207693_100629391 203
418 3300025916 Ga0207663_10059523 Ga0207663_100595231 203
419 3300025928 Ga0207700_10019506 Ga0207700_100195066 203
420 3300031241 Ga0265325_10026904 Ga0265325_100269041 203
421 3300031249 Ga0265339_10002938 Ga0265339_100029387 203
422 3300031595 Ga0265313_10005622 Ga0265313_100056224 203
423 3300048907 Ga0496104_0000932 Ga0496104_0000932_23345_24112 203
424 3300048908 Ga0496105_0019215 Ga0496105_0019215_722_1489 203
425 3300048911 Ga0496108_0021395 Ga0496108_0021395_2877_3644 203
426 3300048912 Ga0496109_0003961 Ga0496109_0003961_1132_1899 203
427 3300048913 Ga0496110_0001450 Ga0496110_0001450_12080_12847 203
428 3300048914 Ga0496111_0018065 Ga0496111_0018065_1496_2263 203
429 3300048915 Ga0496112_0105119 Ga0496112_0105119_1448_2215 203
430 3300048916 Ga0496113_0016626 Ga0496113_0016626_1854_2621 203
431 3300049573 Ga0501037_0072595 Ga0501037_0072595_609_1277 203
432 3300049579 Ga0501043_0008265 Ga0501043_0008265_5677_6345 203
433 3300049581 Ga0501047_0484377 Ga0501047_0484377_67_735 203
434 3300049582 Ga0501048_0034404 Ga0501048_0034404_240_908 203
435 3300049583 Ga0501067_0077169 Ga0501067_0077169_365_1033 203
436 3300049584 Ga0501068_0078727 Ga0501068_0078727_113_781 203
437 3300049586 Ga0501070_0087816 Ga0501070_0087816_958_1626 203
438 3300049587 Ga0501071_0023874 Ga0501071_0023874_620_1288 203
439 3300049590 Ga0501074_0071152 Ga0501074_0071152_51_719 203
440 3300049592 Ga0501076_0344339 Ga0501076_0344339_385_1053 203
441 3300049741 Ga0501079_0056842 Ga0501079_0056842_909_1577 203
442 3300049742 Ga0501080_0221649 Ga0501080_0221649_873_1541 203
443 3300049743 Ga0501081_0135744 Ga0501081_0135744_574_1242 203
444 3300049822 Ga0501035_0054697 Ga0501035_0054697_667_1335 203
445 3300006844 Ga0075428_100507572 Ga0075428_1005075722 204
446 3300006847 Ga0075431_100260622 Ga0075431_1002606222 204
447 3300006880 Ga0075429_100208466 Ga0075429_1002084661 204
448 3300050508 nmdc:mga09592_155375_c1 nmdc:mga09592_155375_c1_143_847 204
449 3300050509 nmdc:mga0qj67_53714_c1 nmdc:mga0qj67_53714_c1_926_1630 204
450 3300050510 nmdc:mga06r32_443833_c1 nmdc:mga06r32_443833_c1_12_716 204
451 3300005328 Ga0070676_10136131 Ga0070676_101361313 205
452 3300005336 Ga0070680_100172825 Ga0070680_1001728253 205
453 3300005338 Ga0068868_100379489 Ga0068868_1003794892 205
454 3300005339 Ga0070660_100100076 Ga0070660_1001000763 205
455 3300005356 Ga0070674_100142637 Ga0070674_1001426373 205
456 3300005455 Ga0070663_100130562 Ga0070663_1001305622 205
457 3300005457 Ga0070662_100235133 Ga0070662_1002351332 205
458 3300005547 Ga0070693_100013889 Ga0070693_1000138893 205
459 3300005615 Ga0070702_100700950 Ga0070702_1007009501 205
460 3300005844 Ga0068862_100313808 Ga0068862_1003138081 205
461 3300005937 Ga0081455_10006948 Ga0081455_100069486 205
462 3300006881 Ga0068865_100460130 Ga0068865_1004601302 205
463 3300009094 Ga0111539_10361669 Ga0111539_103616691 205
464 3300009551 Ga0105238_10287562 Ga0105238_102875622 205
465 3300009553 Ga0105249_10080288 Ga0105249_100802883 205
466 3300010375 Ga0105239_10074122 Ga0105239_100741222 205
467 3300021388 Ga0213875_10000567 Ga0213875_1000056730 205
468 3300025907 Ga0207645_10141903 Ga0207645_101419033 205
469 3300025911 Ga0207654_10059928 Ga0207654_100599283 205
470 3300025914 Ga0207671_10317139 Ga0207671_103171392 205
471 3300025917 Ga0207660_10136260 Ga0207660_101362603 205
472 3300025919 Ga0207657_10035478 Ga0207657_100354785 205
473 3300025921 Ga0207652_10065502 Ga0207652_100655023 205
474 3300025933 Ga0207706_10271666 Ga0207706_102716661 205
475 3300025934 Ga0207686_10020419 Ga0207686_100204194 205
476 3300028380 Ga0268265_10335815 Ga0268265_103358151 205
477 3300028381 Ga0268264_10646488 Ga0268264_106464881 205
478 3300035086 Ga0373934_0014603 Ga0373934_0014603_2220_2855 205
479 3300035111 Ga0373923_0012499 Ga0373923_0012499_267_902 205
480 3300035112 Ga0373932_0076146 Ga0373932_0076146_34_669 205
481 3300035119 Ga0373956_0003018 Ga0373956_0003018_820_1455 205
482 3300035172 Ga0373955_0006189 Ga0373955_0006189_4637_5272 205
483 3300035241 Ga0373961_0079517 Ga0373961_0079517_197_898 205
484 3300035242 Ga0373962_0054149 Ga0373962_0054149_442_1077 205
485 3300035691 Ga0373931_0032737 Ga0373931_0032737_52_753 205
486 3300035724 Ga0373933_0004423 Ga0373933_0004423_6282_6917 205
487 3300036401 Ga0373937_0011291 Ga0373937_0011291_5191_5826 205
488 3300037068 Ga0373925_0334949 Ga0373925_0334949_543_1178 205
489 3300037853 Ga0436364_0045028 Ga0436364_0045028_7063_7725 205
490 3300046454 Ga0495592_0008124 Ga0495592_0008124_1923_2558 205
491 3300046462 Ga0495651_0000493 Ga0495651_0000493_29480_30115 205
492 3300046463 Ga0495653_0004657 Ga0495653_0004657_10238_10873 205
493 3300046514 Ga0495618_0015490 Ga0495618_0015490_3011_3646 205
494 3300046516 Ga0495628_0002046 Ga0495628_0002046_10238_10873 205
495 3300046517 Ga0495630_0036431 Ga0495630_0036431_2339_2974 205
496 3300046529 Ga0495652_0011016 Ga0495652_0011016_2363_2998 205
497 3300046533 Ga0495640_0036686 Ga0495640_0036686_2123_2758 205
498 3300046536 Ga0495587_0016489 Ga0495587_0016489_3591_4226 205
499 3300046543 Ga0495645_0009419 Ga0495645_0009419_5471_6106 205
500 3300046557 Ga0495622_0148178 Ga0495622_0148178_184_819 205
501 3300046559 Ga0495667_0037159 Ga0495667_0037159_1039_1674 205
502 3300046642 Ga0495634_0063424 Ga0495634_0063424_1476_2111 205
503 3300046663 Ga0495635_0000736 Ga0495635_0000736_11313_11948 205
504 3300046675 Ga0495657_0007642 Ga0495657_0007642_3244_3879 205
505 3300046678 Ga0495599_0002064 Ga0495599_0002064_5196_5831 205
506 3300046679 Ga0495623_0002286 Ga0495623_0002286_5661_6296 205
507 3300046680 Ga0495646_0000229 Ga0495646_0000229_2272_2907 205
508 3300046681 Ga0495647_0185620 Ga0495647_0185620_44_679 205
509 3300046690 Ga0495624_0234738 Ga0495624_0234738_446_1081 205
510 3300046809 Ga0495600_0121281 Ga0495600_0121281_688_1323 205
511 3300047317 Ga0495604_0009381 Ga0495604_0009381_3515_4150 205
512 3300047319 Ga0495674_0013071 Ga0495674_0013071_1427_2062 205
513 3300047322 Ga0495680_0005567 Ga0495680_0005567_3141_3776 205
514 3300047444 Ga0495675_0013037 Ga0495675_0013037_2455_3090 205
515 3300047471 Ga0495684_0139589 Ga0495684_0139589_409_1044 205
516 3300048088 Ga0495602_0006950 Ga0495602_0006950_9501_10136 205
517 3300048904 Ga0496101_0097328 Ga0496101_0097328_1193_1828 205
518 3300048905 Ga0496102_0018224 Ga0496102_0018224_3320_3955 205
519 3300048906 Ga0496103_0011059 Ga0496103_0011059_3394_4029 205
520 3300048907 Ga0496104_0041108 Ga0496104_0041108_243_878 205
521 3300048908 Ga0496105_0021279 Ga0496105_0021279_3559_4194 205
522 3300048910 Ga0496107_0005941 Ga0496107_0005941_4106_4807 205
523 3300048911 Ga0496108_0051769 Ga0496108_0051769_631_1266 205
524 3300048915 Ga0496112_0254183 Ga0496112_0254183_892_1527 205
525 3300048917 Ga0496114_0355728 Ga0496114_0355728_290_925 205
526 3300048918 Ga0496115_0014635 Ga0496115_0014635_4009_4710 205
527 3300048918 Ga0496115_0032489 Ga0496115_0032489_1743_2378 205
528 3300049571 Ga0501034_0000032 Ga0501034_0000032_187147_187788 205
529 3300053077 Ga0495601_0066837 Ga0495601_0066837_733_1368 205
530 3300053078 Ga0495612_0007152 Ga0495612_0007152_2009_2644 205
531 3300053084 Ga0495595_0005520 Ga0495595_0005520_1927_2562 205
532 3300053085 Ga0495619_0014245 Ga0495619_0014245_2561_3196 205
533 3300006353 Ga0075370_10099418 Ga0075370_100994183 206
534 3300009147 Ga0114129_10124834 Ga0114129_101248343 206
535 3300046660 Ga0495625_0193799 Ga0495625_0193799_273_1031 206
536 3300049585 Ga0501069_0029376 Ga0501069_0029376_36_704 206
537 3300049586 Ga0501070_0002759 Ga0501070_0002759_11392_12060 206
538 3300049741 Ga0501079_0340247 Ga0501079_0340247_376_1101 206
539 3300050507 nmdc:mga05p37_262753_c1 nmdc:mga05p37_262753_c1_943_1842 206
540 3300009147 Ga0114129_10646036 Ga0114129_106460361 207
541 3300006844 Ga0075428_100410294 Ga0075428_1004102942 208
542 3300006846 Ga0075430_100074585 Ga0075430_1000745855 208
543 3300006846 Ga0075430_100092819 Ga0075430_1000928192 208
544 3300006846 Ga0075430_100281040 Ga0075430_1002810401 208
545 3300006847 Ga0075431_100171407 Ga0075431_1001714072 208
546 3300009147 Ga0114129_10970007 Ga0114129_109700071 208
547 3300009553 Ga0105249_11226388 Ga0105249_112263882 208
548 3300026078 Ga0207702_11047310 Ga0207702_110473102 208
549 3300031595 Ga0265313_10000041 Ga0265313_1000004165 208
550 3300031711 Ga0265314_10010302 Ga0265314_100103029 208
551 3300035115 Ga0373941_0003910 Ga0373941_0003910_220_885 208
552 3300049569 Ga0501032_0048692 Ga0501032_0048692_1784_2449 208
553 3300049570 Ga0501033_0055047 Ga0501033_0055047_1783_2448 208
554 3300049571 Ga0501034_0329514 Ga0501034_0329514_494_1159 208
555 3300049572 Ga0501036_0252883 Ga0501036_0252883_247_915 208
556 3300049572 Ga0501036_0361312 Ga0501036_0361312_355_1020 208
557 3300049573 Ga0501037_0044551 Ga0501037_0044551_571_1236 208
558 3300049574 Ga0501038_0049211 Ga0501038_0049211_238_903 208
559 3300049574 Ga0501038_0090742 Ga0501038_0090742_1368_2033 208
560 3300049574 Ga0501038_0149411 Ga0501038_0149411_909_1577 208
561 3300049575 Ga0501039_0248605 Ga0501039_0248605_564_1229 208
562 3300049579 Ga0501043_0184985 Ga0501043_0184985_214_879 208
563 3300049581 Ga0501047_0213511 Ga0501047_0213511_43_708 208
564 3300049586 Ga0501070_0119058 Ga0501070_0119058_1286_1951 208
565 3300049590 Ga0501074_0068958 Ga0501074_0068958_1722_2387 208
566 3300049593 Ga0501077_0415267 Ga0501077_0415267_41_709 208
567 3300049741 Ga0501079_0162003 Ga0501079_0162003_90_755 208
568 3300049742 Ga0501080_0011076 Ga0501080_0011076_1722_2387 208
569 3300049742 Ga0501080_0112526 Ga0501080_0112526_70_738 208
570 3300049742 Ga0501080_0390695 Ga0501080_0390695_241_909 208
571 3300049823 Ga0501044_0212639 Ga0501044_0212639_285_950 208
572 3300050507 nmdc:mga05p37_237562_c1 nmdc:mga05p37_237562_c1_603_1313 208
573 3300050511 nmdc:mga08y16_278261_c1 nmdc:mga08y16_278261_c1_80_790 208
574 3300053730 Ga0500645_000946 Ga0500645_000946_3421_4104 208
575 3300060353 Ga0501082_0168739 Ga0501082_0168739_456_1124 208
576 3300005347 Ga0070668_100192735 Ga0070668_1001927352 209
577 3300005439 Ga0070711_100282896 Ga0070711_1002828962 209
578 3300005530 Ga0070679_100024204 Ga0070679_1000242043 209
579 3300005548 Ga0070665_100374166 Ga0070665_1003741661 209
580 3300005614 Ga0068856_100622010 Ga0068856_1006220102 209
581 3300005843 Ga0068860_100312604 Ga0068860_1003126042 209
582 3300005981 Ga0081538_10006317 Ga0081538_100063177 209
583 3300006042 Ga0075368_10000202 Ga0075368_100002028 209
584 3300006048 Ga0075363_100015552 Ga0075363_1000155523 209
585 3300006178 Ga0075367_10000448 Ga0075367_1000044813 209
586 3300006847 Ga0075431_100010695 Ga0075431_10001069510 209
587 3300006880 Ga0075429_100249590 Ga0075429_1002495902 209
588 3300009174 Ga0105241_10052670 Ga0105241_100526702 209
589 3300013104 Ga0157370_10038246 Ga0157370_100382464 209
590 3300025917 Ga0207660_10109916 Ga0207660_101099162 209
591 3300025921 Ga0207652_10066943 Ga0207652_100669433 209
592 3300026075 Ga0207708_10163360 Ga0207708_101633601 209
593 3300026118 Ga0207675_100049572 Ga0207675_1000495722 209
594 3300026142 Ga0207698_10257026 Ga0207698_102570261 209
595 3300028380 Ga0268265_10322200 Ga0268265_103222001 209
596 3300028381 Ga0268264_10080791 Ga0268264_100807912 209
597 3300031235 Ga0265330_10048431 Ga0265330_100484312 209
598 3300031238 Ga0265332_10001311 Ga0265332_1000131113 209
599 3300031249 Ga0265339_10004703 Ga0265339_100047037 209
600 3300031712 Ga0265342_10000287 Ga0265342_100002879 209
601 3300032002 Ga0307416_100252012 Ga0307416_1002520123 209
602 3300034816 Ga0373930_0003558 Ga0373930_0003558_954_1661 209
603 3300035692 Ga0373935_0124844 Ga0373935_0124844_358_1089 209
604 3300035695 Ga0373927_0123446 Ga0373927_0123446_427_1158 209
605 3300037068 Ga0373925_0115602 Ga0373925_0115602_988_1719 209
606 3300039447 Ga0436361_0405803 Ga0436361_0405803_157_861 209
607 3300046517 Ga0495630_0143743 Ga0495630_0143743_921_1652 209
608 3300046533 Ga0495640_0038267 Ga0495640_0038267_1353_2084 209
609 3300047315 Ga0495581_0301288 Ga0495581_0301288_17_748 209
610 3300050494 nmdc:mga06z11_4532_c1 nmdc:mga06z11_4532_c1_3921_4733 209
611 3300050495 nmdc:mga04h51_1364_c1 nmdc:mga04h51_1364_c1_2462_3274 209
612 3300050509 nmdc:mga0qj67_336435_c1 nmdc:mga0qj67_336435_c1_162_1046 209
613 3300050510 nmdc:mga06r32_170835_c1 nmdc:mga06r32_170835_c1_849_1733 209
614 iso_pu_bacteria 2643221547 2643755554 209
615 3300000041 ARcpr5oldR_c000444 ARcpr5oldR_0004446 210
616 3300000042 ARSoilYngRDRAFT_c00409 ARSoilYngRDRAFT_004093 210
617 3300000043 ARcpr5yngRDRAFT_c000424 ARcpr5yngRDRAFT_0004246 210
618 3300000044 ARSoilOldRDRAFT_c000395 ARSoilOldRDRAFT_0003953 210
619 3300000045 ARCol0oldRDRAFT_c01154 ARCol0oldRDRAFT_011542 210
620 3300000652 ARCol0yngRDRAFT_1000418 ARCol0yngRDRAFT_10004186 210
621 3300005290 Ga0065712_10105365 Ga0065712_101053653 210
622 3300005293 Ga0065715_10121240 Ga0065715_101212403 210
623 3300005329 Ga0070683_100022026 Ga0070683_1000220264 210
624 3300005455 Ga0070663_100012645 Ga0070663_1000126453 210
625 3300005459 Ga0068867_100050314 Ga0068867_1000503143 210
626 3300005530 Ga0070679_100641681 Ga0070679_1006416811 210
627 3300005535 Ga0070684_100382482 Ga0070684_1003824822 210
628 3300005564 Ga0070664_100006659 Ga0070664_1000066597 210
629 3300005842 Ga0068858_100286720 Ga0068858_1002867201 210
630 3300005843 Ga0068860_100022860 Ga0068860_1000228604 210
631 3300006058 Ga0075432_10058773 Ga0075432_100587731 210
632 3300006846 Ga0075430_100178157 Ga0075430_1001781571 210
633 3300006847 Ga0075431_100252069 Ga0075431_1002520691 210
634 3300007788 Ga0099795_10020516 Ga0099795_100205161 210
635 3300009094 Ga0111539_10000932 Ga0111539_100009329 210
636 3300009147 Ga0114129_10097472 Ga0114129_100974724 210
637 3300010159 Ga0099796_10075690 Ga0099796_100756901 210
638 3300010375 Ga0105239_10528203 Ga0105239_105282032 210
639 3300012513 Ga0157326_1001336 Ga0157326_10013363 210
640 3300012515 Ga0157338_1004402 Ga0157338_10044023 210
641 3300013104 Ga0157370_10501211 Ga0157370_105012111 210
642 3300013307 Ga0157372_10085368 Ga0157372_100853684 210
643 3300014326 Ga0157380_10031602 Ga0157380_100316024 210
644 3300025315 Ga0207697_10003939 Ga0207697_100039398 210
645 3300025906 Ga0207699_10003769 Ga0207699_100037694 210
646 3300025912 Ga0207707_10454637 Ga0207707_104546372 210
647 3300025916 Ga0207663_10243886 Ga0207663_102438862 210
648 3300025937 Ga0207669_10094150 Ga0207669_100941503 210
649 3300025944 Ga0207661_10080161 Ga0207661_100801613 210
650 3300026118 Ga0207675_100172777 Ga0207675_1001727772 210
651 3300027907 Ga0207428_10000420 Ga0207428_1000042038 210
652 3300028381 Ga0268264_10196448 Ga0268264_101964482 210
653 3300031241 Ga0265325_10000105 Ga0265325_1000010549 210
654 3300031241 Ga0265325_10007640 Ga0265325_100076404 210
655 3300031247 Ga0265340_10069909 Ga0265340_100699093 210
656 3300031344 Ga0265316_10133683 Ga0265316_101336833 210
657 3300031595 Ga0265313_10014009 Ga0265313_100140095 210
658 3300034816 Ga0373930_0000557 Ga0373930_0000557_469_1164 210
659 3300034819 Ga0373958_0001091 Ga0373958_0001091_222_917 210
660 3300034820 Ga0373959_0001344 Ga0373959_0001344_557_1252 210
661 3300034957 Ga0373938_0004552 Ga0373938_0004552_49_744 210
662 3300035084 Ga0373928_0000404 Ga0373928_0000404_3469_4164 210
663 3300035085 Ga0373929_0000856 Ga0373929_0000856_5123_5818 210
664 3300035088 Ga0373940_0000069 Ga0373940_0000069_10840_11535 210
665 3300035090 Ga0373949_0002201 Ga0373949_0002201_3727_4422 210
666 3300035092 Ga0373952_0001123 Ga0373952_0001123_184_879 210
667 3300035111 Ga0373923_0000908 Ga0373923_0000908_3768_4466 210
668 3300035112 Ga0373932_0000510 Ga0373932_0000510_5388_6083 210
669 3300035114 Ga0373939_0002803 Ga0373939_0002803_709_1404 210
670 3300035115 Ga0373941_0002011 Ga0373941_0002011_848_1543 210
671 3300035116 Ga0373945_0000687 Ga0373945_0000687_7176_7874 210
672 3300035170 Ga0373943_0094844 Ga0373943_0094844_83_805 210
673 3300035207 Ga0373942_0001103 Ga0373942_0001103_3544_4239 210
674 3300035241 Ga0373961_0000636 Ga0373961_0000636_575_1270 210
675 3300035691 Ga0373931_0003707 Ga0373931_0003707_6032_6727 210
676 3300035695 Ga0373927_0006188 Ga0373927_0006188_1166_1888 210
677 3300036401 Ga0373937_0062979 Ga0373937_0062979_859_1545 210
678 3300038996 Ga0242420_004233 Ga0242420_004233_674_1369 210
679 3300042876 Ga0451577_0048381 Ga0451577_0048381_627_1322 210
680 3300046461 Ga0495641_0110662 Ga0495641_0110662_45_743 210
681 3300046678 Ga0495599_0003364 Ga0495599_0003364_5692_6390 210
682 3300046680 Ga0495646_0006372 Ga0495646_0006372_852_1550 210
683 3300048910 Ga0496107_0116749 Ga0496107_0116749_707_1402 210
684 3300048910 Ga0496107_0255663 Ga0496107_0255663_433_1140 210
685 3300049582 Ga0501048_0420371 Ga0501048_0420371_166_822 210
686 3300049591 Ga0501075_0123637 Ga0501075_0123637_1057_1713 210
687 3300049592 Ga0501076_0114009 Ga0501076_0114009_1484_2140 210
688 3300049743 Ga0501081_0153227 Ga0501081_0153227_181_837 210
689 3300050509 nmdc:mga0qj67_195263_c1 nmdc:mga0qj67_195263_c1_82_750 210
690 3300050510 nmdc:mga06r32_295679_c1 nmdc:mga06r32_295679_c1_846_1514 210
691 3300050511 nmdc:mga08y16_1989_c1 nmdc:mga08y16_1989_c1_17232_17927 210
692 3300053087 Ga0500643_006415 Ga0500643_006415_3829_4521 210
693 3300053090 Ga0500646_0084823 Ga0500646_0084823_231_911 210
694 3300053094 Ga0500566_0008779 Ga0500566_0008779_1146_1838 210
695 3300053119 Ga0500595_000144 Ga0500595_000144_32397_33089 210
696 3300054114 Ga0501084_0084712 Ga0501084_0084712_1094_1750 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

61

107

0.98

PF14246

TetR_C_7

AefR-like transcriptional repressor, C-terminal domain

130

198

0.86

PF16859

TetR_C_11

Tetracyclin repressor-like, C-terminal domain

129

231

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6azh-assembly1.cif.gz_B clostridium perfringens putative fatty acid metabolism regulator 0.8216 24 203
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.8148 22 205
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8104 22 208
5gpa-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8053 25 210
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.8024 24 210
ID Description Score Start End Superfamily
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9264 25 63 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9239 25 63 1.10.10.60
6azhB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.917 24 66 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9165 25 63 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9118 27 63 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A0Q7TPG1-F1-model_v4 HTH tetR-type domain-containing protein 0.9532 14 210 GO:0000976
GO:0003700
AF-A0A327L488-F1-model_v4 HTH tetR-type domain-containing protein 0.9466 14 210 GO:0000976
GO:0003700
AF-A0A6L5FGY3-F1-model_v4 TetR family transcriptional regulator 0.9459 22 210 GO:0000976
GO:0003700
AF-A0A127EWI0-F1-model_v4 Transcriptional regulator, TetR family 0.9379 11 210 GO:0000976
GO:0003700
AF-A0A371BD66-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9367 15 208 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
84.11 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map