F475845
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 696 | 318 | 696 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0019765|Ga0373943_0019765_185_466 |
| Length | 85 |
| Sequence | MGGMCRNIHTLFNFEPPASEDEVHGAALQYVRKVSGFTKPSQANEQVAAATARLIDALVTTAPPKDREVEAERRRERSAKRFAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 101 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 102 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 103 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 182 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 184 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 211 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 212 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 213 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 217 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 218 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 219 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.16 |
| Nodule | 0 |
| Rhizoplane | 11.93 |
| Rhizosphere | 85.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10021184 | 3300003373 | Bacteria | 1691 |
| 2 | JGI25407J50210_10084194 | 3300003373 | Bacteria | 789 |
| 3 | Ga0070658_11965389 | 3300005327 | Bacteria | 505 |
| 4 | Ga0070676_10373089 | 3300005328 | Bacteria | 986 |
| 5 | Ga0070690_100088487 | 3300005330 | Bacteria | 2036 |
| 6 | Ga0070690_100139436 | 3300005330 | Bacteria | 1645 |
| 7 | Ga0070690_101043692 | 3300005330 | Bacteria | 646 |
| 8 | Ga0070666_10219068 | 3300005335 | Bacteria | 1342 |
| 9 | Ga0070680_100050076 | 3300005336 | Bacteria | 3407 |
| 10 | Ga0070680_100053040 | 3300005336 | Bacteria | 3309 |
| 11 | Ga0070680_100800706 | 3300005336 | Bacteria | 812 |
| 12 | Ga0070680_101098288 | 3300005336 | Bacteria | 687 |
| 13 | Ga0070682_100293570 | 3300005337 | Bacteria | 1190 |
| 14 | Ga0068868_100057737 | 3300005338 | Bacteria | 3067 |
| 15 | Ga0068868_100150235 | 3300005338 | Bacteria | 1918 |
| 16 | Ga0068868_100187508 | 3300005338 | Bacteria | 1719 |
| 17 | Ga0068868_100925291 | 3300005338 | Bacteria | 794 |
| 18 | Ga0070660_100097164 | 3300005339 | Bacteria | 2330 |
| 19 | Ga0070689_100226686 | 3300005340 | Bacteria | 1535 |
| 20 | Ga0070691_10080342 | 3300005341 | Bacteria | 1596 |
| 21 | Ga0070691_10099916 | 3300005341 | Bacteria | 1440 |
| 22 | Ga0070691_10564950 | 3300005341 | Bacteria | 667 |
| 23 | Ga0070691_10814738 | 3300005341 | Bacteria | 570 |
| 24 | Ga0070687_100033984 | 3300005343 | Bacteria | 2521 |
| 25 | Ga0070687_100106830 | 3300005343 | Bacteria | 1577 |
| 26 | Ga0070661_100127074 | 3300005344 | Bacteria | 1913 |
| 27 | Ga0070692_10021909 | 3300005345 | Bacteria | 3114 |
| 28 | Ga0070692_10255794 | 3300005345 | Bacteria | 1050 |
| 29 | Ga0070669_100075770 | 3300005353 | Bacteria | 2496 |
| 30 | Ga0070669_101176318 | 3300005353 | Bacteria | 662 |
| 31 | Ga0070671_100133814 | 3300005355 | Bacteria | 2089 |
| 32 | Ga0070671_100429762 | 3300005355 | Bacteria | 1132 |
| 33 | Ga0070674_100052965 | 3300005356 | Bacteria | 2800 |
| 34 | Ga0070674_100166036 | 3300005356 | Bacteria | 1679 |
| 35 | Ga0070688_100155783 | 3300005365 | Bacteria | 1565 |
| 36 | Ga0070688_101569382 | 3300005365 | Bacteria | 537 |
| 37 | Ga0070659_100233430 | 3300005366 | Bacteria | 1520 |
| 38 | Ga0070659_101924823 | 3300005366 | Bacteria | 530 |
| 39 | Ga0070703_10220328 | 3300005406 | Bacteria | 755 |
| 40 | Ga0070709_10175103 | 3300005434 | Bacteria | 1502 |
| 41 | Ga0070709_10337355 | 3300005434 | Bacteria | 1110 |
| 42 | Ga0070714_100122115 | 3300005435 | Bacteria | 2318 |
| 43 | Ga0070714_100129462 | 3300005435 | Bacteria | 2254 |
| 44 | Ga0070714_101701952 | 3300005435 | Bacteria | 616 |
| 45 | Ga0070713_100730322 | 3300005436 | Bacteria | 946 |
| 46 | Ga0070713_101501922 | 3300005436 | Bacteria | 654 |
| 47 | Ga0070710_10034252 | 3300005437 | Bacteria | 2762 |
| 48 | Ga0070701_10007614 | 3300005438 | Bacteria | 4639 |
| 49 | Ga0070701_10008802 | 3300005438 | Bacteria | 4386 |
| 50 | Ga0070711_100005295 | 3300005439 | Bacteria | 7704 |
| 51 | Ga0070711_100169269 | 3300005439 | Bacteria | 1664 |
| 52 | Ga0070711_100205509 | 3300005439 | Bacteria | 1522 |
| 53 | Ga0070711_100661771 | 3300005439 | Bacteria | 876 |
| 54 | Ga0070711_101276558 | 3300005439 | Bacteria | 637 |
| 55 | Ga0070705_100003385 | 3300005440 | Bacteria | 7818 |
| 56 | Ga0070700_100010634 | 3300005441 | Bacteria | 5082 |
| 57 | Ga0070700_100260943 | 3300005441 | Bacteria | 1248 |
| 58 | Ga0070694_100135146 | 3300005444 | Bacteria | 1786 |
| 59 | Ga0070694_100458399 | 3300005444 | Bacteria | 1008 |
| 60 | Ga0070708_100110352 | 3300005445 | Bacteria | 2527 |
| 61 | Ga0070708_100288335 | 3300005445 | Bacteria | 1545 |
| 62 | Ga0070663_100536595 | 3300005455 | Unclassified | 976 |
| 63 | Ga0070678_100672331 | 3300005456 | Bacteria | 930 |
| 64 | Ga0070678_100854057 | 3300005456 | Bacteria | 830 |
| 65 | Ga0070678_100984296 | 3300005456 | Bacteria | 774 |
| 66 | Ga0070681_10021937 | 3300005458 | Bacteria | 6406 |
| 67 | Ga0068867_100150678 | 3300005459 | Bacteria | 1826 |
| 68 | Ga0070685_10118398 | 3300005466 | Bacteria | 1642 |
| 69 | Ga0070685_10677636 | 3300005466 | Bacteria | 750 |
| 70 | Ga0070706_100116713 | 3300005467 | Bacteria | 2486 |
| 71 | Ga0070706_100234612 | 3300005467 | Bacteria | 1713 |
| 72 | Ga0070707_100177575 | 3300005468 | Bacteria | 2076 |
| 73 | Ga0070698_100017096 | 3300005471 | Bacteria | 7646 |
| 74 | Ga0070699_100135215 | 3300005518 | Bacteria | 2175 |
| 75 | Ga0070699_100337167 | 3300005518 | Bacteria | 1357 |
| 76 | Ga0070699_100534815 | 3300005518 | Bacteria | 1066 |
| 77 | Ga0070679_101530584 | 3300005530 | Bacteria | 614 |
| 78 | Ga0070684_100006697 | 3300005535 | Bacteria | 8930 |
| 79 | Ga0070684_100020586 | 3300005535 | Bacteria | 5472 |
| 80 | Ga0070684_100156536 | 3300005535 | Bacteria | 2066 |
| 81 | Ga0070684_100465069 | 3300005535 | Bacteria | 1170 |
| 82 | Ga0070684_100549318 | 3300005535 | Bacteria | 1072 |
| 83 | Ga0070684_100790428 | 3300005535 | Unclassified | 887 |
| 84 | Ga0070684_101802004 | 3300005535 | Bacteria | 578 |
| 85 | Ga0068853_100192017 | 3300005539 | Bacteria | 1856 |
| 86 | Ga0068853_100625846 | 3300005539 | Bacteria | 1023 |
| 87 | Ga0070672_100241964 | 3300005543 | Bacteria | 1518 |
| 88 | Ga0070672_101408579 | 3300005543 | Bacteria | 624 |
| 89 | Ga0070686_100018190 | 3300005544 | Bacteria | 4119 |
| 90 | Ga0070686_100047573 | 3300005544 | Bacteria | 2712 |
| 91 | Ga0070686_100499061 | 3300005544 | Bacteria | 944 |
| 92 | Ga0070686_101534784 | 3300005544 | Bacteria | 562 |
| 93 | Ga0070695_100017405 | 3300005545 | Bacteria | 4357 |
| 94 | Ga0070695_100059120 | 3300005545 | Bacteria | 2480 |
| 95 | Ga0070696_100020918 | 3300005546 | Bacteria | 4434 |
| 96 | Ga0070696_100121166 | 3300005546 | Bacteria | 1893 |
| 97 | Ga0070693_100018095 | 3300005547 | Bacteria | 3675 |
| 98 | Ga0070693_100021785 | 3300005547 | Bacteria | 3399 |
| 99 | Ga0070693_100054746 | 3300005547 | Bacteria | 2296 |
| 100 | Ga0070704_100109126 | 3300005549 | Bacteria | 2102 |
| 101 | Ga0070664_100144377 | 3300005564 | Bacteria | 2098 |
| 102 | Ga0068857_102455766 | 3300005577 | Bacteria | 512 |
| 103 | Ga0068856_100112299 | 3300005614 | Bacteria | 2723 |
| 104 | Ga0068856_100188380 | 3300005614 | Bacteria | 2077 |
| 105 | Ga0068856_100296614 | 3300005614 | Bacteria | 1634 |
| 106 | Ga0068856_101294970 | 3300005614 | Bacteria | 744 |
| 107 | Ga0068856_101781248 | 3300005614 | Bacteria | 628 |
| 108 | Ga0068856_102506794 | 3300005614 | Bacteria | 522 |
| 109 | Ga0070702_100018341 | 3300005615 | Bacteria | 3630 |
| 110 | Ga0070702_100019258 | 3300005615 | Bacteria | 3556 |
| 111 | Ga0070702_100145094 | 3300005615 | Bacteria | 1516 |
| 112 | Ga0070702_100339215 | 3300005615 | Bacteria | 1054 |
| 113 | Ga0068852_100066678 | 3300005616 | Bacteria | 3144 |
| 114 | Ga0068852_101563486 | 3300005616 | Bacteria | 682 |
| 115 | Ga0068859_100111263 | 3300005617 | Bacteria | 2801 |
| 116 | Ga0068859_102615070 | 3300005617 | Bacteria | 555 |
| 117 | Ga0068864_100166944 | 3300005618 | Bacteria | 2004 |
| 118 | Ga0068864_100537376 | 3300005618 | Bacteria | 1128 |
| 119 | Ga0068864_100707218 | 3300005618 | Bacteria | 985 |
| 120 | Ga0068866_10012856 | 3300005718 | Bacteria | 3656 |
| 121 | Ga0068866_10019471 | 3300005718 | Bacteria | 3091 |
| 122 | Ga0068866_11118390 | 3300005718 | Bacteria | 565 |
| 123 | Ga0068861_100403037 | 3300005719 | Bacteria | 1214 |
| 124 | Ga0068870_10258637 | 3300005840 | Bacteria | 1082 |
| 125 | Ga0068870_10510676 | 3300005840 | Bacteria | 803 |
| 126 | Ga0068858_100103031 | 3300005842 | Bacteria | 2662 |
| 127 | Ga0068862_100149026 | 3300005844 | Bacteria | 2081 |
| 128 | Ga0081455_10007478 | 3300005937 | Bacteria | 11503 |
| 129 | Ga0081455_10105305 | 3300005937 | Bacteria | 2254 |
| 130 | Ga0081538_10001960 | 3300005981 | Bacteria | 20612 |
| 131 | Ga0081538_10002508 | 3300005981 | Bacteria | 17875 |
| 132 | Ga0081538_10002566 | 3300005981 | Bacteria | 17640 |
| 133 | Ga0081538_10004666 | 3300005981 | Bacteria | 12565 |
| 134 | Ga0081538_10009134 | 3300005981 | Bacteria | 8314 |
| 135 | Ga0081538_10011726 | 3300005981 | Bacteria | 7075 |
| 136 | Ga0081538_10011801 | 3300005981 | Bacteria | 7051 |
| 137 | Ga0081538_10016040 | 3300005981 | Bacteria | 5765 |
| 138 | Ga0081538_10040648 | 3300005981 | Bacteria | 2963 |
| 139 | Ga0081538_10043061 | 3300005981 | Bacteria | 2841 |
| 140 | Ga0081538_10043342 | 3300005981 | Bacteria | 2827 |
| 141 | Ga0081538_10138225 | 3300005981 | Bacteria | 1129 |
| 142 | Ga0081538_10160454 | 3300005981 | Bacteria | 1000 |
| 143 | Ga0081540_1010122 | 3300005983 | Bacteria | 6419 |
| 144 | Ga0081540_1197022 | 3300005983 | Bacteria | 736 |
| 145 | Ga0081539_10154109 | 3300005985 | Bacteria | 1102 |
| 146 | Ga0070717_10220519 | 3300006028 | Bacteria | 1667 |
| 147 | Ga0070717_10250716 | 3300006028 | Bacteria | 1564 |
| 148 | Ga0075365_10011921 | 3300006038 | Bacteria | 5135 |
| 149 | Ga0075365_10020204 | 3300006038 | Bacteria | 4125 |
| 150 | Ga0075365_10193190 | 3300006038 | Bacteria | 1425 |
| 151 | Ga0075365_11053908 | 3300006038 | Bacteria | 573 |
| 152 | Ga0075363_100030031 | 3300006048 | Bacteria | 2811 |
| 153 | Ga0075363_100858746 | 3300006048 | Bacteria | 554 |
| 154 | Ga0075364_10110756 | 3300006051 | Bacteria | 1832 |
| 155 | Ga0075364_10318677 | 3300006051 | Bacteria | 1059 |
| 156 | Ga0075432_10053194 | 3300006058 | Bacteria | 1431 |
| 157 | Ga0075432_10108741 | 3300006058 | Unclassified | 1031 |
| 158 | Ga0070715_10000495 | 3300006163 | Bacteria | 10272 |
| 159 | Ga0070715_10029689 | 3300006163 | Bacteria | 2204 |
| 160 | Ga0070715_10239938 | 3300006163 | Bacteria | 942 |
| 161 | Ga0070716_101066677 | 3300006173 | Bacteria | 642 |
| 162 | Ga0070712_100000012 | 3300006175 | Bacteria | 118838 |
| 163 | Ga0070712_100060393 | 3300006175 | Bacteria | 2673 |
| 164 | Ga0070712_100568582 | 3300006175 | Bacteria | 957 |
| 165 | Ga0070712_100679565 | 3300006175 | Bacteria | 876 |
| 166 | Ga0070712_101748251 | 3300006175 | Bacteria | 544 |
| 167 | Ga0075362_10262768 | 3300006177 | Bacteria | 851 |
| 168 | Ga0075367_10949822 | 3300006178 | Bacteria | 548 |
| 169 | Ga0097621_100460078 | 3300006237 | Bacteria | 1147 |
| 170 | Ga0075428_100107582 | 3300006844 | Bacteria | 3039 |
| 171 | Ga0075430_100228590 | 3300006846 | Bacteria | 1543 |
| 172 | Ga0075430_100456027 | 3300006846 | Bacteria | 1055 |
| 173 | Ga0075431_100381989 | 3300006847 | Bacteria | 1412 |
| 174 | Ga0075431_100666609 | 3300006847 | Bacteria | 1020 |
| 175 | Ga0075431_101888886 | 3300006847 | Bacteria | 553 |
| 176 | Ga0075433_10299799 | 3300006852 | Bacteria | 1423 |
| 177 | Ga0075433_10331953 | 3300006852 | Bacteria | 1345 |
| 178 | Ga0075433_10519590 | 3300006852 | Bacteria | 1047 |
| 179 | Ga0075434_100199305 | 3300006871 | Bacteria | 2021 |
| 180 | Ga0075434_100366150 | 3300006871 | Bacteria | 1462 |
| 181 | Ga0075434_100386849 | 3300006871 | Bacteria | 1420 |
| 182 | Ga0075434_101215764 | 3300006871 | Bacteria | 765 |
| 183 | Ga0068865_100076837 | 3300006881 | Bacteria | 2385 |
| 184 | Ga0075436_100005811 | 3300006914 | Bacteria | 8471 |
| 185 | Ga0075436_100166322 | 3300006914 | Bacteria | 1556 |
| 186 | Ga0075436_100260819 | 3300006914 | Bacteria | 1236 |
| 187 | Ga0097620_100111263 | 3300006931 | Bacteria | 2801 |
| 188 | Ga0097620_102615167 | 3300006931 | Bacteria | 555 |
| 189 | Ga0075435_100026571 | 3300007076 | Bacteria | 4518 |
| 190 | Ga0075435_100175518 | 3300007076 | Bacteria | 1809 |
| 191 | Ga0075435_100374808 | 3300007076 | Bacteria | 1222 |
| 192 | Ga0075435_100445515 | 3300007076 | Bacteria | 1116 |
| 193 | Ga0105250_10441324 | 3300009092 | Bacteria | 583 |
| 194 | Ga0105240_10328973 | 3300009093 | Bacteria | 1739 |
| 195 | Ga0105240_10968291 | 3300009093 | Bacteria | 912 |
| 196 | Ga0111539_10041528 | 3300009094 | Bacteria | 5530 |
| 197 | Ga0111539_10355322 | 3300009094 | Bacteria | 1705 |
| 198 | Ga0111539_11199630 | 3300009094 | Bacteria | 881 |
| 199 | Ga0111539_11983094 | 3300009094 | Bacteria | 675 |
| 200 | Ga0105245_10000438 | 3300009098 | Bacteria | 38412 |
| 201 | Ga0105245_10011634 | 3300009098 | Bacteria | 7660 |
| 202 | Ga0105245_10112892 | 3300009098 | Bacteria | 2530 |
| 203 | Ga0105245_10159400 | 3300009098 | Bacteria | 2140 |
| 204 | Ga0105245_10510630 | 3300009098 | Bacteria | 1219 |
| 205 | Ga0105245_12093121 | 3300009098 | Bacteria | 620 |
| 206 | Ga0105247_10016614 | 3300009101 | Bacteria | 4412 |
| 207 | Ga0105247_10767344 | 3300009101 | Bacteria | 732 |
| 208 | Ga0114129_10061875 | 3300009147 | Bacteria | 5231 |
| 209 | Ga0114129_10080698 | 3300009147 | Bacteria | 4522 |
| 210 | Ga0114129_10155732 | 3300009147 | Bacteria | 3125 |
| 211 | Ga0114129_10177731 | 3300009147 | Bacteria | 2898 |
| 212 | Ga0114129_10256293 | 3300009147 | Bacteria | 2347 |
| 213 | Ga0114129_10560216 | 3300009147 | Bacteria | 1485 |
| 214 | Ga0114129_10589599 | 3300009147 | Bacteria | 1441 |
| 215 | Ga0114129_11779054 | 3300009147 | Bacteria | 750 |
| 216 | Ga0114129_12026956 | 3300009147 | Bacteria | 695 |
| 217 | Ga0114129_12062753 | 3300009147 | Bacteria | 689 |
| 218 | Ga0114129_12646663 | 3300009147 | Bacteria | 598 |
| 219 | Ga0105243_10057760 | 3300009148 | Bacteria | 3091 |
| 220 | Ga0105243_10064578 | 3300009148 | Bacteria | 2938 |
| 221 | Ga0105243_10153368 | 3300009148 | Bacteria | 1979 |
| 222 | Ga0105243_10551995 | 3300009148 | Bacteria | 1101 |
| 223 | Ga0105243_12653208 | 3300009148 | Bacteria | 541 |
| 224 | Ga0105241_10326989 | 3300009174 | Bacteria | 1324 |
| 225 | Ga0105241_10634788 | 3300009174 | Unclassified | 968 |
| 226 | Ga0105242_10037976 | 3300009176 | Bacteria | 3870 |
| 227 | Ga0105242_10048158 | 3300009176 | Bacteria | 3463 |
| 228 | Ga0105242_10073924 | 3300009176 | Bacteria | 2835 |
| 229 | Ga0105242_12212014 | 3300009176 | Bacteria | 595 |
| 230 | Ga0105248_10132102 | 3300009177 | Bacteria | 2817 |
| 231 | Ga0105248_10402244 | 3300009177 | Bacteria | 1542 |
| 232 | Ga0105248_11127871 | 3300009177 | Bacteria | 886 |
| 233 | Ga0105248_11982758 | 3300009177 | Bacteria | 661 |
| 234 | Ga0105237_10001241 | 3300009545 | Bacteria | 34013 |
| 235 | Ga0105237_11123617 | 3300009545 | Bacteria | 792 |
| 236 | Ga0105237_12109555 | 3300009545 | Bacteria | 573 |
| 237 | Ga0105237_12367658 | 3300009545 | Bacteria | 541 |
| 238 | Ga0105238_10167241 | 3300009551 | Bacteria | 2175 |
| 239 | Ga0105249_10077959 | 3300009553 | Bacteria | 3074 |
| 240 | Ga0105249_10139821 | 3300009553 | Bacteria | 2320 |
| 241 | Ga0105249_10226499 | 3300009553 | Bacteria | 1842 |
| 242 | Ga0105249_10510123 | 3300009553 | Bacteria | 1249 |
| 243 | Ga0105249_12449475 | 3300009553 | Bacteria | 594 |
| 244 | Ga0105249_13456085 | 3300009553 | Bacteria | 508 |
| 245 | Ga0105239_10234284 | 3300010375 | Bacteria | 2060 |
| 246 | Ga0105239_10569018 | 3300010375 | Bacteria | 1291 |
| 247 | Ga0105239_10904316 | 3300010375 | Bacteria | 1013 |
| 248 | Ga0105239_12011416 | 3300010375 | Bacteria | 671 |
| 249 | Ga0105239_12527219 | 3300010375 | Bacteria | 599 |
| 250 | Ga0105239_12774107 | 3300010375 | Bacteria | 572 |
| 251 | Ga0105246_10449155 | 3300011119 | Bacteria | 1083 |
| 252 | Ga0157329_1016661 | 3300012491 | Bacteria | 648 |
| 253 | Ga0157345_1009168 | 3300012498 | Bacteria | 840 |
| 254 | Ga0157347_1011188 | 3300012502 | Bacteria | 951 |
| 255 | Ga0157315_1067161 | 3300012508 | Bacteria | 519 |
| 256 | Ga0157373_10365092 | 3300013100 | Bacteria | 1031 |
| 257 | Ga0157371_10042662 | 3300013102 | Bacteria | 3233 |
| 258 | Ga0157370_10658974 | 3300013104 | Bacteria | 956 |
| 259 | Ga0157370_11077329 | 3300013104 | Bacteria | 726 |
| 260 | Ga0157369_10844686 | 3300013105 | Bacteria | 940 |
| 261 | Ga0163162_10066115 | 3300013306 | Bacteria | 3664 |
| 262 | Ga0157372_10464310 | 3300013307 | Bacteria | 1475 |
| 263 | Ga0157372_10892395 | 3300013307 | Bacteria | 1032 |
| 264 | Ga0157372_11435744 | 3300013307 | Bacteria | 795 |
| 265 | Ga0157375_10226983 | 3300013308 | Bacteria | 2026 |
| 266 | Ga0157375_10483647 | 3300013308 | Bacteria | 1403 |
| 267 | Ga0157375_11079152 | 3300013308 | Bacteria | 939 |
| 268 | Ga0163163_11187903 | 3300014325 | Bacteria | 825 |
| 269 | Ga0163163_11683161 | 3300014325 | Bacteria | 695 |
| 270 | Ga0163163_12430830 | 3300014325 | Bacteria | 582 |
| 271 | Ga0157380_10087295 | 3300014326 | Bacteria | 2564 |
| 272 | Ga0157380_10338911 | 3300014326 | Bacteria | 1402 |
| 273 | Ga0157380_13544168 | 3300014326 | Bacteria | 500 |
| 274 | Ga0157377_10610317 | 3300014745 | Bacteria | 779 |
| 275 | Ga0157379_10093938 | 3300014968 | Bacteria | 2691 |
| 276 | Ga0157376_12535651 | 3300014969 | Bacteria | 552 |
| 277 | Ga0157376_12645324 | 3300014969 | Bacteria | 542 |
| 278 | Ga0163161_10295322 | 3300017792 | Bacteria | 1275 |
| 279 | Ga0163161_10642490 | 3300017792 | Bacteria | 878 |
| 280 | Ga0206353_10290208 | 3300020082 | Bacteria | 810 |
| 281 | Ga0206353_10988080 | 3300020082 | Bacteria | 967 |
| 282 | Ga0206353_12036647 | 3300020082 | Bacteria | 1251 |
| 283 | Ga0207653_10001268 | 3300025885 | Bacteria | 8234 |
| 284 | Ga0207653_10246722 | 3300025885 | Bacteria | 683 |
| 285 | Ga0207642_10026907 | 3300025899 | Bacteria | 2348 |
| 286 | Ga0207642_10304142 | 3300025899 | Bacteria | 925 |
| 287 | Ga0207642_10501675 | 3300025899 | Bacteria | 743 |
| 288 | Ga0207710_10212642 | 3300025900 | Bacteria | 958 |
| 289 | Ga0207688_10087669 | 3300025901 | Bacteria | 1784 |
| 290 | Ga0207647_10287451 | 3300025904 | Bacteria | 938 |
| 291 | Ga0207685_10004045 | 3300025905 | Bacteria | 3666 |
| 292 | Ga0207685_10125879 | 3300025905 | Bacteria | 1131 |
| 293 | Ga0207699_10058481 | 3300025906 | Bacteria | 2306 |
| 294 | Ga0207643_10270978 | 3300025908 | Bacteria | 1050 |
| 295 | Ga0207643_10953197 | 3300025908 | Bacteria | 555 |
| 296 | Ga0207684_10120613 | 3300025910 | Bacteria | 2248 |
| 297 | Ga0207654_10248734 | 3300025911 | Bacteria | 1191 |
| 298 | Ga0207654_10551209 | 3300025911 | Bacteria | 819 |
| 299 | Ga0207671_10000770 | 3300025914 | Bacteria | 40613 |
| 300 | Ga0207693_10000030 | 3300025915 | Bacteria | 118049 |
| 301 | Ga0207693_10027562 | 3300025915 | Bacteria | 4490 |
| 302 | Ga0207693_10038032 | 3300025915 | Unclassified | 3790 |
| 303 | Ga0207693_10266996 | 3300025915 | Bacteria | 1341 |
| 304 | Ga0207693_10726408 | 3300025915 | Bacteria | 768 |
| 305 | Ga0207663_10242571 | 3300025916 | Bacteria | 1322 |
| 306 | Ga0207660_10017777 | 3300025917 | Bacteria | 4731 |
| 307 | Ga0207660_10419227 | 3300025917 | Bacteria | 1080 |
| 308 | Ga0207657_10197949 | 3300025919 | Bacteria | 1617 |
| 309 | Ga0207657_10222850 | 3300025919 | Bacteria | 1510 |
| 310 | Ga0207649_10212382 | 3300025920 | Bacteria | 1374 |
| 311 | Ga0207646_10625728 | 3300025922 | Bacteria | 965 |
| 312 | Ga0207681_10787994 | 3300025923 | Bacteria | 794 |
| 313 | Ga0207694_10213437 | 3300025924 | Bacteria | 1573 |
| 314 | Ga0207694_11769681 | 3300025924 | Bacteria | 519 |
| 315 | Ga0207650_10358620 | 3300025925 | Bacteria | 1201 |
| 316 | Ga0207650_11498320 | 3300025925 | Bacteria | 573 |
| 317 | Ga0207687_10000075 | 3300025927 | Bacteria | 71856 |
| 318 | Ga0207687_10055695 | 3300025927 | Bacteria | 2772 |
| 319 | Ga0207700_11120389 | 3300025928 | Bacteria | 703 |
| 320 | Ga0207700_11683181 | 3300025928 | Bacteria | 560 |
| 321 | Ga0207664_10721618 | 3300025929 | Bacteria | 896 |
| 322 | Ga0207664_10935981 | 3300025929 | Bacteria | 777 |
| 323 | Ga0207664_11388042 | 3300025929 | Bacteria | 623 |
| 324 | Ga0207644_10074347 | 3300025931 | Bacteria | 2494 |
| 325 | Ga0207644_10733419 | 3300025931 | Bacteria | 825 |
| 326 | Ga0207690_10289437 | 3300025932 | Bacteria | 1278 |
| 327 | Ga0207690_10538398 | 3300025932 | Bacteria | 948 |
| 328 | Ga0207706_10026648 | 3300025933 | Bacteria | 5174 |
| 329 | Ga0207686_10142767 | 3300025934 | Bacteria | 1657 |
| 330 | Ga0207709_10244871 | 3300025935 | Bacteria | 1306 |
| 331 | Ga0207670_10062758 | 3300025936 | Bacteria | 2540 |
| 332 | Ga0207669_10803380 | 3300025937 | Bacteria | 780 |
| 333 | Ga0207704_10055419 | 3300025938 | Bacteria | 2423 |
| 334 | Ga0207704_10529894 | 3300025938 | Bacteria | 954 |
| 335 | Ga0207665_10003333 | 3300025939 | Bacteria | 10764 |
| 336 | Ga0207665_10024121 | 3300025939 | Bacteria | 4009 |
| 337 | Ga0207691_10805454 | 3300025940 | Bacteria | 789 |
| 338 | Ga0207711_10108052 | 3300025941 | Bacteria | 2471 |
| 339 | Ga0207711_10816874 | 3300025941 | Bacteria | 868 |
| 340 | Ga0207711_11555004 | 3300025941 | Bacteria | 605 |
| 341 | Ga0207711_12105304 | 3300025941 | Bacteria | 507 |
| 342 | Ga0207689_11464107 | 3300025942 | Bacteria | 571 |
| 343 | Ga0207661_10007432 | 3300025944 | Bacteria | 7799 |
| 344 | Ga0207661_10430586 | 3300025944 | Bacteria | 1199 |
| 345 | Ga0207679_10011719 | 3300025945 | Bacteria | 5692 |
| 346 | Ga0207679_10578467 | 3300025945 | Bacteria | 1010 |
| 347 | Ga0207667_10039317 | 3300025949 | Bacteria | 5043 |
| 348 | Ga0207667_11074930 | 3300025949 | Bacteria | 789 |
| 349 | Ga0207667_11478830 | 3300025949 | Bacteria | 651 |
| 350 | Ga0207651_10791455 | 3300025960 | Bacteria | 840 |
| 351 | Ga0207712_10150907 | 3300025961 | Bacteria | 1795 |
| 352 | Ga0207712_10259495 | 3300025961 | Bacteria | 1409 |
| 353 | Ga0207712_10364425 | 3300025961 | Bacteria | 1205 |
| 354 | Ga0207668_10288660 | 3300025972 | Bacteria | 1349 |
| 355 | Ga0207668_10460951 | 3300025972 | Bacteria | 1087 |
| 356 | Ga0207668_10682151 | 3300025972 | Bacteria | 902 |
| 357 | Ga0207640_11571369 | 3300025981 | Bacteria | 592 |
| 358 | Ga0207677_10055941 | 3300026023 | Bacteria | 2700 |
| 359 | Ga0207703_10130559 | 3300026035 | Bacteria | 2169 |
| 360 | Ga0207639_10575475 | 3300026041 | Bacteria | 1036 |
| 361 | Ga0207708_10036676 | 3300026075 | Bacteria | 3733 |
| 362 | Ga0207708_10060336 | 3300026075 | Bacteria | 2895 |
| 363 | Ga0207708_10568818 | 3300026075 | Bacteria | 957 |
| 364 | Ga0207702_10011983 | 3300026078 | Bacteria | 7208 |
| 365 | Ga0207702_10108827 | 3300026078 | Bacteria | 2460 |
| 366 | Ga0207702_10133539 | 3300026078 | Bacteria | 2236 |
| 367 | Ga0207641_12019766 | 3300026088 | Bacteria | 578 |
| 368 | Ga0207648_10016547 | 3300026089 | Bacteria | 6735 |
| 369 | Ga0207648_10021170 | 3300026089 | Bacteria | 5846 |
| 370 | Ga0207648_10114958 | 3300026089 | Bacteria | 2364 |
| 371 | Ga0207648_10464256 | 3300026089 | Bacteria | 1154 |
| 372 | Ga0207648_10980948 | 3300026089 | Bacteria | 791 |
| 373 | Ga0207676_10043299 | 3300026095 | Bacteria | 3466 |
| 374 | Ga0207676_10113004 | 3300026095 | Bacteria | 2276 |
| 375 | Ga0207674_11845896 | 3300026116 | Bacteria | 571 |
| 376 | Ga0207675_100067443 | 3300026118 | Bacteria | 3345 |
| 377 | Ga0207675_100134900 | 3300026118 | Bacteria | 2341 |
| 378 | Ga0207675_100272538 | 3300026118 | Bacteria | 1643 |
| 379 | Ga0207675_101156194 | 3300026118 | Bacteria | 794 |
| 380 | Ga0207683_10032315 | 3300026121 | Bacteria | 4546 |
| 381 | Ga0207683_10229859 | 3300026121 | Bacteria | 1691 |
| 382 | Ga0207683_10292946 | 3300026121 | Bacteria | 1488 |
| 383 | Ga0207683_10407459 | 3300026121 | Bacteria | 1251 |
| 384 | Ga0207698_10097364 | 3300026142 | Bacteria | 2428 |
| 385 | Ga0207698_10243536 | 3300026142 | Bacteria | 1640 |
| 386 | Ga0209998_10033807 | 3300027717 | Bacteria | 1141 |
| 387 | Ga0207428_10013670 | 3300027907 | Bacteria | 7080 |
| 388 | Ga0207428_10817237 | 3300027907 | Bacteria | 662 |
| 389 | Ga0207428_11130245 | 3300027907 | Unclassified | 547 |
| 390 | Ga0268265_10064059 | 3300028380 | Bacteria | 2831 |
| 391 | Ga0268264_10120583 | 3300028381 | Bacteria | 2311 |
| 392 | Ga0268264_12359803 | 3300028381 | Bacteria | 538 |
| 393 | Ga0307410_10538271 | 3300031852 | Bacteria | 966 |
| 394 | Ga0307409_100148564 | 3300031995 | Bacteria | 2031 |
| 395 | Ga0307416_100797732 | 3300032002 | Bacteria | 1040 |
| 396 | Ga0307416_101491172 | 3300032002 | Bacteria | 782 |
| 397 | Ga0307414_11618413 | 3300032004 | Bacteria | 604 |
| 398 | Ga0307415_100484234 | 3300032126 | Bacteria | 1078 |
| 399 | Ga0373948_0038603 | 3300034817 | Bacteria | 991 |
| 400 | Ga0373938_0002635 | 3300034957 | Bacteria | 2895 |
| 401 | Ga0373938_0153603 | 3300034957 | Bacteria | 614 |
| 402 | Ga0373926_0375091 | 3300035083 | Bacteria | 560 |
| 403 | Ga0373928_0001755 | 3300035084 | Bacteria | 4223 |
| 404 | Ga0373940_0021716 | 3300035088 | Bacteria | 1644 |
| 405 | Ga0373944_0009900 | 3300035089 | Bacteria | 2591 |
| 406 | Ga0373949_0008702 | 3300035090 | Bacteria | 2222 |
| 407 | Ga0373949_0099248 | 3300035090 | Bacteria | 796 |
| 408 | Ga0373951_0053886 | 3300035091 | Bacteria | 994 |
| 409 | Ga0373952_0021658 | 3300035092 | Bacteria | 1358 |
| 410 | Ga0373952_0162362 | 3300035092 | Bacteria | 634 |
| 411 | Ga0373923_0544975 | 3300035111 | Bacteria | 568 |
| 412 | Ga0373932_0007185 | 3300035112 | Bacteria | 2646 |
| 413 | Ga0373941_0028490 | 3300035115 | Bacteria | 1640 |
| 414 | Ga0373941_0345612 | 3300035115 | Bacteria | 604 |
| 415 | Ga0373945_0160545 | 3300035116 | Bacteria | 916 |
| 416 | Ga0373945_0297487 | 3300035116 | Bacteria | 691 |
| 417 | Ga0373953_0307113 | 3300035117 | Bacteria | 693 |
| 418 | Ga0373956_0232241 | 3300035119 | Bacteria | 876 |
| 419 | Ga0373960_0047071 | 3300035121 | Bacteria | 1267 |
| 420 | Ga0373943_0019765 | 3300035170 | Bacteria | 3101 |
| 421 | Ga0373943_0029115 | 3300035170 | Bacteria | 2608 |
| 422 | Ga0373946_0041418 | 3300035171 | Bacteria | 1889 |
| 423 | Ga0373942_0195777 | 3300035207 | Bacteria | 668 |
| 424 | Ga0373961_0013528 | 3300035241 | Bacteria | 2059 |
| 425 | Ga0373962_0002078 | 3300035242 | Bacteria | 4780 |
| 426 | Ga0373962_0050513 | 3300035242 | Bacteria | 1198 |
| 427 | Ga0373931_0035482 | 3300035691 | Bacteria | 2593 |
| 428 | Ga0373931_0566719 | 3300035691 | Bacteria | 739 |
| 429 | Ga0373947_0008966 | 3300035725 | Bacteria | 5749 |
| 430 | Ga0373925_0103348 | 3300037068 | Bacteria | 2193 |
| 431 | Ga0395899_0037746 | 3300037312 | Bacteria | 3620 |
| 432 | Ga0395899_0041313 | 3300037312 | Bacteria | 3446 |
| 433 | Ga0395899_0634737 | 3300037312 | Bacteria | 677 |
| 434 | Ga0395900_0005605 | 3300037418 | Bacteria | 13128 |
| 435 | Ga0395900_0117068 | 3300037418 | Bacteria | 2734 |
| 436 | Ga0395900_0202426 | 3300037418 | Bacteria | 2008 |
| 437 | Ga0395900_0304553 | 3300037418 | Bacteria | 1578 |
| 438 | Ga0395900_0638859 | 3300037418 | Bacteria | 1002 |
| 439 | Ga0395900_0772238 | 3300037418 | Bacteria | 890 |
| 440 | Ga0395900_0813165 | 3300037418 | Bacteria | 862 |
| 441 | Ga0395900_1574161 | 3300037418 | Bacteria | 569 |
| 442 | Ga0395898_0018531 | 3300037466 | Bacteria | 7095 |
| 443 | Ga0395898_0072155 | 3300037466 | Bacteria | 3335 |
| 444 | Ga0395898_0621979 | 3300037466 | Bacteria | 1022 |
| 445 | Ga0395898_1337198 | 3300037466 | Bacteria | 645 |
| 446 | Ga0395905_0017416 | 3300037471 | Bacteria | 6821 |
| 447 | Ga0395905_0053061 | 3300037471 | Bacteria | 3795 |
| 448 | Ga0395905_0381323 | 3300037471 | Bacteria | 1304 |
| 449 | Ga0395905_0428913 | 3300037471 | Bacteria | 1219 |
| 450 | Ga0395901_0010517 | 3300038443 | Bacteria | 9371 |
| 451 | Ga0395901_0079204 | 3300038443 | Bacteria | 3430 |
| 452 | Ga0395901_0138821 | 3300038443 | Bacteria | 2555 |
| 453 | Ga0395901_0648951 | 3300038443 | Bacteria | 1059 |
| 454 | Ga0395901_1259423 | 3300038443 | Bacteria | 703 |
| 455 | Ga0395901_1792898 | 3300038443 | Bacteria | 563 |
| 456 | Ga0451845_0864229 | 3300041501 | Bacteria | 706 |
| 457 | Ga0451849_0034861 | 3300041505 | Bacteria | 568 |
| 458 | Ga0451851_0347102 | 3300041507 | Bacteria | 673 |
| 459 | Ga0451843_1106634 | 3300041509 | Bacteria | 543 |
| 460 | Ga0451853_3133616 | 3300041512 | Bacteria | 1435 |
| 461 | Ga0451853_3586855 | 3300041512 | Bacteria | 1689 |
| 462 | Ga0439448_0028095 | 3300042005 | Bacteria | 1775 |
| 463 | Ga0439448_0042866 | 3300042005 | Bacteria | 1468 |
| 464 | Ga0439455_0042830 | 3300042012 | Bacteria | 1164 |
| 465 | Ga0439463_015226 | 3300042016 | Bacteria | 1902 |
| 466 | Ga0439458_0042246 | 3300042157 | Bacteria | 1109 |
| 467 | Ga0439464_0155349 | 3300042439 | Bacteria | 717 |
| 468 | Ga0439460_0035970 | 3300042461 | Bacteria | 1434 |
| 469 | Ga0450916_050459 | 3300042530 | Bacteria | 655 |
| 470 | Ga0466969_0224359 | 3300044656 | Bacteria | 854 |
| 471 | Ga0466966_0056774 | 3300044684 | Bacteria | 2476 |
| 472 | Ga0466961_0048829 | 3300044693 | Bacteria | 2705 |
| 473 | Ga0466963_1333787 | 3300044694 | Bacteria | 503 |
| 474 | Ga0466964_0183442 | 3300044706 | Bacteria | 994 |
| 475 | Ga0466964_0331501 | 3300044706 | Bacteria | 776 |
| 476 | Ga0466971_0374438 | 3300044719 | Bacteria | 691 |
| 477 | Ga0466968_0511629 | 3300044735 | Bacteria | 599 |
| 478 | Ga0466959_0082180 | 3300045049 | Bacteria | 2321 |
| 479 | Ga0451576_0123507 | 3300045051 | Bacteria | 2696 |
| 480 | Ga0466958_0382127 | 3300045836 | Bacteria | 908 |
| 481 | Ga0466958_0823067 | 3300045836 | Bacteria | 605 |
| 482 | Ga0466967_0006817 | 3300045976 | Bacteria | 8143 |
| 483 | Ga0466967_0430820 | 3300045976 | Bacteria | 1287 |
| 484 | Ga0466967_1409751 | 3300045976 | Bacteria | 694 |
| 485 | Ga0495603_0003706 | 3300046455 | Bacteria | 9097 |
| 486 | Ga0495591_146452 | 3300046458 | Bacteria | 568 |
| 487 | Ga0495641_0005237 | 3300046461 | Bacteria | 8836 |
| 488 | Ga0495641_0063001 | 3300046461 | Bacteria | 1672 |
| 489 | Ga0495653_0656485 | 3300046463 | Bacteria | 640 |
| 490 | Ga0495582_0058980 | 3300046473 | Bacteria | 2117 |
| 491 | Ga0495582_0105401 | 3300046473 | Bacteria | 1581 |
| 492 | Ga0495582_0614792 | 3300046473 | Bacteria | 629 |
| 493 | Ga0495639_0364190 | 3300046475 | Bacteria | 727 |
| 494 | Ga0495584_0133942 | 3300046491 | Bacteria | 1258 |
| 495 | Ga0495584_0308492 | 3300046491 | Bacteria | 804 |
| 496 | Ga0495585_0361558 | 3300046492 | Bacteria | 704 |
| 497 | Ga0495594_0000927 | 3300046499 | Bacteria | 15176 |
| 498 | Ga0495630_0001557 | 3300046517 | Bacteria | 15924 |
| 499 | Ga0495630_0038975 | 3300046517 | Bacteria | 3554 |
| 500 | Ga0495663_0319379 | 3300046525 | Bacteria | 562 |
| 501 | Ga0495666_0017192 | 3300046526 | Bacteria | 3602 |
| 502 | Ga0495652_0036488 | 3300046529 | Bacteria | 4274 |
| 503 | Ga0495665_0158964 | 3300046531 | Bacteria | 1178 |
| 504 | Ga0495665_0335675 | 3300046531 | Bacteria | 771 |
| 505 | Ga0495640_0817169 | 3300046533 | Bacteria | 555 |
| 506 | Ga0495588_0003423 | 3300046674 | Bacteria | 6894 |
| 507 | Ga0495588_0586760 | 3300046674 | Bacteria | 584 |
| 508 | Ga0495657_0000008 | 3300046675 | Bacteria | 221090 |
| 509 | Ga0495599_0048753 | 3300046678 | Bacteria | 2655 |
| 510 | Ga0495613_0443541 | 3300046689 | Bacteria | 880 |
| 511 | Ga0495670_0175229 | 3300046691 | Unclassified | 1131 |
| 512 | Ga0495649_0000320 | 3300046694 | Bacteria | 41735 |
| 513 | Ga0495600_0202747 | 3300046809 | Bacteria | 1273 |
| 514 | Ga0495600_0329599 | 3300046809 | Bacteria | 959 |
| 515 | Ga0495604_0174199 | 3300047317 | Bacteria | 1510 |
| 516 | Ga0495676_0000204 | 3300047321 | Bacteria | 46818 |
| 517 | Ga0495676_0006624 | 3300047321 | Bacteria | 10681 |
| 518 | Ga0495676_0119731 | 3300047321 | Bacteria | 1917 |
| 519 | Ga0495680_0751385 | 3300047322 | Bacteria | 640 |
| 520 | Ga0495593_0105254 | 3300047673 | Bacteria | 1444 |
| 521 | Ga0496100_0001005 | 3300048903 | Bacteria | 13598 |
| 522 | Ga0496100_0032783 | 3300048903 | Bacteria | 3244 |
| 523 | Ga0496100_0237988 | 3300048903 | Bacteria | 1342 |
| 524 | Ga0496100_0522469 | 3300048903 | Bacteria | 916 |
| 525 | Ga0496101_0009726 | 3300048904 | Bacteria | 6329 |
| 526 | Ga0496101_0112799 | 3300048904 | Bacteria | 2048 |
| 527 | Ga0496101_0189128 | 3300048904 | Bacteria | 1588 |
| 528 | Ga0496101_0898398 | 3300048904 | Bacteria | 697 |
| 529 | Ga0496102_0025710 | 3300048905 | Bacteria | 5244 |
| 530 | Ga0496102_0145217 | 3300048905 | Bacteria | 2226 |
| 531 | Ga0496102_0147329 | 3300048905 | Bacteria | 2210 |
| 532 | Ga0496102_0499639 | 3300048905 | Bacteria | 1138 |
| 533 | Ga0496102_0651937 | 3300048905 | Bacteria | 976 |
| 534 | Ga0496102_0775048 | 3300048905 | Bacteria | 882 |
| 535 | Ga0496102_1223179 | 3300048905 | Bacteria | 671 |
| 536 | Ga0496102_1844549 | 3300048905 | Bacteria | 522 |
| 537 | Ga0496103_0086753 | 3300048906 | Bacteria | 1973 |
| 538 | Ga0496103_0205001 | 3300048906 | Bacteria | 1268 |
| 539 | Ga0496104_0003336 | 3300048907 | Bacteria | 13855 |
| 540 | Ga0496104_0072353 | 3300048907 | Bacteria | 3278 |
| 541 | Ga0496104_0417804 | 3300048907 | Bacteria | 1253 |
| 542 | Ga0496104_0829597 | 3300048907 | Bacteria | 830 |
| 543 | Ga0496105_0000671 | 3300048908 | Bacteria | 22997 |
| 544 | Ga0496105_0025383 | 3300048908 | Bacteria | 4824 |
| 545 | Ga0496105_0062025 | 3300048908 | Bacteria | 3085 |
| 546 | Ga0496106_0011147 | 3300048909 | Bacteria | 6651 |
| 547 | Ga0496106_0050477 | 3300048909 | Bacteria | 3135 |
| 548 | Ga0496106_0334686 | 3300048909 | Bacteria | 1215 |
| 549 | Ga0496106_0363974 | 3300048909 | Bacteria | 1162 |
| 550 | Ga0496106_1310570 | 3300048909 | Bacteria | 562 |
| 551 | Ga0496107_0008053 | 3300048910 | Bacteria | 7277 |
| 552 | Ga0496107_0017905 | 3300048910 | Bacteria | 4987 |
| 553 | Ga0496107_0586627 | 3300048910 | Bacteria | 824 |
| 554 | Ga0496107_0965741 | 3300048910 | Bacteria | 619 |
| 555 | Ga0496108_0000317 | 3300048911 | Bacteria | 40920 |
| 556 | Ga0496108_0003773 | 3300048911 | Bacteria | 12129 |
| 557 | Ga0496108_0019040 | 3300048911 | Bacteria | 5631 |
| 558 | Ga0496108_0123220 | 3300048911 | Bacteria | 2224 |
| 559 | Ga0496108_1370280 | 3300048911 | Bacteria | 593 |
| 560 | Ga0496109_0007014 | 3300048912 | Bacteria | 9505 |
| 561 | Ga0496109_0062491 | 3300048912 | Bacteria | 3405 |
| 562 | Ga0496109_0082943 | 3300048912 | Bacteria | 2956 |
| 563 | Ga0496109_0090036 | 3300048912 | Bacteria | 2837 |
| 564 | Ga0496109_0290400 | 3300048912 | Bacteria | 1541 |
| 565 | Ga0496109_0388874 | 3300048912 | Bacteria | 1318 |
| 566 | Ga0496109_0524848 | 3300048912 | Bacteria | 1117 |
| 567 | Ga0496110_0000774 | 3300048913 | Bacteria | 22221 |
| 568 | Ga0496110_0003926 | 3300048913 | Bacteria | 11441 |
| 569 | Ga0496110_0023700 | 3300048913 | Bacteria | 5222 |
| 570 | Ga0496110_0041097 | 3300048913 | Bacteria | 4033 |
| 571 | Ga0496110_0142582 | 3300048913 | Bacteria | 2166 |
| 572 | Ga0496110_0343214 | 3300048913 | Bacteria | 1360 |
| 573 | Ga0496110_1203207 | 3300048913 | Bacteria | 667 |
| 574 | Ga0496110_1332176 | 3300048913 | Bacteria | 627 |
| 575 | Ga0496111_0001461 | 3300048914 | Bacteria | 13512 |
| 576 | Ga0496111_0035877 | 3300048914 | Bacteria | 3545 |
| 577 | Ga0496111_0086730 | 3300048914 | Bacteria | 2290 |
| 578 | Ga0496111_0117232 | 3300048914 | Bacteria | 1964 |
| 579 | Ga0496111_0162573 | 3300048914 | Bacteria | 1658 |
| 580 | Ga0496111_0302204 | 3300048914 | Bacteria | 1186 |
| 581 | Ga0496111_0620848 | 3300048914 | Bacteria | 790 |
| 582 | Ga0496112_0059782 | 3300048915 | Bacteria | 3755 |
| 583 | Ga0496112_0117971 | 3300048915 | Unclassified | 2624 |
| 584 | Ga0496112_0315777 | 3300048915 | Bacteria | 1507 |
| 585 | Ga0496112_0635782 | 3300048915 | Bacteria | 997 |
| 586 | Ga0496113_0001684 | 3300048916 | Bacteria | 12527 |
| 587 | Ga0496113_0014555 | 3300048916 | Bacteria | 5370 |
| 588 | Ga0496113_0091637 | 3300048916 | Bacteria | 2343 |
| 589 | Ga0496113_0342847 | 3300048916 | Bacteria | 1198 |
| 590 | Ga0496113_0502710 | 3300048916 | Bacteria | 973 |
| 591 | Ga0496113_0571137 | 3300048916 | Bacteria | 906 |
| 592 | Ga0496114_0012171 | 3300048917 | Bacteria | 6885 |
| 593 | Ga0496114_0032146 | 3300048917 | Bacteria | 4318 |
| 594 | Ga0496114_0080759 | 3300048917 | Bacteria | 2746 |
| 595 | Ga0496114_0501200 | 3300048917 | Bacteria | 1074 |
| 596 | Ga0496114_1304659 | 3300048917 | Bacteria | 613 |
| 597 | Ga0496114_1787862 | 3300048917 | Bacteria | 503 |
| 598 | Ga0496115_0000006 | 3300048918 | Bacteria | 252944 |
| 599 | Ga0496115_0000344 | 3300048918 | Bacteria | 39346 |
| 600 | Ga0496115_0137281 | 3300048918 | Bacteria | 2016 |
| 601 | Ga0496115_0412095 | 3300048918 | Bacteria | 1095 |
| 602 | Ga0496115_0511586 | 3300048918 | Bacteria | 964 |
| 603 | Ga0496115_0542452 | 3300048918 | Bacteria | 930 |
| 604 | Ga0501031_0119077 | 3300049568 | Bacteria | 1725 |
| 605 | Ga0501032_0524473 | 3300049569 | Bacteria | 756 |
| 606 | Ga0501033_0489207 | 3300049570 | Bacteria | 852 |
| 607 | Ga0501033_0581461 | 3300049570 | Bacteria | 769 |
| 608 | Ga0501036_0010832 | 3300049572 | Bacteria | 7533 |
| 609 | Ga0501036_0179126 | 3300049572 | Bacteria | 1785 |
| 610 | Ga0501036_0644663 | 3300049572 | Bacteria | 877 |
| 611 | Ga0501038_0038211 | 3300049574 | Bacteria | 4205 |
| 612 | Ga0501038_0565988 | 3300049574 | Bacteria | 863 |
| 613 | Ga0501039_0101661 | 3300049575 | Bacteria | 2243 |
| 614 | Ga0501039_0523063 | 3300049575 | Bacteria | 931 |
| 615 | Ga0501039_1439883 | 3300049575 | Bacteria | 530 |
| 616 | Ga0501040_0105426 | 3300049576 | Bacteria | 1969 |
| 617 | Ga0501040_0231069 | 3300049576 | Bacteria | 1317 |
| 618 | Ga0501040_0762921 | 3300049576 | Bacteria | 700 |
| 619 | Ga0501041_0262927 | 3300049577 | Bacteria | 1085 |
| 620 | Ga0501042_0008043 | 3300049578 | Bacteria | 6941 |
| 621 | Ga0501042_0180118 | 3300049578 | Bacteria | 1525 |
| 622 | Ga0501043_1170746 | 3300049579 | Bacteria | 541 |
| 623 | Ga0501046_0263251 | 3300049580 | Bacteria | 1266 |
| 624 | Ga0501048_0028256 | 3300049582 | Bacteria | 4071 |
| 625 | Ga0501068_0470159 | 3300049584 | Bacteria | 814 |
| 626 | Ga0501068_1152165 | 3300049584 | Bacteria | 513 |
| 627 | Ga0501071_1004819 | 3300049587 | Bacteria | 644 |
| 628 | Ga0501072_0311255 | 3300049588 | Bacteria | 1252 |
| 629 | Ga0501072_0708503 | 3300049588 | Bacteria | 791 |
| 630 | Ga0501073_0339470 | 3300049589 | Bacteria | 1037 |
| 631 | Ga0501074_0061481 | 3300049590 | Bacteria | 2706 |
| 632 | Ga0501074_0534282 | 3300049590 | Bacteria | 830 |
| 633 | Ga0501075_0015408 | 3300049591 | Bacteria | 5487 |
| 634 | Ga0501075_0206334 | 3300049591 | Bacteria | 1499 |
| 635 | Ga0501075_0209043 | 3300049591 | Bacteria | 1489 |
| 636 | Ga0501075_0636704 | 3300049591 | Bacteria | 813 |
| 637 | Ga0501076_0082208 | 3300049592 | Bacteria | 2586 |
| 638 | Ga0501076_0111303 | 3300049592 | Bacteria | 2213 |
| 639 | Ga0501077_0075046 | 3300049593 | Bacteria | 2141 |
| 640 | Ga0501077_0243231 | 3300049593 | Bacteria | 1144 |
| 641 | Ga0501077_0449752 | 3300049593 | Bacteria | 825 |
| 642 | Ga0501079_0045155 | 3300049741 | Bacteria | 3401 |
| 643 | Ga0501079_0168637 | 3300049741 | Bacteria | 1707 |
| 644 | Ga0501079_0474470 | 3300049741 | Bacteria | 983 |
| 645 | Ga0501079_0519467 | 3300049741 | Bacteria | 936 |
| 646 | Ga0501080_1824888 | 3300049742 | Bacteria | 510 |
| 647 | Ga0501081_0198152 | 3300049743 | Bacteria | 1456 |
| 648 | Ga0501081_0253269 | 3300049743 | Bacteria | 1285 |
| 649 | Ga0501081_0498168 | 3300049743 | Bacteria | 908 |
| 650 | Ga0501083_0383102 | 3300049744 | Bacteria | 915 |
| 651 | Ga0501035_0079395 | 3300049822 | Bacteria | 2899 |
| 652 | Ga0501044_0521546 | 3300049823 | Bacteria | 1088 |
| 653 | Ga0501045_0070312 | 3300049824 | Bacteria | 2575 |
| 654 | Ga0501045_1185375 | 3300049824 | Bacteria | 557 |
| 655 | nmdc:mga03n38_48985_c1 | 3300050490 | Bacteria | 1876 |
| 656 | nmdc:mga00v17_103522_c1 | 3300050491 | Bacteria | 1799 |
| 657 | nmdc:mga0yw44_202902_c1 | 3300050492 | Bacteria | 1310 |
| 658 | nmdc:mga0yw44_393010_c1 | 3300050492 | Bacteria | 937 |
| 659 | nmdc:mga0yw44_80395_c1 | 3300050492 | Bacteria | 2042 |
| 660 | nmdc:mga05p37_145726_c1 | 3300050507 | Bacteria | 2900 |
| 661 | nmdc:mga05p37_354341_c1 | 3300050507 | Bacteria | 1727 |
| 662 | nmdc:mga05p37_356842_c1 | 3300050507 | Bacteria | 1720 |
| 663 | nmdc:mga0qj67_1168012_c1 | 3300050509 | Bacteria | 600 |
| 664 | nmdc:mga0qj67_437967_c1 | 3300050509 | Bacteria | 1053 |
| 665 | nmdc:mga06r32_1786285_c1 | 3300050510 | Bacteria | 551 |
| 666 | nmdc:mga06r32_240504_c1 | 3300050510 | Bacteria | 1798 |
| 667 | nmdc:mga06r32_524306_c1 | 3300050510 | Bacteria | 1160 |
| 668 | nmdc:mga06r32_554586_c1 | 3300050510 | Bacteria | 1123 |
| 669 | nmdc:mga08y16_1102905_c1 | 3300050511 | Bacteria | 769 |
| 670 | nmdc:mga08y16_1561098_c1 | 3300050511 | Bacteria | 619 |
| 671 | nmdc:mga08y16_27600_c1 | 3300050511 | Bacteria | 5982 |
| 672 | nmdc:mga0n895_1286835_c1 | 3300050512 | Bacteria | 703 |
| 673 | nmdc:mga0n895_1551336_c1 | 3300050512 | Bacteria | 628 |
| 674 | nmdc:mga0n895_48692_c1 | 3300050512 | Bacteria | 4150 |
| 675 | nmdc:mga0n895_7454_c1 | 3300050512 | Bacteria | 9393 |
| 676 | nmdc:mga0rr50_1356020_c1 | 3300050513 | Bacteria | 603 |
| 677 | nmdc:mga0rr50_441412_c1 | 3300050513 | Bacteria | 1103 |
| 678 | nmdc:mga0rr50_49082_c1 | 3300050513 | Bacteria | 3124 |
| 679 | nmdc:mga0rr50_652630_c1 | 3300050513 | Bacteria | 898 |
| 680 | nmdc:mga08x19_63526_c1 | 3300050514 | Bacteria | 2396 |
| 681 | nmdc:mga0a205_127261_c1 | 3300050515 | Bacteria | 2447 |
| 682 | nmdc:mga0a205_268777_c1 | 3300050515 | Bacteria | 1582 |
| 683 | nmdc:mga0a205_642577_c1 | 3300050515 | Bacteria | 913 |
| 684 | nmdc:mga0a205_84787_c1 | 3300050515 | Bacteria | 3061 |
| 685 | Ga0495601_0020486 | 3300053077 | Unclassified | 4040 |
| 686 | Ga0495619_0012634 | 3300053085 | Bacteria | 5315 |
| 687 | Ga0495619_0033556 | 3300053085 | Bacteria | 3334 |
| 688 | Ga0501084_0009716 | 3300054114 | Bacteria | 7956 |
| 689 | Ga0501084_0134152 | 3300054114 | Bacteria | 2084 |
| 690 | Ga0501082_0053899 | 3300060353 | Bacteria | 3467 |
| 691 | Ga0501082_0087990 | 3300060353 | Bacteria | 2680 |
| 692 | Ga0501082_0443753 | 3300060353 | Bacteria | 1134 |
| 693 | Ga0501082_1607679 | 3300060353 | Bacteria | 567 |
| 694 | Ga0466962_0232710 | 3300061719 | Bacteria | 903 |
| 695 | Ga0530510_0079885 | 3300061734 | Bacteria | 2379 |
| 696 | Ga0530510_1114863 | 3300061734 | Bacteria | 605 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0019765 | Ga0373943_0019765_185_466 | 82 |
| 2 | 3300006846 | Ga0075430_100456027 | Ga0075430_1004560272 | 88 |
| 3 | 3300007076 | Ga0075435_100374808 | Ga0075435_1003748081 | 88 |
| 4 | 3300009147 | Ga0114129_10177731 | Ga0114129_101777313 | 88 |
| 5 | 3300035111 | Ga0373923_0544975 | Ga0373923_0544975_70_336 | 88 |
| 6 | 3300035117 | Ga0373953_0307113 | Ga0373953_0307113_221_487 | 88 |
| 7 | 3300035119 | Ga0373956_0232241 | Ga0373956_0232241_377_643 | 88 |
| 8 | 3300046463 | Ga0495653_0656485 | Ga0495653_0656485_198_464 | 88 |
| 9 | 3300046533 | Ga0495640_0817169 | Ga0495640_0817169_133_399 | 88 |
| 10 | 3300046809 | Ga0495600_0329599 | Ga0495600_0329599_61_327 | 88 |
| 11 | 3300047317 | Ga0495604_0174199 | Ga0495604_0174199_412_678 | 88 |
| 12 | 3300047673 | Ga0495593_0105254 | Ga0495593_0105254_1122_1388 | 88 |
| 13 | 3300050507 | nmdc:mga05p37_354341_c1 | nmdc:mga05p37_354341_c1_452_718 | 88 |
| 14 | 3300050509 | nmdc:mga0qj67_437967_c1 | nmdc:mga0qj67_437967_c1_367_633 | 88 |
| 15 | 3300050510 | nmdc:mga06r32_524306_c1 | nmdc:mga06r32_524306_c1_632_898 | 88 |
| 16 | 3300053085 | Ga0495619_0012634 | Ga0495619_0012634_4638_4904 | 88 |
| 17 | 3300053085 | Ga0495619_0033556 | Ga0495619_0033556_16_282 | 88 |
| 18 | 3300060353 | Ga0501082_0443753 | Ga0501082_0443753_38_304 | 88 |
| 19 | 3300005328 | Ga0070676_10373089 | Ga0070676_103730892 | 89 |
| 20 | 3300005330 | Ga0070690_100088487 | Ga0070690_1000884872 | 89 |
| 21 | 3300005338 | Ga0068868_100150235 | Ga0068868_1001502352 | 89 |
| 22 | 3300005338 | Ga0068868_100925291 | Ga0068868_1009252912 | 89 |
| 23 | 3300005340 | Ga0070689_100226686 | Ga0070689_1002266862 | 89 |
| 24 | 3300005341 | Ga0070691_10099916 | Ga0070691_100999162 | 89 |
| 25 | 3300005341 | Ga0070691_10564950 | Ga0070691_105649502 | 89 |
| 26 | 3300005343 | Ga0070687_100033984 | Ga0070687_1000339842 | 89 |
| 27 | 3300005344 | Ga0070661_100127074 | Ga0070661_1001270742 | 89 |
| 28 | 3300005345 | Ga0070692_10021909 | Ga0070692_100219094 | 89 |
| 29 | 3300005353 | Ga0070669_101176318 | Ga0070669_1011763182 | 89 |
| 30 | 3300005356 | Ga0070674_100166036 | Ga0070674_1001660363 | 89 |
| 31 | 3300005365 | Ga0070688_101569382 | Ga0070688_1015693821 | 89 |
| 32 | 3300005435 | Ga0070714_100122115 | Ga0070714_1001221151 | 89 |
| 33 | 3300005438 | Ga0070701_10008802 | Ga0070701_100088023 | 89 |
| 34 | 3300005441 | Ga0070700_100010634 | Ga0070700_1000106344 | 89 |
| 35 | 3300005444 | Ga0070694_100135146 | Ga0070694_1001351462 | 89 |
| 36 | 3300005456 | Ga0070678_100854057 | Ga0070678_1008540572 | 89 |
| 37 | 3300005466 | Ga0070685_10677636 | Ga0070685_106776362 | 89 |
| 38 | 3300005530 | Ga0070679_101530584 | Ga0070679_1015305842 | 89 |
| 39 | 3300005535 | Ga0070684_100020586 | Ga0070684_1000205865 | 89 |
| 40 | 3300005535 | Ga0070684_100156536 | Ga0070684_1001565362 | 89 |
| 41 | 3300005535 | Ga0070684_100790428 | Ga0070684_1007904282 | 89 |
| 42 | 3300005535 | Ga0070684_101802004 | Ga0070684_1018020041 | 89 |
| 43 | 3300005543 | Ga0070672_100241964 | Ga0070672_1002419642 | 89 |
| 44 | 3300005544 | Ga0070686_100018190 | Ga0070686_1000181905 | 89 |
| 45 | 3300005564 | Ga0070664_100144377 | Ga0070664_1001443773 | 89 |
| 46 | 3300005614 | Ga0068856_100188380 | Ga0068856_1001883802 | 89 |
| 47 | 3300005614 | Ga0068856_101294970 | Ga0068856_1012949701 | 89 |
| 48 | 3300005614 | Ga0068856_102506794 | Ga0068856_1025067941 | 89 |
| 49 | 3300005615 | Ga0070702_100018341 | Ga0070702_1000183413 | 89 |
| 50 | 3300005616 | Ga0068852_100066678 | Ga0068852_1000666785 | 89 |
| 51 | 3300005617 | Ga0068859_100111263 | Ga0068859_1001112632 | 89 |
| 52 | 3300005617 | Ga0068859_102615070 | Ga0068859_1026150702 | 89 |
| 53 | 3300005618 | Ga0068864_100166944 | Ga0068864_1001669442 | 89 |
| 54 | 3300005618 | Ga0068864_100537376 | Ga0068864_1005373762 | 89 |
| 55 | 3300005718 | Ga0068866_10012856 | Ga0068866_100128565 | 89 |
| 56 | 3300005718 | Ga0068866_11118390 | Ga0068866_111183902 | 89 |
| 57 | 3300005719 | Ga0068861_100403037 | Ga0068861_1004030372 | 89 |
| 58 | 3300005840 | Ga0068870_10510676 | Ga0068870_105106762 | 89 |
| 59 | 3300005842 | Ga0068858_100103031 | Ga0068858_1001030314 | 89 |
| 60 | 3300005981 | Ga0081538_10004666 | Ga0081538_1000466613 | 89 |
| 61 | 3300005981 | Ga0081538_10009134 | Ga0081538_100091345 | 89 |
| 62 | 3300005981 | Ga0081538_10011726 | Ga0081538_1001172610 | 89 |
| 63 | 3300005981 | Ga0081538_10011801 | Ga0081538_100118017 | 89 |
| 64 | 3300005981 | Ga0081538_10016040 | Ga0081538_100160404 | 89 |
| 65 | 3300005981 | Ga0081538_10040648 | Ga0081538_100406482 | 89 |
| 66 | 3300005981 | Ga0081538_10043061 | Ga0081538_100430616 | 89 |
| 67 | 3300005981 | Ga0081538_10138225 | Ga0081538_101382253 | 89 |
| 68 | 3300005981 | Ga0081538_10160454 | Ga0081538_101604541 | 89 |
| 69 | 3300005983 | Ga0081540_1197022 | Ga0081540_11970221 | 89 |
| 70 | 3300005985 | Ga0081539_10154109 | Ga0081539_101541092 | 89 |
| 71 | 3300006038 | Ga0075365_10011921 | Ga0075365_100119215 | 89 |
| 72 | 3300006038 | Ga0075365_10193190 | Ga0075365_101931903 | 89 |
| 73 | 3300006038 | Ga0075365_11053908 | Ga0075365_110539082 | 89 |
| 74 | 3300006048 | Ga0075363_100030031 | Ga0075363_1000300313 | 89 |
| 75 | 3300006051 | Ga0075364_10110756 | Ga0075364_101107564 | 89 |
| 76 | 3300006051 | Ga0075364_10318677 | Ga0075364_103186772 | 89 |
| 77 | 3300006175 | Ga0070712_100568582 | Ga0070712_1005685823 | 89 |
| 78 | 3300006847 | Ga0075431_101888886 | Ga0075431_1018888862 | 89 |
| 79 | 3300006852 | Ga0075433_10331953 | Ga0075433_103319532 | 89 |
| 80 | 3300006871 | Ga0075434_100386849 | Ga0075434_1003868492 | 89 |
| 81 | 3300006881 | Ga0068865_100076837 | Ga0068865_1000768373 | 89 |
| 82 | 3300006931 | Ga0097620_100111263 | Ga0097620_1001112632 | 89 |
| 83 | 3300006931 | Ga0097620_102615167 | Ga0097620_1026151671 | 89 |
| 84 | 3300009093 | Ga0105240_10968291 | Ga0105240_109682912 | 89 |
| 85 | 3300009098 | Ga0105245_10000438 | Ga0105245_1000043819 | 89 |
| 86 | 3300009101 | Ga0105247_10016614 | Ga0105247_100166142 | 89 |
| 87 | 3300009147 | Ga0114129_10256293 | Ga0114129_102562933 | 89 |
| 88 | 3300009147 | Ga0114129_11779054 | Ga0114129_117790542 | 89 |
| 89 | 3300009147 | Ga0114129_12646663 | Ga0114129_126466632 | 89 |
| 90 | 3300009148 | Ga0105243_10153368 | Ga0105243_101533683 | 89 |
| 91 | 3300009148 | Ga0105243_12653208 | Ga0105243_126532082 | 89 |
| 92 | 3300009176 | Ga0105242_10048158 | Ga0105242_100481583 | 89 |
| 93 | 3300009177 | Ga0105248_11127871 | Ga0105248_111278712 | 89 |
| 94 | 3300009177 | Ga0105248_11982758 | Ga0105248_119827582 | 89 |
| 95 | 3300009545 | Ga0105237_10001241 | Ga0105237_1000124130 | 89 |
| 96 | 3300009545 | Ga0105237_12367658 | Ga0105237_123676582 | 89 |
| 97 | 3300009551 | Ga0105238_10167241 | Ga0105238_101672413 | 89 |
| 98 | 3300009553 | Ga0105249_10077959 | Ga0105249_100779595 | 89 |
| 99 | 3300009553 | Ga0105249_12449475 | Ga0105249_124494752 | 89 |
| 100 | 3300009553 | Ga0105249_13456085 | Ga0105249_134560851 | 89 |
| 101 | 3300010375 | Ga0105239_10234284 | Ga0105239_102342842 | 89 |
| 102 | 3300010375 | Ga0105239_12011416 | Ga0105239_120114162 | 89 |
| 103 | 3300013104 | Ga0157370_10658974 | Ga0157370_106589742 | 89 |
| 104 | 3300013307 | Ga0157372_10892395 | Ga0157372_108923952 | 89 |
| 105 | 3300013308 | Ga0157375_10483647 | Ga0157375_104836472 | 89 |
| 106 | 3300014326 | Ga0157380_13544168 | Ga0157380_135441682 | 89 |
| 107 | 3300014969 | Ga0157376_12535651 | Ga0157376_125356511 | 89 |
| 108 | 3300014969 | Ga0157376_12645324 | Ga0157376_126453241 | 89 |
| 109 | 3300017792 | Ga0163161_10295322 | Ga0163161_102953222 | 89 |
| 110 | 3300020082 | Ga0206353_10290208 | Ga0206353_102902082 | 89 |
| 111 | 3300025899 | Ga0207642_10026907 | Ga0207642_100269072 | 89 |
| 112 | 3300025899 | Ga0207642_10501675 | Ga0207642_105016752 | 89 |
| 113 | 3300025900 | Ga0207710_10212642 | Ga0207710_102126422 | 89 |
| 114 | 3300025901 | Ga0207688_10087669 | Ga0207688_100876692 | 89 |
| 115 | 3300025914 | Ga0207671_10000770 | Ga0207671_1000077011 | 89 |
| 116 | 3300025915 | Ga0207693_10266996 | Ga0207693_102669963 | 89 |
| 117 | 3300025917 | Ga0207660_10419227 | Ga0207660_104192272 | 89 |
| 118 | 3300025919 | Ga0207657_10222850 | Ga0207657_102228502 | 89 |
| 119 | 3300025920 | Ga0207649_10212382 | Ga0207649_102123822 | 89 |
| 120 | 3300025924 | Ga0207694_11769681 | Ga0207694_117696812 | 89 |
| 121 | 3300025925 | Ga0207650_10358620 | Ga0207650_103586201 | 89 |
| 122 | 3300025927 | Ga0207687_10000075 | Ga0207687_1000007519 | 89 |
| 123 | 3300025929 | Ga0207664_10935981 | Ga0207664_109359812 | 89 |
| 124 | 3300025929 | Ga0207664_11388042 | Ga0207664_113880421 | 89 |
| 125 | 3300025932 | Ga0207690_10538398 | Ga0207690_105383983 | 89 |
| 126 | 3300025934 | Ga0207686_10142767 | Ga0207686_101427671 | 89 |
| 127 | 3300025936 | Ga0207670_10062758 | Ga0207670_100627584 | 89 |
| 128 | 3300025938 | Ga0207704_10055419 | Ga0207704_100554193 | 89 |
| 129 | 3300025940 | Ga0207691_10805454 | Ga0207691_108054542 | 89 |
| 130 | 3300025941 | Ga0207711_11555004 | Ga0207711_115550042 | 89 |
| 131 | 3300025941 | Ga0207711_12105304 | Ga0207711_121053042 | 89 |
| 132 | 3300025944 | Ga0207661_10007432 | Ga0207661_100074324 | 89 |
| 133 | 3300025945 | Ga0207679_10011719 | Ga0207679_100117193 | 89 |
| 134 | 3300025945 | Ga0207679_10578467 | Ga0207679_105784673 | 89 |
| 135 | 3300025949 | Ga0207667_11478830 | Ga0207667_114788301 | 89 |
| 136 | 3300025961 | Ga0207712_10364425 | Ga0207712_103644252 | 89 |
| 137 | 3300026023 | Ga0207677_10055941 | Ga0207677_100559412 | 89 |
| 138 | 3300026035 | Ga0207703_10130559 | Ga0207703_101305594 | 89 |
| 139 | 3300026075 | Ga0207708_10060336 | Ga0207708_100603363 | 89 |
| 140 | 3300026078 | Ga0207702_10108827 | Ga0207702_101088272 | 89 |
| 141 | 3300026089 | Ga0207648_10021170 | Ga0207648_100211703 | 89 |
| 142 | 3300026089 | Ga0207648_10114958 | Ga0207648_101149582 | 89 |
| 143 | 3300026089 | Ga0207648_10464256 | Ga0207648_104642563 | 89 |
| 144 | 3300026089 | Ga0207648_10980948 | Ga0207648_109809482 | 89 |
| 145 | 3300026095 | Ga0207676_10043299 | Ga0207676_100432994 | 89 |
| 146 | 3300026118 | Ga0207675_100134900 | Ga0207675_1001349003 | 89 |
| 147 | 3300026118 | Ga0207675_100272538 | Ga0207675_1002725382 | 89 |
| 148 | 3300026121 | Ga0207683_10292946 | Ga0207683_102929462 | 89 |
| 149 | 3300026142 | Ga0207698_10097364 | Ga0207698_100973642 | 89 |
| 150 | 3300028380 | Ga0268265_10064059 | Ga0268265_100640594 | 89 |
| 151 | 3300028381 | Ga0268264_10120583 | Ga0268264_101205832 | 89 |
| 152 | 3300035115 | Ga0373941_0345612 | Ga0373941_0345612_41_346 | 89 |
| 153 | 3300035116 | Ga0373945_0297487 | Ga0373945_0297487_364_633 | 89 |
| 154 | 3300037312 | Ga0395899_0634737 | Ga0395899_0634737_252_521 | 89 |
| 155 | 3300037418 | Ga0395900_0005605 | Ga0395900_0005605_2607_2876 | 89 |
| 156 | 3300037418 | Ga0395900_0813165 | Ga0395900_0813165_418_687 | 89 |
| 157 | 3300037466 | Ga0395898_0018531 | Ga0395898_0018531_3743_4012 | 89 |
| 158 | 3300037466 | Ga0395898_1337198 | Ga0395898_1337198_106_375 | 89 |
| 159 | 3300037471 | Ga0395905_0017416 | Ga0395905_0017416_5001_5270 | 89 |
| 160 | 3300038443 | Ga0395901_0010517 | Ga0395901_0010517_947_1216 | 89 |
| 161 | 3300038443 | Ga0395901_0138821 | Ga0395901_0138821_93_362 | 89 |
| 162 | 3300041509 | Ga0451843_1106634 | Ga0451843_1106634_264_533 | 89 |
| 163 | 3300041512 | Ga0451853_3586855 | Ga0451853_3586855_859_1128 | 89 |
| 164 | 3300042461 | Ga0439460_0035970 | Ga0439460_0035970_760_1029 | 89 |
| 165 | 3300042530 | Ga0450916_050459 | Ga0450916_050459_212_481 | 89 |
| 166 | 3300044656 | Ga0466969_0224359 | Ga0466969_0224359_209_478 | 89 |
| 167 | 3300044684 | Ga0466966_0056774 | Ga0466966_0056774_1938_2207 | 89 |
| 168 | 3300044693 | Ga0466961_0048829 | Ga0466961_0048829_1554_1823 | 89 |
| 169 | 3300044694 | Ga0466963_1333787 | Ga0466963_1333787_88_357 | 89 |
| 170 | 3300044706 | Ga0466964_0183442 | Ga0466964_0183442_253_522 | 89 |
| 171 | 3300044706 | Ga0466964_0331501 | Ga0466964_0331501_274_543 | 89 |
| 172 | 3300044719 | Ga0466971_0374438 | Ga0466971_0374438_378_647 | 89 |
| 173 | 3300045049 | Ga0466959_0082180 | Ga0466959_0082180_1580_1849 | 89 |
| 174 | 3300045836 | Ga0466958_0382127 | Ga0466958_0382127_590_859 | 89 |
| 175 | 3300045836 | Ga0466958_0823067 | Ga0466958_0823067_108_377 | 89 |
| 176 | 3300045976 | Ga0466967_0006817 | Ga0466967_0006817_1806_2075 | 89 |
| 177 | 3300045976 | Ga0466967_0430820 | Ga0466967_0430820_115_384 | 89 |
| 178 | 3300045976 | Ga0466967_1409751 | Ga0466967_1409751_141_410 | 89 |
| 179 | 3300046458 | Ga0495591_146452 | Ga0495591_146452_235_504 | 89 |
| 180 | 3300046517 | Ga0495630_0001557 | Ga0495630_0001557_5610_5879 | 89 |
| 181 | 3300046517 | Ga0495630_0038975 | Ga0495630_0038975_796_1065 | 89 |
| 182 | 3300046529 | Ga0495652_0036488 | Ga0495652_0036488_3351_3620 | 89 |
| 183 | 3300046675 | Ga0495657_0000008 | Ga0495657_0000008_19201_19470 | 89 |
| 184 | 3300046678 | Ga0495599_0048753 | Ga0495599_0048753_1192_1461 | 89 |
| 185 | 3300046689 | Ga0495613_0443541 | Ga0495613_0443541_81_350 | 89 |
| 186 | 3300046694 | Ga0495649_0000320 | Ga0495649_0000320_16891_17160 | 89 |
| 187 | 3300046809 | Ga0495600_0202747 | Ga0495600_0202747_516_785 | 89 |
| 188 | 3300047321 | Ga0495676_0000204 | Ga0495676_0000204_35793_36062 | 89 |
| 189 | 3300047322 | Ga0495680_0751385 | Ga0495680_0751385_227_496 | 89 |
| 190 | 3300048903 | Ga0496100_0032783 | Ga0496100_0032783_2322_2591 | 89 |
| 191 | 3300048904 | Ga0496101_0898398 | Ga0496101_0898398_221_490 | 89 |
| 192 | 3300048905 | Ga0496102_0499639 | Ga0496102_0499639_355_624 | 89 |
| 193 | 3300048905 | Ga0496102_0775048 | Ga0496102_0775048_520_825 | 89 |
| 194 | 3300048905 | Ga0496102_1223179 | Ga0496102_1223179_56_325 | 89 |
| 195 | 3300048905 | Ga0496102_1844549 | Ga0496102_1844549_83_352 | 89 |
| 196 | 3300048906 | Ga0496103_0205001 | Ga0496103_0205001_108_377 | 89 |
| 197 | 3300048909 | Ga0496106_0050477 | Ga0496106_0050477_1533_1802 | 89 |
| 198 | 3300048910 | Ga0496107_0017905 | Ga0496107_0017905_1715_1984 | 89 |
| 199 | 3300048911 | Ga0496108_1370280 | Ga0496108_1370280_56_325 | 89 |
| 200 | 3300048912 | Ga0496109_0062491 | Ga0496109_0062491_1579_1848 | 89 |
| 201 | 3300048912 | Ga0496109_0388874 | Ga0496109_0388874_53_322 | 89 |
| 202 | 3300048912 | Ga0496109_0524848 | Ga0496109_0524848_473_778 | 89 |
| 203 | 3300048913 | Ga0496110_1332176 | Ga0496110_1332176_256_561 | 89 |
| 204 | 3300048914 | Ga0496111_0620848 | Ga0496111_0620848_11_280 | 89 |
| 205 | 3300048915 | Ga0496112_0315777 | Ga0496112_0315777_710_979 | 89 |
| 206 | 3300048916 | Ga0496113_0502710 | Ga0496113_0502710_77_382 | 89 |
| 207 | 3300048916 | Ga0496113_0571137 | Ga0496113_0571137_128_397 | 89 |
| 208 | 3300048917 | Ga0496114_0012171 | Ga0496114_0012171_5949_6218 | 89 |
| 209 | 3300048917 | Ga0496114_0501200 | Ga0496114_0501200_383_652 | 89 |
| 210 | 3300048917 | Ga0496114_1787862 | Ga0496114_1787862_160_429 | 89 |
| 211 | 3300048918 | Ga0496115_0000006 | Ga0496115_0000006_166821_167090 | 89 |
| 212 | 3300048918 | Ga0496115_0000344 | Ga0496115_0000344_24508_24777 | 89 |
| 213 | 3300048918 | Ga0496115_0542452 | Ga0496115_0542452_559_828 | 89 |
| 214 | 3300049568 | Ga0501031_0119077 | Ga0501031_0119077_241_513 | 89 |
| 215 | 3300049569 | Ga0501032_0524473 | Ga0501032_0524473_402_674 | 89 |
| 216 | 3300049570 | Ga0501033_0489207 | Ga0501033_0489207_25_297 | 89 |
| 217 | 3300049570 | Ga0501033_0581461 | Ga0501033_0581461_25_297 | 89 |
| 218 | 3300049572 | Ga0501036_0010832 | Ga0501036_0010832_2775_3047 | 89 |
| 219 | 3300049572 | Ga0501036_0644663 | Ga0501036_0644663_523_792 | 89 |
| 220 | 3300049574 | Ga0501038_0038211 | Ga0501038_0038211_1857_2129 | 89 |
| 221 | 3300049574 | Ga0501038_0565988 | Ga0501038_0565988_439_708 | 89 |
| 222 | 3300049575 | Ga0501039_0101661 | Ga0501039_0101661_979_1251 | 89 |
| 223 | 3300049575 | Ga0501039_0523063 | Ga0501039_0523063_439_708 | 89 |
| 224 | 3300049575 | Ga0501039_1439883 | Ga0501039_1439883_198_467 | 89 |
| 225 | 3300049576 | Ga0501040_0105426 | Ga0501040_0105426_1126_1398 | 89 |
| 226 | 3300049576 | Ga0501040_0231069 | Ga0501040_0231069_946_1215 | 89 |
| 227 | 3300049578 | Ga0501042_0008043 | Ga0501042_0008043_2044_2316 | 89 |
| 228 | 3300049578 | Ga0501042_0180118 | Ga0501042_0180118_520_789 | 89 |
| 229 | 3300049579 | Ga0501043_1170746 | Ga0501043_1170746_170_442 | 89 |
| 230 | 3300049580 | Ga0501046_0263251 | Ga0501046_0263251_624_896 | 89 |
| 231 | 3300049582 | Ga0501048_0028256 | Ga0501048_0028256_3289_3561 | 89 |
| 232 | 3300049584 | Ga0501068_0470159 | Ga0501068_0470159_509_778 | 89 |
| 233 | 3300049584 | Ga0501068_1152165 | Ga0501068_1152165_212_484 | 89 |
| 234 | 3300049587 | Ga0501071_1004819 | Ga0501071_1004819_59_328 | 89 |
| 235 | 3300049588 | Ga0501072_0311255 | Ga0501072_0311255_775_1044 | 89 |
| 236 | 3300049588 | Ga0501072_0708503 | Ga0501072_0708503_262_531 | 89 |
| 237 | 3300049589 | Ga0501073_0339470 | Ga0501073_0339470_163_432 | 89 |
| 238 | 3300049590 | Ga0501074_0061481 | Ga0501074_0061481_516_788 | 89 |
| 239 | 3300049590 | Ga0501074_0534282 | Ga0501074_0534282_401_670 | 89 |
| 240 | 3300049591 | Ga0501075_0015408 | Ga0501075_0015408_1025_1294 | 89 |
| 241 | 3300049591 | Ga0501075_0209043 | Ga0501075_0209043_681_950 | 89 |
| 242 | 3300049591 | Ga0501075_0636704 | Ga0501075_0636704_55_327 | 89 |
| 243 | 3300049592 | Ga0501076_0082208 | Ga0501076_0082208_1348_1617 | 89 |
| 244 | 3300049592 | Ga0501076_0111303 | Ga0501076_0111303_572_844 | 89 |
| 245 | 3300049593 | Ga0501077_0075046 | Ga0501077_0075046_1467_1739 | 89 |
| 246 | 3300049593 | Ga0501077_0243231 | Ga0501077_0243231_206_475 | 89 |
| 247 | 3300049593 | Ga0501077_0449752 | Ga0501077_0449752_322_591 | 89 |
| 248 | 3300049741 | Ga0501079_0045155 | Ga0501079_0045155_1659_1931 | 89 |
| 249 | 3300049741 | Ga0501079_0168637 | Ga0501079_0168637_1199_1468 | 89 |
| 250 | 3300049741 | Ga0501079_0474470 | Ga0501079_0474470_159_428 | 89 |
| 251 | 3300049742 | Ga0501080_1824888 | Ga0501080_1824888_49_318 | 89 |
| 252 | 3300049743 | Ga0501081_0198152 | Ga0501081_0198152_27_299 | 89 |
| 253 | 3300049743 | Ga0501081_0253269 | Ga0501081_0253269_343_615 | 89 |
| 254 | 3300049744 | Ga0501083_0383102 | Ga0501083_0383102_84_356 | 89 |
| 255 | 3300049822 | Ga0501035_0079395 | Ga0501035_0079395_675_947 | 89 |
| 256 | 3300049823 | Ga0501044_0521546 | Ga0501044_0521546_82_354 | 89 |
| 257 | 3300049824 | Ga0501045_0070312 | Ga0501045_0070312_1358_1627 | 89 |
| 258 | 3300049824 | Ga0501045_1185375 | Ga0501045_1185375_242_514 | 89 |
| 259 | 3300050490 | nmdc:mga03n38_48985_c1 | nmdc:mga03n38_48985_c1_422_691 | 89 |
| 260 | 3300050491 | nmdc:mga00v17_103522_c1 | nmdc:mga00v17_103522_c1_241_510 | 89 |
| 261 | 3300050492 | nmdc:mga0yw44_202902_c1 | nmdc:mga0yw44_202902_c1_406_675 | 89 |
| 262 | 3300050492 | nmdc:mga0yw44_393010_c1 | nmdc:mga0yw44_393010_c1_474_743 | 89 |
| 263 | 3300050492 | nmdc:mga0yw44_80395_c1 | nmdc:mga0yw44_80395_c1_1735_2004 | 89 |
| 264 | 3300050509 | nmdc:mga0qj67_1168012_c1 | nmdc:mga0qj67_1168012_c1_64_336 | 89 |
| 265 | 3300050510 | nmdc:mga06r32_1786285_c1 | nmdc:mga06r32_1786285_c1_154_423 | 89 |
| 266 | 3300050511 | nmdc:mga08y16_1561098_c1 | nmdc:mga08y16_1561098_c1_205_474 | 89 |
| 267 | 3300050515 | nmdc:mga0a205_268777_c1 | nmdc:mga0a205_268777_c1_65_334 | 89 |
| 268 | 3300053077 | Ga0495601_0020486 | Ga0495601_0020486_2110_2379 | 89 |
| 269 | 3300054114 | Ga0501084_0009716 | Ga0501084_0009716_6805_7077 | 89 |
| 270 | 3300054114 | Ga0501084_0134152 | Ga0501084_0134152_971_1240 | 89 |
| 271 | 3300060353 | Ga0501082_0053899 | Ga0501082_0053899_1234_1503 | 89 |
| 272 | 3300060353 | Ga0501082_0087990 | Ga0501082_0087990_627_899 | 89 |
| 273 | 3300060353 | Ga0501082_1607679 | Ga0501082_1607679_79_348 | 89 |
| 274 | 3300061719 | Ga0466962_0232710 | Ga0466962_0232710_330_599 | 89 |
| 275 | 3300061734 | Ga0530510_0079885 | Ga0530510_0079885_496_765 | 89 |
| 276 | 3300003373 | JGI25407J50210_10084194 | JGI25407J50210_100841942 | 90 |
| 277 | 3300005327 | Ga0070658_11965389 | Ga0070658_119653892 | 90 |
| 278 | 3300005330 | Ga0070690_100139436 | Ga0070690_1001394362 | 90 |
| 279 | 3300005330 | Ga0070690_101043692 | Ga0070690_1010436922 | 90 |
| 280 | 3300005335 | Ga0070666_10219068 | Ga0070666_102190682 | 90 |
| 281 | 3300005336 | Ga0070680_100050076 | Ga0070680_1000500762 | 90 |
| 282 | 3300005336 | Ga0070680_100053040 | Ga0070680_1000530404 | 90 |
| 283 | 3300005336 | Ga0070680_100800706 | Ga0070680_1008007062 | 90 |
| 284 | 3300005336 | Ga0070680_101098288 | Ga0070680_1010982882 | 90 |
| 285 | 3300005337 | Ga0070682_100293570 | Ga0070682_1002935702 | 90 |
| 286 | 3300005338 | Ga0068868_100057737 | Ga0068868_1000577374 | 90 |
| 287 | 3300005338 | Ga0068868_100187508 | Ga0068868_1001875083 | 90 |
| 288 | 3300005339 | Ga0070660_100097164 | Ga0070660_1000971643 | 90 |
| 289 | 3300005341 | Ga0070691_10080342 | Ga0070691_100803423 | 90 |
| 290 | 3300005343 | Ga0070687_100106830 | Ga0070687_1001068302 | 90 |
| 291 | 3300005345 | Ga0070692_10255794 | Ga0070692_102557942 | 90 |
| 292 | 3300005353 | Ga0070669_100075770 | Ga0070669_1000757703 | 90 |
| 293 | 3300005355 | Ga0070671_100133814 | Ga0070671_1001338143 | 90 |
| 294 | 3300005355 | Ga0070671_100429762 | Ga0070671_1004297622 | 90 |
| 295 | 3300005356 | Ga0070674_100052965 | Ga0070674_1000529652 | 90 |
| 296 | 3300005365 | Ga0070688_100155783 | Ga0070688_1001557832 | 90 |
| 297 | 3300005366 | Ga0070659_100233430 | Ga0070659_1002334301 | 90 |
| 298 | 3300005366 | Ga0070659_101924823 | Ga0070659_1019248232 | 90 |
| 299 | 3300005406 | Ga0070703_10220328 | Ga0070703_102203281 | 90 |
| 300 | 3300005434 | Ga0070709_10175103 | Ga0070709_101751033 | 90 |
| 301 | 3300005434 | Ga0070709_10337355 | Ga0070709_103373554 | 90 |
| 302 | 3300005435 | Ga0070714_100129462 | Ga0070714_1001294624 | 90 |
| 303 | 3300005435 | Ga0070714_101701952 | Ga0070714_1017019522 | 90 |
| 304 | 3300005436 | Ga0070713_100730322 | Ga0070713_1007303222 | 90 |
| 305 | 3300005436 | Ga0070713_101501922 | Ga0070713_1015019222 | 90 |
| 306 | 3300005437 | Ga0070710_10034252 | Ga0070710_100342524 | 90 |
| 307 | 3300005438 | Ga0070701_10007614 | Ga0070701_100076144 | 90 |
| 308 | 3300005439 | Ga0070711_100005295 | Ga0070711_10000529510 | 90 |
| 309 | 3300005439 | Ga0070711_100169269 | Ga0070711_1001692692 | 90 |
| 310 | 3300005439 | Ga0070711_100205509 | Ga0070711_1002055092 | 90 |
| 311 | 3300005439 | Ga0070711_100661771 | Ga0070711_1006617712 | 90 |
| 312 | 3300005440 | Ga0070705_100003385 | Ga0070705_10000338512 | 90 |
| 313 | 3300005441 | Ga0070700_100260943 | Ga0070700_1002609432 | 90 |
| 314 | 3300005444 | Ga0070694_100458399 | Ga0070694_1004583993 | 90 |
| 315 | 3300005445 | Ga0070708_100110352 | Ga0070708_1001103522 | 90 |
| 316 | 3300005445 | Ga0070708_100288335 | Ga0070708_1002883351 | 90 |
| 317 | 3300005455 | Ga0070663_100536595 | Ga0070663_1005365951 | 90 |
| 318 | 3300005456 | Ga0070678_100672331 | Ga0070678_1006723312 | 90 |
| 319 | 3300005456 | Ga0070678_100984296 | Ga0070678_1009842962 | 90 |
| 320 | 3300005458 | Ga0070681_10021937 | Ga0070681_100219372 | 90 |
| 321 | 3300005459 | Ga0068867_100150678 | Ga0068867_1001506783 | 90 |
| 322 | 3300005466 | Ga0070685_10118398 | Ga0070685_101183983 | 90 |
| 323 | 3300005467 | Ga0070706_100116713 | Ga0070706_1001167133 | 90 |
| 324 | 3300005467 | Ga0070706_100234612 | Ga0070706_1002346122 | 90 |
| 325 | 3300005468 | Ga0070707_100177575 | Ga0070707_1001775752 | 90 |
| 326 | 3300005471 | Ga0070698_100017096 | Ga0070698_10001709614 | 90 |
| 327 | 3300005518 | Ga0070699_100135215 | Ga0070699_1001352154 | 90 |
| 328 | 3300005518 | Ga0070699_100337167 | Ga0070699_1003371671 | 90 |
| 329 | 3300005518 | Ga0070699_100534815 | Ga0070699_1005348152 | 90 |
| 330 | 3300005535 | Ga0070684_100006697 | Ga0070684_1000066979 | 90 |
| 331 | 3300005535 | Ga0070684_100465069 | Ga0070684_1004650691 | 90 |
| 332 | 3300005535 | Ga0070684_100549318 | Ga0070684_1005493182 | 90 |
| 333 | 3300005539 | Ga0068853_100192017 | Ga0068853_1001920171 | 90 |
| 334 | 3300005539 | Ga0068853_100625846 | Ga0068853_1006258463 | 90 |
| 335 | 3300005543 | Ga0070672_101408579 | Ga0070672_1014085791 | 90 |
| 336 | 3300005544 | Ga0070686_100047573 | Ga0070686_1000475731 | 90 |
| 337 | 3300005544 | Ga0070686_100499061 | Ga0070686_1004990611 | 90 |
| 338 | 3300005544 | Ga0070686_101534784 | Ga0070686_1015347841 | 90 |
| 339 | 3300005545 | Ga0070695_100017405 | Ga0070695_1000174054 | 90 |
| 340 | 3300005545 | Ga0070695_100059120 | Ga0070695_1000591202 | 90 |
| 341 | 3300005546 | Ga0070696_100020918 | Ga0070696_1000209183 | 90 |
| 342 | 3300005546 | Ga0070696_100121166 | Ga0070696_1001211662 | 90 |
| 343 | 3300005547 | Ga0070693_100018095 | Ga0070693_1000180955 | 90 |
| 344 | 3300005547 | Ga0070693_100021785 | Ga0070693_1000217855 | 90 |
| 345 | 3300005547 | Ga0070693_100054746 | Ga0070693_1000547461 | 90 |
| 346 | 3300005549 | Ga0070704_100109126 | Ga0070704_1001091261 | 90 |
| 347 | 3300005577 | Ga0068857_102455766 | Ga0068857_1024557662 | 90 |
| 348 | 3300005614 | Ga0068856_100112299 | Ga0068856_1001122992 | 90 |
| 349 | 3300005614 | Ga0068856_100296614 | Ga0068856_1002966142 | 90 |
| 350 | 3300005614 | Ga0068856_101781248 | Ga0068856_1017812482 | 90 |
| 351 | 3300005615 | Ga0070702_100019258 | Ga0070702_1000192583 | 90 |
| 352 | 3300005615 | Ga0070702_100145094 | Ga0070702_1001450941 | 90 |
| 353 | 3300005615 | Ga0070702_100339215 | Ga0070702_1003392152 | 90 |
| 354 | 3300005616 | Ga0068852_101563486 | Ga0068852_1015634862 | 90 |
| 355 | 3300005618 | Ga0068864_100707218 | Ga0068864_1007072182 | 90 |
| 356 | 3300005718 | Ga0068866_10019471 | Ga0068866_100194712 | 90 |
| 357 | 3300005840 | Ga0068870_10258637 | Ga0068870_102586372 | 90 |
| 358 | 3300005844 | Ga0068862_100149026 | Ga0068862_1001490262 | 90 |
| 359 | 3300005937 | Ga0081455_10007478 | Ga0081455_1000747815 | 90 |
| 360 | 3300005937 | Ga0081455_10105305 | Ga0081455_101053052 | 90 |
| 361 | 3300005981 | Ga0081538_10001960 | Ga0081538_100019607 | 90 |
| 362 | 3300005981 | Ga0081538_10002508 | Ga0081538_100025089 | 90 |
| 363 | 3300005981 | Ga0081538_10043342 | Ga0081538_100433423 | 90 |
| 364 | 3300005983 | Ga0081540_1010122 | Ga0081540_10101224 | 90 |
| 365 | 3300006028 | Ga0070717_10220519 | Ga0070717_102205192 | 90 |
| 366 | 3300006028 | Ga0070717_10250716 | Ga0070717_102507162 | 90 |
| 367 | 3300006038 | Ga0075365_10020204 | Ga0075365_100202044 | 90 |
| 368 | 3300006048 | Ga0075363_100858746 | Ga0075363_1008587462 | 90 |
| 369 | 3300006058 | Ga0075432_10053194 | Ga0075432_100531942 | 90 |
| 370 | 3300006058 | Ga0075432_10108741 | Ga0075432_101087412 | 90 |
| 371 | 3300006163 | Ga0070715_10000495 | Ga0070715_1000049513 | 90 |
| 372 | 3300006163 | Ga0070715_10029689 | Ga0070715_100296893 | 90 |
| 373 | 3300006163 | Ga0070715_10239938 | Ga0070715_102399382 | 90 |
| 374 | 3300006173 | Ga0070716_101066677 | Ga0070716_1010666772 | 90 |
| 375 | 3300006175 | Ga0070712_100000012 | Ga0070712_10000001213 | 90 |
| 376 | 3300006175 | Ga0070712_100060393 | Ga0070712_1000603937 | 90 |
| 377 | 3300006175 | Ga0070712_100679565 | Ga0070712_1006795652 | 90 |
| 378 | 3300006175 | Ga0070712_101748251 | Ga0070712_1017482511 | 90 |
| 379 | 3300006177 | Ga0075362_10262768 | Ga0075362_102627682 | 90 |
| 380 | 3300006178 | Ga0075367_10949822 | Ga0075367_109498222 | 90 |
| 381 | 3300006237 | Ga0097621_100460078 | Ga0097621_1004600781 | 90 |
| 382 | 3300006844 | Ga0075428_100107582 | Ga0075428_1001075823 | 90 |
| 383 | 3300006846 | Ga0075430_100228590 | Ga0075430_1002285902 | 90 |
| 384 | 3300006847 | Ga0075431_100381989 | Ga0075431_1003819892 | 90 |
| 385 | 3300006847 | Ga0075431_100666609 | Ga0075431_1006666092 | 90 |
| 386 | 3300006852 | Ga0075433_10299799 | Ga0075433_102997991 | 90 |
| 387 | 3300006852 | Ga0075433_10519590 | Ga0075433_105195902 | 90 |
| 388 | 3300006871 | Ga0075434_100199305 | Ga0075434_1001993055 | 90 |
| 389 | 3300006871 | Ga0075434_100366150 | Ga0075434_1003661502 | 90 |
| 390 | 3300006871 | Ga0075434_101215764 | Ga0075434_1012157643 | 90 |
| 391 | 3300006914 | Ga0075436_100005811 | Ga0075436_1000058117 | 90 |
| 392 | 3300006914 | Ga0075436_100166322 | Ga0075436_1001663223 | 90 |
| 393 | 3300006914 | Ga0075436_100260819 | Ga0075436_1002608192 | 90 |
| 394 | 3300007076 | Ga0075435_100026571 | Ga0075435_1000265714 | 90 |
| 395 | 3300007076 | Ga0075435_100175518 | Ga0075435_1001755182 | 90 |
| 396 | 3300007076 | Ga0075435_100445515 | Ga0075435_1004455154 | 90 |
| 397 | 3300009092 | Ga0105250_10441324 | Ga0105250_104413242 | 90 |
| 398 | 3300009093 | Ga0105240_10328973 | Ga0105240_103289733 | 90 |
| 399 | 3300009094 | Ga0111539_10355322 | Ga0111539_103553222 | 90 |
| 400 | 3300009094 | Ga0111539_11199630 | Ga0111539_111996302 | 90 |
| 401 | 3300009094 | Ga0111539_11983094 | Ga0111539_119830942 | 90 |
| 402 | 3300009098 | Ga0105245_10011634 | Ga0105245_100116348 | 90 |
| 403 | 3300009098 | Ga0105245_10112892 | Ga0105245_101128923 | 90 |
| 404 | 3300009098 | Ga0105245_10159400 | Ga0105245_101594003 | 90 |
| 405 | 3300009098 | Ga0105245_10510630 | Ga0105245_105106302 | 90 |
| 406 | 3300009098 | Ga0105245_12093121 | Ga0105245_120931211 | 90 |
| 407 | 3300009101 | Ga0105247_10767344 | Ga0105247_107673442 | 90 |
| 408 | 3300009147 | Ga0114129_10061875 | Ga0114129_100618753 | 90 |
| 409 | 3300009147 | Ga0114129_10080698 | Ga0114129_100806984 | 90 |
| 410 | 3300009147 | Ga0114129_10155732 | Ga0114129_101557324 | 90 |
| 411 | 3300009147 | Ga0114129_10560216 | Ga0114129_105602163 | 90 |
| 412 | 3300009147 | Ga0114129_10589599 | Ga0114129_105895991 | 90 |
| 413 | 3300009147 | Ga0114129_12026956 | Ga0114129_120269561 | 90 |
| 414 | 3300009147 | Ga0114129_12062753 | Ga0114129_120627532 | 90 |
| 415 | 3300009148 | Ga0105243_10057760 | Ga0105243_100577601 | 90 |
| 416 | 3300009148 | Ga0105243_10064578 | Ga0105243_100645782 | 90 |
| 417 | 3300009148 | Ga0105243_10551995 | Ga0105243_105519952 | 90 |
| 418 | 3300009174 | Ga0105241_10326989 | Ga0105241_103269892 | 90 |
| 419 | 3300009174 | Ga0105241_10634788 | Ga0105241_106347881 | 90 |
| 420 | 3300009176 | Ga0105242_10037976 | Ga0105242_100379769 | 90 |
| 421 | 3300009176 | Ga0105242_10073924 | Ga0105242_100739242 | 90 |
| 422 | 3300009176 | Ga0105242_12212014 | Ga0105242_122120141 | 90 |
| 423 | 3300009177 | Ga0105248_10132102 | Ga0105248_101321025 | 90 |
| 424 | 3300009177 | Ga0105248_10402244 | Ga0105248_104022442 | 90 |
| 425 | 3300009545 | Ga0105237_11123617 | Ga0105237_111236172 | 90 |
| 426 | 3300009545 | Ga0105237_12109555 | Ga0105237_121095551 | 90 |
| 427 | 3300009553 | Ga0105249_10139821 | Ga0105249_101398212 | 90 |
| 428 | 3300009553 | Ga0105249_10226499 | Ga0105249_102264993 | 90 |
| 429 | 3300009553 | Ga0105249_10510123 | Ga0105249_105101231 | 90 |
| 430 | 3300010375 | Ga0105239_10569018 | Ga0105239_105690182 | 90 |
| 431 | 3300010375 | Ga0105239_10904316 | Ga0105239_109043161 | 90 |
| 432 | 3300010375 | Ga0105239_12527219 | Ga0105239_125272192 | 90 |
| 433 | 3300010375 | Ga0105239_12774107 | Ga0105239_127741072 | 90 |
| 434 | 3300011119 | Ga0105246_10449155 | Ga0105246_104491552 | 90 |
| 435 | 3300012491 | Ga0157329_1016661 | Ga0157329_10166612 | 90 |
| 436 | 3300012498 | Ga0157345_1009168 | Ga0157345_10091681 | 90 |
| 437 | 3300012502 | Ga0157347_1011188 | Ga0157347_10111882 | 90 |
| 438 | 3300012508 | Ga0157315_1067161 | Ga0157315_10671612 | 90 |
| 439 | 3300013100 | Ga0157373_10365092 | Ga0157373_103650921 | 90 |
| 440 | 3300013102 | Ga0157371_10042662 | Ga0157371_100426624 | 90 |
| 441 | 3300013104 | Ga0157370_11077329 | Ga0157370_110773292 | 90 |
| 442 | 3300013105 | Ga0157369_10844686 | Ga0157369_108446862 | 90 |
| 443 | 3300013306 | Ga0163162_10066115 | Ga0163162_100661154 | 90 |
| 444 | 3300013307 | Ga0157372_10464310 | Ga0157372_104643102 | 90 |
| 445 | 3300013307 | Ga0157372_11435744 | Ga0157372_114357441 | 90 |
| 446 | 3300013308 | Ga0157375_10226983 | Ga0157375_102269832 | 90 |
| 447 | 3300013308 | Ga0157375_11079152 | Ga0157375_110791521 | 90 |
| 448 | 3300014325 | Ga0163163_11187903 | Ga0163163_111879032 | 90 |
| 449 | 3300014325 | Ga0163163_11683161 | Ga0163163_116831612 | 90 |
| 450 | 3300014325 | Ga0163163_12430830 | Ga0163163_124308302 | 90 |
| 451 | 3300014326 | Ga0157380_10087295 | Ga0157380_100872952 | 90 |
| 452 | 3300014326 | Ga0157380_10338911 | Ga0157380_103389112 | 90 |
| 453 | 3300014745 | Ga0157377_10610317 | Ga0157377_106103172 | 90 |
| 454 | 3300014968 | Ga0157379_10093938 | Ga0157379_100939383 | 90 |
| 455 | 3300017792 | Ga0163161_10642490 | Ga0163161_106424902 | 90 |
| 456 | 3300020082 | Ga0206353_10988080 | Ga0206353_109880802 | 90 |
| 457 | 3300020082 | Ga0206353_12036647 | Ga0206353_120366472 | 90 |
| 458 | 3300025885 | Ga0207653_10001268 | Ga0207653_100012686 | 90 |
| 459 | 3300025885 | Ga0207653_10246722 | Ga0207653_102467222 | 90 |
| 460 | 3300025899 | Ga0207642_10304142 | Ga0207642_103041422 | 90 |
| 461 | 3300025904 | Ga0207647_10287451 | Ga0207647_102874512 | 90 |
| 462 | 3300025905 | Ga0207685_10004045 | Ga0207685_100040452 | 90 |
| 463 | 3300025905 | Ga0207685_10125879 | Ga0207685_101258792 | 90 |
| 464 | 3300025906 | Ga0207699_10058481 | Ga0207699_100584811 | 90 |
| 465 | 3300025908 | Ga0207643_10270978 | Ga0207643_102709782 | 90 |
| 466 | 3300025908 | Ga0207643_10953197 | Ga0207643_109531971 | 90 |
| 467 | 3300025910 | Ga0207684_10120613 | Ga0207684_101206135 | 90 |
| 468 | 3300025911 | Ga0207654_10248734 | Ga0207654_102487343 | 90 |
| 469 | 3300025911 | Ga0207654_10551209 | Ga0207654_105512092 | 90 |
| 470 | 3300025915 | Ga0207693_10000030 | Ga0207693_1000003013 | 90 |
| 471 | 3300025915 | Ga0207693_10027562 | Ga0207693_100275623 | 90 |
| 472 | 3300025915 | Ga0207693_10038032 | Ga0207693_100380327 | 90 |
| 473 | 3300025915 | Ga0207693_10726408 | Ga0207693_107264081 | 90 |
| 474 | 3300025916 | Ga0207663_10242571 | Ga0207663_102425713 | 90 |
| 475 | 3300025917 | Ga0207660_10017777 | Ga0207660_100177773 | 90 |
| 476 | 3300025919 | Ga0207657_10197949 | Ga0207657_101979492 | 90 |
| 477 | 3300025922 | Ga0207646_10625728 | Ga0207646_106257282 | 90 |
| 478 | 3300025923 | Ga0207681_10787994 | Ga0207681_107879941 | 90 |
| 479 | 3300025924 | Ga0207694_10213437 | Ga0207694_102134373 | 90 |
| 480 | 3300025925 | Ga0207650_11498320 | Ga0207650_114983202 | 90 |
| 481 | 3300025927 | Ga0207687_10055695 | Ga0207687_100556953 | 90 |
| 482 | 3300025928 | Ga0207700_11120389 | Ga0207700_111203891 | 90 |
| 483 | 3300025928 | Ga0207700_11683181 | Ga0207700_116831812 | 90 |
| 484 | 3300025929 | Ga0207664_10721618 | Ga0207664_107216182 | 90 |
| 485 | 3300025931 | Ga0207644_10074347 | Ga0207644_100743472 | 90 |
| 486 | 3300025931 | Ga0207644_10733419 | Ga0207644_107334192 | 90 |
| 487 | 3300025932 | Ga0207690_10289437 | Ga0207690_102894372 | 90 |
| 488 | 3300025933 | Ga0207706_10026648 | Ga0207706_100266485 | 90 |
| 489 | 3300025935 | Ga0207709_10244871 | Ga0207709_102448715 | 90 |
| 490 | 3300025937 | Ga0207669_10803380 | Ga0207669_108033802 | 90 |
| 491 | 3300025938 | Ga0207704_10529894 | Ga0207704_105298942 | 90 |
| 492 | 3300025939 | Ga0207665_10003333 | Ga0207665_100033336 | 90 |
| 493 | 3300025939 | Ga0207665_10024121 | Ga0207665_1002412110 | 90 |
| 494 | 3300025941 | Ga0207711_10108052 | Ga0207711_101080522 | 90 |
| 495 | 3300025941 | Ga0207711_10816874 | Ga0207711_108168742 | 90 |
| 496 | 3300025942 | Ga0207689_11464107 | Ga0207689_114641071 | 90 |
| 497 | 3300025944 | Ga0207661_10430586 | Ga0207661_104305862 | 90 |
| 498 | 3300025949 | Ga0207667_10039317 | Ga0207667_100393171 | 90 |
| 499 | 3300025949 | Ga0207667_11074930 | Ga0207667_110749302 | 90 |
| 500 | 3300025960 | Ga0207651_10791455 | Ga0207651_107914551 | 90 |
| 501 | 3300025961 | Ga0207712_10150907 | Ga0207712_101509072 | 90 |
| 502 | 3300025961 | Ga0207712_10259495 | Ga0207712_102594952 | 90 |
| 503 | 3300025972 | Ga0207668_10288660 | Ga0207668_102886602 | 90 |
| 504 | 3300025972 | Ga0207668_10460951 | Ga0207668_104609511 | 90 |
| 505 | 3300025972 | Ga0207668_10682151 | Ga0207668_106821511 | 90 |
| 506 | 3300025981 | Ga0207640_11571369 | Ga0207640_115713692 | 90 |
| 507 | 3300026041 | Ga0207639_10575475 | Ga0207639_105754753 | 90 |
| 508 | 3300026075 | Ga0207708_10036676 | Ga0207708_100366765 | 90 |
| 509 | 3300026075 | Ga0207708_10568818 | Ga0207708_105688182 | 90 |
| 510 | 3300026078 | Ga0207702_10011983 | Ga0207702_100119833 | 90 |
| 511 | 3300026078 | Ga0207702_10133539 | Ga0207702_101335394 | 90 |
| 512 | 3300026088 | Ga0207641_12019766 | Ga0207641_120197662 | 90 |
| 513 | 3300026089 | Ga0207648_10016547 | Ga0207648_100165474 | 90 |
| 514 | 3300026095 | Ga0207676_10113004 | Ga0207676_101130042 | 90 |
| 515 | 3300026116 | Ga0207674_11845896 | Ga0207674_118458962 | 90 |
| 516 | 3300026118 | Ga0207675_100067443 | Ga0207675_1000674434 | 90 |
| 517 | 3300026118 | Ga0207675_101156194 | Ga0207675_1011561942 | 90 |
| 518 | 3300026121 | Ga0207683_10032315 | Ga0207683_100323152 | 90 |
| 519 | 3300026121 | Ga0207683_10229859 | Ga0207683_102298592 | 90 |
| 520 | 3300026121 | Ga0207683_10407459 | Ga0207683_104074592 | 90 |
| 521 | 3300026142 | Ga0207698_10243536 | Ga0207698_102435362 | 90 |
| 522 | 3300027717 | Ga0209998_10033807 | Ga0209998_100338072 | 90 |
| 523 | 3300027907 | Ga0207428_10013670 | Ga0207428_100136706 | 90 |
| 524 | 3300027907 | Ga0207428_10817237 | Ga0207428_108172372 | 90 |
| 525 | 3300027907 | Ga0207428_11130245 | Ga0207428_111302451 | 90 |
| 526 | 3300028381 | Ga0268264_12359803 | Ga0268264_123598032 | 90 |
| 527 | 3300031852 | Ga0307410_10538271 | Ga0307410_105382712 | 90 |
| 528 | 3300031995 | Ga0307409_100148564 | Ga0307409_1001485643 | 90 |
| 529 | 3300032002 | Ga0307416_101491172 | Ga0307416_1014911722 | 90 |
| 530 | 3300032004 | Ga0307414_11618413 | Ga0307414_116184132 | 90 |
| 531 | 3300032126 | Ga0307415_100484234 | Ga0307415_1004842341 | 90 |
| 532 | 3300034817 | Ga0373948_0038603 | Ga0373948_0038603_685_957 | 90 |
| 533 | 3300034957 | Ga0373938_0002635 | Ga0373938_0002635_1011_1283 | 90 |
| 534 | 3300034957 | Ga0373938_0153603 | Ga0373938_0153603_64_345 | 90 |
| 535 | 3300035083 | Ga0373926_0375091 | Ga0373926_0375091_74_346 | 90 |
| 536 | 3300035084 | Ga0373928_0001755 | Ga0373928_0001755_17_289 | 90 |
| 537 | 3300035088 | Ga0373940_0021716 | Ga0373940_0021716_685_957 | 90 |
| 538 | 3300035089 | Ga0373944_0009900 | Ga0373944_0009900_1014_1286 | 90 |
| 539 | 3300035090 | Ga0373949_0008702 | Ga0373949_0008702_332_604 | 90 |
| 540 | 3300035090 | Ga0373949_0099248 | Ga0373949_0099248_82_354 | 90 |
| 541 | 3300035091 | Ga0373951_0053886 | Ga0373951_0053886_691_963 | 90 |
| 542 | 3300035092 | Ga0373952_0021658 | Ga0373952_0021658_503_775 | 90 |
| 543 | 3300035092 | Ga0373952_0162362 | Ga0373952_0162362_173_445 | 90 |
| 544 | 3300035112 | Ga0373932_0007185 | Ga0373932_0007185_1718_1990 | 90 |
| 545 | 3300035115 | Ga0373941_0028490 | Ga0373941_0028490_962_1234 | 90 |
| 546 | 3300035116 | Ga0373945_0160545 | Ga0373945_0160545_250_522 | 90 |
| 547 | 3300035121 | Ga0373960_0047071 | Ga0373960_0047071_653_925 | 90 |
| 548 | 3300035170 | Ga0373943_0029115 | Ga0373943_0029115_1698_1970 | 90 |
| 549 | 3300035171 | Ga0373946_0041418 | Ga0373946_0041418_443_715 | 90 |
| 550 | 3300035207 | Ga0373942_0195777 | Ga0373942_0195777_285_566 | 90 |
| 551 | 3300035241 | Ga0373961_0013528 | Ga0373961_0013528_1123_1395 | 90 |
| 552 | 3300035242 | Ga0373962_0002078 | Ga0373962_0002078_4478_4750 | 90 |
| 553 | 3300035242 | Ga0373962_0050513 | Ga0373962_0050513_706_978 | 90 |
| 554 | 3300035691 | Ga0373931_0035482 | Ga0373931_0035482_395_667 | 90 |
| 555 | 3300035691 | Ga0373931_0566719 | Ga0373931_0566719_368_649 | 90 |
| 556 | 3300035725 | Ga0373947_0008966 | Ga0373947_0008966_3079_3351 | 90 |
| 557 | 3300037068 | Ga0373925_0103348 | Ga0373925_0103348_367_639 | 90 |
| 558 | 3300037312 | Ga0395899_0037746 | Ga0395899_0037746_1633_1905 | 90 |
| 559 | 3300037312 | Ga0395899_0041313 | Ga0395899_0041313_1042_1314 | 90 |
| 560 | 3300037418 | Ga0395900_0117068 | Ga0395900_0117068_2356_2628 | 90 |
| 561 | 3300037418 | Ga0395900_0304553 | Ga0395900_0304553_649_921 | 90 |
| 562 | 3300037418 | Ga0395900_0638859 | Ga0395900_0638859_518_790 | 90 |
| 563 | 3300037418 | Ga0395900_0772238 | Ga0395900_0772238_438_710 | 90 |
| 564 | 3300037466 | Ga0395898_0072155 | Ga0395898_0072155_1348_1620 | 90 |
| 565 | 3300037466 | Ga0395898_0621979 | Ga0395898_0621979_651_923 | 90 |
| 566 | 3300037471 | Ga0395905_0053061 | Ga0395905_0053061_930_1202 | 90 |
| 567 | 3300037471 | Ga0395905_0381323 | Ga0395905_0381323_621_893 | 90 |
| 568 | 3300038443 | Ga0395901_0079204 | Ga0395901_0079204_957_1229 | 90 |
| 569 | 3300041501 | Ga0451845_0864229 | Ga0451845_0864229_278_550 | 90 |
| 570 | 3300041505 | Ga0451849_0034861 | Ga0451849_0034861_137_409 | 90 |
| 571 | 3300041507 | Ga0451851_0347102 | Ga0451851_0347102_79_351 | 90 |
| 572 | 3300041512 | Ga0451853_3133616 | Ga0451853_3133616_937_1209 | 90 |
| 573 | 3300042005 | Ga0439448_0028095 | Ga0439448_0028095_535_807 | 90 |
| 574 | 3300042005 | Ga0439448_0042866 | Ga0439448_0042866_1094_1366 | 90 |
| 575 | 3300042012 | Ga0439455_0042830 | Ga0439455_0042830_272_544 | 90 |
| 576 | 3300042016 | Ga0439463_015226 | Ga0439463_015226_768_1040 | 90 |
| 577 | 3300042157 | Ga0439458_0042246 | Ga0439458_0042246_240_512 | 90 |
| 578 | 3300042439 | Ga0439464_0155349 | Ga0439464_0155349_425_697 | 90 |
| 579 | 3300044735 | Ga0466968_0511629 | Ga0466968_0511629_25_306 | 90 |
| 580 | 3300045051 | Ga0451576_0123507 | Ga0451576_0123507_1514_1786 | 90 |
| 581 | 3300046455 | Ga0495603_0003706 | Ga0495603_0003706_4941_5213 | 90 |
| 582 | 3300046461 | Ga0495641_0005237 | Ga0495641_0005237_7946_8218 | 90 |
| 583 | 3300046461 | Ga0495641_0063001 | Ga0495641_0063001_804_1085 | 90 |
| 584 | 3300046473 | Ga0495582_0058980 | Ga0495582_0058980_384_656 | 90 |
| 585 | 3300046473 | Ga0495582_0105401 | Ga0495582_0105401_1220_1492 | 90 |
| 586 | 3300046473 | Ga0495582_0614792 | Ga0495582_0614792_331_612 | 90 |
| 587 | 3300046475 | Ga0495639_0364190 | Ga0495639_0364190_298_570 | 90 |
| 588 | 3300046491 | Ga0495584_0133942 | Ga0495584_0133942_255_527 | 90 |
| 589 | 3300046492 | Ga0495585_0361558 | Ga0495585_0361558_265_537 | 90 |
| 590 | 3300046499 | Ga0495594_0000927 | Ga0495594_0000927_12527_12799 | 90 |
| 591 | 3300046525 | Ga0495663_0319379 | Ga0495663_0319379_143_415 | 90 |
| 592 | 3300046526 | Ga0495666_0017192 | Ga0495666_0017192_1739_2011 | 90 |
| 593 | 3300046531 | Ga0495665_0158964 | Ga0495665_0158964_473_745 | 90 |
| 594 | 3300046531 | Ga0495665_0335675 | Ga0495665_0335675_330_602 | 90 |
| 595 | 3300046674 | Ga0495588_0003423 | Ga0495588_0003423_2766_3038 | 90 |
| 596 | 3300046674 | Ga0495588_0586760 | Ga0495588_0586760_19_291 | 90 |
| 597 | 3300047321 | Ga0495676_0006624 | Ga0495676_0006624_7138_7410 | 90 |
| 598 | 3300047321 | Ga0495676_0119731 | Ga0495676_0119731_816_1088 | 90 |
| 599 | 3300048903 | Ga0496100_0001005 | Ga0496100_0001005_1894_2166 | 90 |
| 600 | 3300048903 | Ga0496100_0237988 | Ga0496100_0237988_1040_1312 | 90 |
| 601 | 3300048903 | Ga0496100_0522469 | Ga0496100_0522469_63_335 | 90 |
| 602 | 3300048904 | Ga0496101_0009726 | Ga0496101_0009726_4569_4841 | 90 |
| 603 | 3300048904 | Ga0496101_0112799 | Ga0496101_0112799_81_362 | 90 |
| 604 | 3300048904 | Ga0496101_0189128 | Ga0496101_0189128_641_913 | 90 |
| 605 | 3300048905 | Ga0496102_0025710 | Ga0496102_0025710_2567_2839 | 90 |
| 606 | 3300048905 | Ga0496102_0145217 | Ga0496102_0145217_1132_1404 | 90 |
| 607 | 3300048905 | Ga0496102_0147329 | Ga0496102_0147329_1756_2028 | 90 |
| 608 | 3300048905 | Ga0496102_0651937 | Ga0496102_0651937_283_555 | 90 |
| 609 | 3300048906 | Ga0496103_0086753 | Ga0496103_0086753_416_688 | 90 |
| 610 | 3300048907 | Ga0496104_0003336 | Ga0496104_0003336_12999_13271 | 90 |
| 611 | 3300048907 | Ga0496104_0072353 | Ga0496104_0072353_130_402 | 90 |
| 612 | 3300048907 | Ga0496104_0417804 | Ga0496104_0417804_275_556 | 90 |
| 613 | 3300048907 | Ga0496104_0829597 | Ga0496104_0829597_304_576 | 90 |
| 614 | 3300048908 | Ga0496105_0000671 | Ga0496105_0000671_7263_7535 | 90 |
| 615 | 3300048908 | Ga0496105_0025383 | Ga0496105_0025383_4230_4511 | 90 |
| 616 | 3300048908 | Ga0496105_0062025 | Ga0496105_0062025_1819_2091 | 90 |
| 617 | 3300048909 | Ga0496106_0011147 | Ga0496106_0011147_5941_6222 | 90 |
| 618 | 3300048909 | Ga0496106_0334686 | Ga0496106_0334686_558_830 | 90 |
| 619 | 3300048909 | Ga0496106_0363974 | Ga0496106_0363974_87_359 | 90 |
| 620 | 3300048909 | Ga0496106_1310570 | Ga0496106_1310570_277_549 | 90 |
| 621 | 3300048910 | Ga0496107_0008053 | Ga0496107_0008053_4570_4842 | 90 |
| 622 | 3300048910 | Ga0496107_0586627 | Ga0496107_0586627_202_474 | 90 |
| 623 | 3300048910 | Ga0496107_0965741 | Ga0496107_0965741_146_418 | 90 |
| 624 | 3300048911 | Ga0496108_0000317 | Ga0496108_0000317_29378_29650 | 90 |
| 625 | 3300048911 | Ga0496108_0003773 | Ga0496108_0003773_833_1114 | 90 |
| 626 | 3300048911 | Ga0496108_0019040 | Ga0496108_0019040_3785_4057 | 90 |
| 627 | 3300048911 | Ga0496108_0123220 | Ga0496108_0123220_1216_1488 | 90 |
| 628 | 3300048912 | Ga0496109_0007014 | Ga0496109_0007014_5567_5839 | 90 |
| 629 | 3300048912 | Ga0496109_0082943 | Ga0496109_0082943_672_944 | 90 |
| 630 | 3300048912 | Ga0496109_0090036 | Ga0496109_0090036_794_1066 | 90 |
| 631 | 3300048912 | Ga0496109_0290400 | Ga0496109_0290400_448_729 | 90 |
| 632 | 3300048913 | Ga0496110_0000774 | Ga0496110_0000774_3795_4067 | 90 |
| 633 | 3300048913 | Ga0496110_0003926 | Ga0496110_0003926_6921_7202 | 90 |
| 634 | 3300048913 | Ga0496110_0023700 | Ga0496110_0023700_4099_4371 | 90 |
| 635 | 3300048913 | Ga0496110_0041097 | Ga0496110_0041097_3278_3559 | 90 |
| 636 | 3300048913 | Ga0496110_0142582 | Ga0496110_0142582_853_1125 | 90 |
| 637 | 3300048913 | Ga0496110_0343214 | Ga0496110_0343214_848_1120 | 90 |
| 638 | 3300048913 | Ga0496110_1203207 | Ga0496110_1203207_45_317 | 90 |
| 639 | 3300048914 | Ga0496111_0001461 | Ga0496111_0001461_8421_8693 | 90 |
| 640 | 3300048914 | Ga0496111_0035877 | Ga0496111_0035877_1439_1711 | 90 |
| 641 | 3300048914 | Ga0496111_0086730 | Ga0496111_0086730_1612_1893 | 90 |
| 642 | 3300048914 | Ga0496111_0117232 | Ga0496111_0117232_15_296 | 90 |
| 643 | 3300048914 | Ga0496111_0162573 | Ga0496111_0162573_363_635 | 90 |
| 644 | 3300048914 | Ga0496111_0302204 | Ga0496111_0302204_334_606 | 90 |
| 645 | 3300048915 | Ga0496112_0059782 | Ga0496112_0059782_377_658 | 90 |
| 646 | 3300048915 | Ga0496112_0117971 | Ga0496112_0117971_1581_1853 | 90 |
| 647 | 3300048915 | Ga0496112_0635782 | Ga0496112_0635782_386_658 | 90 |
| 648 | 3300048916 | Ga0496113_0001684 | Ga0496113_0001684_6817_7089 | 90 |
| 649 | 3300048916 | Ga0496113_0014555 | Ga0496113_0014555_657_929 | 90 |
| 650 | 3300048916 | Ga0496113_0091637 | Ga0496113_0091637_1696_1977 | 90 |
| 651 | 3300048916 | Ga0496113_0342847 | Ga0496113_0342847_217_489 | 90 |
| 652 | 3300048917 | Ga0496114_0032146 | Ga0496114_0032146_3154_3426 | 90 |
| 653 | 3300048917 | Ga0496114_0080759 | Ga0496114_0080759_1123_1395 | 90 |
| 654 | 3300048917 | Ga0496114_1304659 | Ga0496114_1304659_88_369 | 90 |
| 655 | 3300048918 | Ga0496115_0137281 | Ga0496115_0137281_693_965 | 90 |
| 656 | 3300048918 | Ga0496115_0412095 | Ga0496115_0412095_326_598 | 90 |
| 657 | 3300048918 | Ga0496115_0511586 | Ga0496115_0511586_149_421 | 90 |
| 658 | 3300049572 | Ga0501036_0179126 | Ga0501036_0179126_758_1030 | 90 |
| 659 | 3300049576 | Ga0501040_0762921 | Ga0501040_0762921_55_327 | 90 |
| 660 | 3300049577 | Ga0501041_0262927 | Ga0501041_0262927_718_990 | 90 |
| 661 | 3300049591 | Ga0501075_0206334 | Ga0501075_0206334_392_664 | 90 |
| 662 | 3300049741 | Ga0501079_0519467 | Ga0501079_0519467_566_838 | 90 |
| 663 | 3300049743 | Ga0501081_0498168 | Ga0501081_0498168_148_420 | 90 |
| 664 | 3300050507 | nmdc:mga05p37_145726_c1 | nmdc:mga05p37_145726_c1_740_1012 | 90 |
| 665 | 3300050507 | nmdc:mga05p37_356842_c1 | nmdc:mga05p37_356842_c1_505_777 | 90 |
| 666 | 3300050510 | nmdc:mga06r32_240504_c1 | nmdc:mga06r32_240504_c1_141_413 | 90 |
| 667 | 3300050510 | nmdc:mga06r32_554586_c1 | nmdc:mga06r32_554586_c1_173_445 | 90 |
| 668 | 3300050511 | nmdc:mga08y16_1102905_c1 | nmdc:mga08y16_1102905_c1_186_458 | 90 |
| 669 | 3300050511 | nmdc:mga08y16_27600_c1 | nmdc:mga08y16_27600_c1_2754_3026 | 90 |
| 670 | 3300050512 | nmdc:mga0n895_1286835_c1 | nmdc:mga0n895_1286835_c1_172_444 | 90 |
| 671 | 3300050512 | nmdc:mga0n895_1551336_c1 | nmdc:mga0n895_1551336_c1_322_594 | 90 |
| 672 | 3300050512 | nmdc:mga0n895_48692_c1 | nmdc:mga0n895_48692_c1_3351_3623 | 90 |
| 673 | 3300050512 | nmdc:mga0n895_7454_c1 | nmdc:mga0n895_7454_c1_7099_7371 | 90 |
| 674 | 3300050513 | nmdc:mga0rr50_1356020_c1 | nmdc:mga0rr50_1356020_c1_78_350 | 90 |
| 675 | 3300050513 | nmdc:mga0rr50_441412_c1 | nmdc:mga0rr50_441412_c1_104_376 | 90 |
| 676 | 3300050513 | nmdc:mga0rr50_49082_c1 | nmdc:mga0rr50_49082_c1_2775_3047 | 90 |
| 677 | 3300050513 | nmdc:mga0rr50_652630_c1 | nmdc:mga0rr50_652630_c1_120_392 | 90 |
| 678 | 3300050514 | nmdc:mga08x19_63526_c1 | nmdc:mga08x19_63526_c1_1275_1547 | 90 |
| 679 | 3300050515 | nmdc:mga0a205_127261_c1 | nmdc:mga0a205_127261_c1_119_391 | 90 |
| 680 | 3300050515 | nmdc:mga0a205_642577_c1 | nmdc:mga0a205_642577_c1_400_672 | 90 |
| 681 | 3300050515 | nmdc:mga0a205_84787_c1 | nmdc:mga0a205_84787_c1_1619_1891 | 90 |
| 682 | 3300061734 | Ga0530510_1114863 | Ga0530510_1114863_50_322 | 90 |
| 683 | 3300003373 | JGI25407J50210_10021184 | JGI25407J50210_100211841 | 91 |
| 684 | 3300005341 | Ga0070691_10814738 | Ga0070691_108147382 | 91 |
| 685 | 3300005439 | Ga0070711_101276558 | Ga0070711_1012765581 | 91 |
| 686 | 3300005981 | Ga0081538_10002566 | Ga0081538_100025666 | 91 |
| 687 | 3300009094 | Ga0111539_10041528 | Ga0111539_100415283 | 91 |
| 688 | 3300032002 | Ga0307416_100797732 | Ga0307416_1007977321 | 91 |
| 689 | 3300037418 | Ga0395900_0202426 | Ga0395900_0202426_1513_1788 | 91 |
| 690 | 3300037418 | Ga0395900_1574161 | Ga0395900_1574161_46_321 | 91 |
| 691 | 3300037471 | Ga0395905_0428913 | Ga0395905_0428913_380_655 | 91 |
| 692 | 3300038443 | Ga0395901_0648951 | Ga0395901_0648951_369_644 | 91 |
| 693 | 3300038443 | Ga0395901_1259423 | Ga0395901_1259423_121_396 | 91 |
| 694 | 3300038443 | Ga0395901_1792898 | Ga0395901_1792898_49_324 | 91 |
| 695 | 3300046491 | Ga0495584_0308492 | Ga0495584_0308492_501_776 | 91 |
| 696 | 3300046691 | Ga0495670_0175229 | Ga0495670_0175229_410_685 | 91 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8glv-assembly1.cif.gz_AR | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.6358 | 15 | 60 |
| 8j07-assembly1.cif.gz_n8 | 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes | 0.6334 | 15 | 61 |
| 3hes-assembly3.cif.gz_B | human prion protein variant f198s with m129 | 0.6274 | 5 | 61 |
| 5wi4-assembly1.cif.gz_C | crystal structure of dynlt1/tctex-1 in complex with arhgef2 | 0.5938 | 6 | 61 |
| 8glv-assembly1.cif.gz_MK | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.5932 | 12 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G3V8D8_119_217_3.30.1140.40 | Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 | 0.7491 | 15 | 60 | 3.30.1140.40 |
| af_Q6TGT3_15_113_3.30.1140.40 | Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 | 0.6538 | 19 | 57 | 3.30.1140.40 |
| 3hesB00 | Mainly Alpha;Orthogonal Bundle;Major Prion Protein;Prion/Doppel protein, beta-ribbon domain | 0.6274 | 5 | 61 | 1.10.790.10 |
| af_P77475_18_87_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.627 | 16 | 63 | 3.40.50.1000 |
| af_Q4CSR2_869_1039_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.6066 | 7 | 39 | 3.80.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529FDB9-F1-model_v4 | DUF2277 domain-containing protein | 1.007 | 1 | 70 |
|
| AF-A0A6P2EKU9-F1-model_v4 | DUF2277 domain-containing protein | 0.9996 | 1 | 87 |
|
| AF-E0I5X4-F1-model_v4 | DUF2277 domain-containing protein | 0.9985 | 1 | 86 |
|
| AF-A0A327XPT1-F1-model_v4 | deleted | 0.998 | 1 | 87 |
|
| AF-A0A7W1U879-F1-model_v4 | DUF2277 domain-containing protein | 0.9977 | 1 | 87 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar