F475845

General Info

Members Datasets Scaffolds Average Seq Length
696 318 696 90

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0019765|Ga0373943_0019765_185_466
Length 85
Sequence MGGMCRNIHTLFNFEPPASEDEVHGAALQYVRKVSGFTKPSQANEQVAAATARLIDALVTTAPPKDREVEAERRRERSAKRFAAA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
101 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
102 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 11.93
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10021184 3300003373 Bacteria 1691
2 JGI25407J50210_10084194 3300003373 Bacteria 789
3 Ga0070658_11965389 3300005327 Bacteria 505
4 Ga0070676_10373089 3300005328 Bacteria 986
5 Ga0070690_100088487 3300005330 Bacteria 2036
6 Ga0070690_100139436 3300005330 Bacteria 1645
7 Ga0070690_101043692 3300005330 Bacteria 646
8 Ga0070666_10219068 3300005335 Bacteria 1342
9 Ga0070680_100050076 3300005336 Bacteria 3407
10 Ga0070680_100053040 3300005336 Bacteria 3309
11 Ga0070680_100800706 3300005336 Bacteria 812
12 Ga0070680_101098288 3300005336 Bacteria 687
13 Ga0070682_100293570 3300005337 Bacteria 1190
14 Ga0068868_100057737 3300005338 Bacteria 3067
15 Ga0068868_100150235 3300005338 Bacteria 1918
16 Ga0068868_100187508 3300005338 Bacteria 1719
17 Ga0068868_100925291 3300005338 Bacteria 794
18 Ga0070660_100097164 3300005339 Bacteria 2330
19 Ga0070689_100226686 3300005340 Bacteria 1535
20 Ga0070691_10080342 3300005341 Bacteria 1596
21 Ga0070691_10099916 3300005341 Bacteria 1440
22 Ga0070691_10564950 3300005341 Bacteria 667
23 Ga0070691_10814738 3300005341 Bacteria 570
24 Ga0070687_100033984 3300005343 Bacteria 2521
25 Ga0070687_100106830 3300005343 Bacteria 1577
26 Ga0070661_100127074 3300005344 Bacteria 1913
27 Ga0070692_10021909 3300005345 Bacteria 3114
28 Ga0070692_10255794 3300005345 Bacteria 1050
29 Ga0070669_100075770 3300005353 Bacteria 2496
30 Ga0070669_101176318 3300005353 Bacteria 662
31 Ga0070671_100133814 3300005355 Bacteria 2089
32 Ga0070671_100429762 3300005355 Bacteria 1132
33 Ga0070674_100052965 3300005356 Bacteria 2800
34 Ga0070674_100166036 3300005356 Bacteria 1679
35 Ga0070688_100155783 3300005365 Bacteria 1565
36 Ga0070688_101569382 3300005365 Bacteria 537
37 Ga0070659_100233430 3300005366 Bacteria 1520
38 Ga0070659_101924823 3300005366 Bacteria 530
39 Ga0070703_10220328 3300005406 Bacteria 755
40 Ga0070709_10175103 3300005434 Bacteria 1502
41 Ga0070709_10337355 3300005434 Bacteria 1110
42 Ga0070714_100122115 3300005435 Bacteria 2318
43 Ga0070714_100129462 3300005435 Bacteria 2254
44 Ga0070714_101701952 3300005435 Bacteria 616
45 Ga0070713_100730322 3300005436 Bacteria 946
46 Ga0070713_101501922 3300005436 Bacteria 654
47 Ga0070710_10034252 3300005437 Bacteria 2762
48 Ga0070701_10007614 3300005438 Bacteria 4639
49 Ga0070701_10008802 3300005438 Bacteria 4386
50 Ga0070711_100005295 3300005439 Bacteria 7704
51 Ga0070711_100169269 3300005439 Bacteria 1664
52 Ga0070711_100205509 3300005439 Bacteria 1522
53 Ga0070711_100661771 3300005439 Bacteria 876
54 Ga0070711_101276558 3300005439 Bacteria 637
55 Ga0070705_100003385 3300005440 Bacteria 7818
56 Ga0070700_100010634 3300005441 Bacteria 5082
57 Ga0070700_100260943 3300005441 Bacteria 1248
58 Ga0070694_100135146 3300005444 Bacteria 1786
59 Ga0070694_100458399 3300005444 Bacteria 1008
60 Ga0070708_100110352 3300005445 Bacteria 2527
61 Ga0070708_100288335 3300005445 Bacteria 1545
62 Ga0070663_100536595 3300005455 Unclassified 976
63 Ga0070678_100672331 3300005456 Bacteria 930
64 Ga0070678_100854057 3300005456 Bacteria 830
65 Ga0070678_100984296 3300005456 Bacteria 774
66 Ga0070681_10021937 3300005458 Bacteria 6406
67 Ga0068867_100150678 3300005459 Bacteria 1826
68 Ga0070685_10118398 3300005466 Bacteria 1642
69 Ga0070685_10677636 3300005466 Bacteria 750
70 Ga0070706_100116713 3300005467 Bacteria 2486
71 Ga0070706_100234612 3300005467 Bacteria 1713
72 Ga0070707_100177575 3300005468 Bacteria 2076
73 Ga0070698_100017096 3300005471 Bacteria 7646
74 Ga0070699_100135215 3300005518 Bacteria 2175
75 Ga0070699_100337167 3300005518 Bacteria 1357
76 Ga0070699_100534815 3300005518 Bacteria 1066
77 Ga0070679_101530584 3300005530 Bacteria 614
78 Ga0070684_100006697 3300005535 Bacteria 8930
79 Ga0070684_100020586 3300005535 Bacteria 5472
80 Ga0070684_100156536 3300005535 Bacteria 2066
81 Ga0070684_100465069 3300005535 Bacteria 1170
82 Ga0070684_100549318 3300005535 Bacteria 1072
83 Ga0070684_100790428 3300005535 Unclassified 887
84 Ga0070684_101802004 3300005535 Bacteria 578
85 Ga0068853_100192017 3300005539 Bacteria 1856
86 Ga0068853_100625846 3300005539 Bacteria 1023
87 Ga0070672_100241964 3300005543 Bacteria 1518
88 Ga0070672_101408579 3300005543 Bacteria 624
89 Ga0070686_100018190 3300005544 Bacteria 4119
90 Ga0070686_100047573 3300005544 Bacteria 2712
91 Ga0070686_100499061 3300005544 Bacteria 944
92 Ga0070686_101534784 3300005544 Bacteria 562
93 Ga0070695_100017405 3300005545 Bacteria 4357
94 Ga0070695_100059120 3300005545 Bacteria 2480
95 Ga0070696_100020918 3300005546 Bacteria 4434
96 Ga0070696_100121166 3300005546 Bacteria 1893
97 Ga0070693_100018095 3300005547 Bacteria 3675
98 Ga0070693_100021785 3300005547 Bacteria 3399
99 Ga0070693_100054746 3300005547 Bacteria 2296
100 Ga0070704_100109126 3300005549 Bacteria 2102
101 Ga0070664_100144377 3300005564 Bacteria 2098
102 Ga0068857_102455766 3300005577 Bacteria 512
103 Ga0068856_100112299 3300005614 Bacteria 2723
104 Ga0068856_100188380 3300005614 Bacteria 2077
105 Ga0068856_100296614 3300005614 Bacteria 1634
106 Ga0068856_101294970 3300005614 Bacteria 744
107 Ga0068856_101781248 3300005614 Bacteria 628
108 Ga0068856_102506794 3300005614 Bacteria 522
109 Ga0070702_100018341 3300005615 Bacteria 3630
110 Ga0070702_100019258 3300005615 Bacteria 3556
111 Ga0070702_100145094 3300005615 Bacteria 1516
112 Ga0070702_100339215 3300005615 Bacteria 1054
113 Ga0068852_100066678 3300005616 Bacteria 3144
114 Ga0068852_101563486 3300005616 Bacteria 682
115 Ga0068859_100111263 3300005617 Bacteria 2801
116 Ga0068859_102615070 3300005617 Bacteria 555
117 Ga0068864_100166944 3300005618 Bacteria 2004
118 Ga0068864_100537376 3300005618 Bacteria 1128
119 Ga0068864_100707218 3300005618 Bacteria 985
120 Ga0068866_10012856 3300005718 Bacteria 3656
121 Ga0068866_10019471 3300005718 Bacteria 3091
122 Ga0068866_11118390 3300005718 Bacteria 565
123 Ga0068861_100403037 3300005719 Bacteria 1214
124 Ga0068870_10258637 3300005840 Bacteria 1082
125 Ga0068870_10510676 3300005840 Bacteria 803
126 Ga0068858_100103031 3300005842 Bacteria 2662
127 Ga0068862_100149026 3300005844 Bacteria 2081
128 Ga0081455_10007478 3300005937 Bacteria 11503
129 Ga0081455_10105305 3300005937 Bacteria 2254
130 Ga0081538_10001960 3300005981 Bacteria 20612
131 Ga0081538_10002508 3300005981 Bacteria 17875
132 Ga0081538_10002566 3300005981 Bacteria 17640
133 Ga0081538_10004666 3300005981 Bacteria 12565
134 Ga0081538_10009134 3300005981 Bacteria 8314
135 Ga0081538_10011726 3300005981 Bacteria 7075
136 Ga0081538_10011801 3300005981 Bacteria 7051
137 Ga0081538_10016040 3300005981 Bacteria 5765
138 Ga0081538_10040648 3300005981 Bacteria 2963
139 Ga0081538_10043061 3300005981 Bacteria 2841
140 Ga0081538_10043342 3300005981 Bacteria 2827
141 Ga0081538_10138225 3300005981 Bacteria 1129
142 Ga0081538_10160454 3300005981 Bacteria 1000
143 Ga0081540_1010122 3300005983 Bacteria 6419
144 Ga0081540_1197022 3300005983 Bacteria 736
145 Ga0081539_10154109 3300005985 Bacteria 1102
146 Ga0070717_10220519 3300006028 Bacteria 1667
147 Ga0070717_10250716 3300006028 Bacteria 1564
148 Ga0075365_10011921 3300006038 Bacteria 5135
149 Ga0075365_10020204 3300006038 Bacteria 4125
150 Ga0075365_10193190 3300006038 Bacteria 1425
151 Ga0075365_11053908 3300006038 Bacteria 573
152 Ga0075363_100030031 3300006048 Bacteria 2811
153 Ga0075363_100858746 3300006048 Bacteria 554
154 Ga0075364_10110756 3300006051 Bacteria 1832
155 Ga0075364_10318677 3300006051 Bacteria 1059
156 Ga0075432_10053194 3300006058 Bacteria 1431
157 Ga0075432_10108741 3300006058 Unclassified 1031
158 Ga0070715_10000495 3300006163 Bacteria 10272
159 Ga0070715_10029689 3300006163 Bacteria 2204
160 Ga0070715_10239938 3300006163 Bacteria 942
161 Ga0070716_101066677 3300006173 Bacteria 642
162 Ga0070712_100000012 3300006175 Bacteria 118838
163 Ga0070712_100060393 3300006175 Bacteria 2673
164 Ga0070712_100568582 3300006175 Bacteria 957
165 Ga0070712_100679565 3300006175 Bacteria 876
166 Ga0070712_101748251 3300006175 Bacteria 544
167 Ga0075362_10262768 3300006177 Bacteria 851
168 Ga0075367_10949822 3300006178 Bacteria 548
169 Ga0097621_100460078 3300006237 Bacteria 1147
170 Ga0075428_100107582 3300006844 Bacteria 3039
171 Ga0075430_100228590 3300006846 Bacteria 1543
172 Ga0075430_100456027 3300006846 Bacteria 1055
173 Ga0075431_100381989 3300006847 Bacteria 1412
174 Ga0075431_100666609 3300006847 Bacteria 1020
175 Ga0075431_101888886 3300006847 Bacteria 553
176 Ga0075433_10299799 3300006852 Bacteria 1423
177 Ga0075433_10331953 3300006852 Bacteria 1345
178 Ga0075433_10519590 3300006852 Bacteria 1047
179 Ga0075434_100199305 3300006871 Bacteria 2021
180 Ga0075434_100366150 3300006871 Bacteria 1462
181 Ga0075434_100386849 3300006871 Bacteria 1420
182 Ga0075434_101215764 3300006871 Bacteria 765
183 Ga0068865_100076837 3300006881 Bacteria 2385
184 Ga0075436_100005811 3300006914 Bacteria 8471
185 Ga0075436_100166322 3300006914 Bacteria 1556
186 Ga0075436_100260819 3300006914 Bacteria 1236
187 Ga0097620_100111263 3300006931 Bacteria 2801
188 Ga0097620_102615167 3300006931 Bacteria 555
189 Ga0075435_100026571 3300007076 Bacteria 4518
190 Ga0075435_100175518 3300007076 Bacteria 1809
191 Ga0075435_100374808 3300007076 Bacteria 1222
192 Ga0075435_100445515 3300007076 Bacteria 1116
193 Ga0105250_10441324 3300009092 Bacteria 583
194 Ga0105240_10328973 3300009093 Bacteria 1739
195 Ga0105240_10968291 3300009093 Bacteria 912
196 Ga0111539_10041528 3300009094 Bacteria 5530
197 Ga0111539_10355322 3300009094 Bacteria 1705
198 Ga0111539_11199630 3300009094 Bacteria 881
199 Ga0111539_11983094 3300009094 Bacteria 675
200 Ga0105245_10000438 3300009098 Bacteria 38412
201 Ga0105245_10011634 3300009098 Bacteria 7660
202 Ga0105245_10112892 3300009098 Bacteria 2530
203 Ga0105245_10159400 3300009098 Bacteria 2140
204 Ga0105245_10510630 3300009098 Bacteria 1219
205 Ga0105245_12093121 3300009098 Bacteria 620
206 Ga0105247_10016614 3300009101 Bacteria 4412
207 Ga0105247_10767344 3300009101 Bacteria 732
208 Ga0114129_10061875 3300009147 Bacteria 5231
209 Ga0114129_10080698 3300009147 Bacteria 4522
210 Ga0114129_10155732 3300009147 Bacteria 3125
211 Ga0114129_10177731 3300009147 Bacteria 2898
212 Ga0114129_10256293 3300009147 Bacteria 2347
213 Ga0114129_10560216 3300009147 Bacteria 1485
214 Ga0114129_10589599 3300009147 Bacteria 1441
215 Ga0114129_11779054 3300009147 Bacteria 750
216 Ga0114129_12026956 3300009147 Bacteria 695
217 Ga0114129_12062753 3300009147 Bacteria 689
218 Ga0114129_12646663 3300009147 Bacteria 598
219 Ga0105243_10057760 3300009148 Bacteria 3091
220 Ga0105243_10064578 3300009148 Bacteria 2938
221 Ga0105243_10153368 3300009148 Bacteria 1979
222 Ga0105243_10551995 3300009148 Bacteria 1101
223 Ga0105243_12653208 3300009148 Bacteria 541
224 Ga0105241_10326989 3300009174 Bacteria 1324
225 Ga0105241_10634788 3300009174 Unclassified 968
226 Ga0105242_10037976 3300009176 Bacteria 3870
227 Ga0105242_10048158 3300009176 Bacteria 3463
228 Ga0105242_10073924 3300009176 Bacteria 2835
229 Ga0105242_12212014 3300009176 Bacteria 595
230 Ga0105248_10132102 3300009177 Bacteria 2817
231 Ga0105248_10402244 3300009177 Bacteria 1542
232 Ga0105248_11127871 3300009177 Bacteria 886
233 Ga0105248_11982758 3300009177 Bacteria 661
234 Ga0105237_10001241 3300009545 Bacteria 34013
235 Ga0105237_11123617 3300009545 Bacteria 792
236 Ga0105237_12109555 3300009545 Bacteria 573
237 Ga0105237_12367658 3300009545 Bacteria 541
238 Ga0105238_10167241 3300009551 Bacteria 2175
239 Ga0105249_10077959 3300009553 Bacteria 3074
240 Ga0105249_10139821 3300009553 Bacteria 2320
241 Ga0105249_10226499 3300009553 Bacteria 1842
242 Ga0105249_10510123 3300009553 Bacteria 1249
243 Ga0105249_12449475 3300009553 Bacteria 594
244 Ga0105249_13456085 3300009553 Bacteria 508
245 Ga0105239_10234284 3300010375 Bacteria 2060
246 Ga0105239_10569018 3300010375 Bacteria 1291
247 Ga0105239_10904316 3300010375 Bacteria 1013
248 Ga0105239_12011416 3300010375 Bacteria 671
249 Ga0105239_12527219 3300010375 Bacteria 599
250 Ga0105239_12774107 3300010375 Bacteria 572
251 Ga0105246_10449155 3300011119 Bacteria 1083
252 Ga0157329_1016661 3300012491 Bacteria 648
253 Ga0157345_1009168 3300012498 Bacteria 840
254 Ga0157347_1011188 3300012502 Bacteria 951
255 Ga0157315_1067161 3300012508 Bacteria 519
256 Ga0157373_10365092 3300013100 Bacteria 1031
257 Ga0157371_10042662 3300013102 Bacteria 3233
258 Ga0157370_10658974 3300013104 Bacteria 956
259 Ga0157370_11077329 3300013104 Bacteria 726
260 Ga0157369_10844686 3300013105 Bacteria 940
261 Ga0163162_10066115 3300013306 Bacteria 3664
262 Ga0157372_10464310 3300013307 Bacteria 1475
263 Ga0157372_10892395 3300013307 Bacteria 1032
264 Ga0157372_11435744 3300013307 Bacteria 795
265 Ga0157375_10226983 3300013308 Bacteria 2026
266 Ga0157375_10483647 3300013308 Bacteria 1403
267 Ga0157375_11079152 3300013308 Bacteria 939
268 Ga0163163_11187903 3300014325 Bacteria 825
269 Ga0163163_11683161 3300014325 Bacteria 695
270 Ga0163163_12430830 3300014325 Bacteria 582
271 Ga0157380_10087295 3300014326 Bacteria 2564
272 Ga0157380_10338911 3300014326 Bacteria 1402
273 Ga0157380_13544168 3300014326 Bacteria 500
274 Ga0157377_10610317 3300014745 Bacteria 779
275 Ga0157379_10093938 3300014968 Bacteria 2691
276 Ga0157376_12535651 3300014969 Bacteria 552
277 Ga0157376_12645324 3300014969 Bacteria 542
278 Ga0163161_10295322 3300017792 Bacteria 1275
279 Ga0163161_10642490 3300017792 Bacteria 878
280 Ga0206353_10290208 3300020082 Bacteria 810
281 Ga0206353_10988080 3300020082 Bacteria 967
282 Ga0206353_12036647 3300020082 Bacteria 1251
283 Ga0207653_10001268 3300025885 Bacteria 8234
284 Ga0207653_10246722 3300025885 Bacteria 683
285 Ga0207642_10026907 3300025899 Bacteria 2348
286 Ga0207642_10304142 3300025899 Bacteria 925
287 Ga0207642_10501675 3300025899 Bacteria 743
288 Ga0207710_10212642 3300025900 Bacteria 958
289 Ga0207688_10087669 3300025901 Bacteria 1784
290 Ga0207647_10287451 3300025904 Bacteria 938
291 Ga0207685_10004045 3300025905 Bacteria 3666
292 Ga0207685_10125879 3300025905 Bacteria 1131
293 Ga0207699_10058481 3300025906 Bacteria 2306
294 Ga0207643_10270978 3300025908 Bacteria 1050
295 Ga0207643_10953197 3300025908 Bacteria 555
296 Ga0207684_10120613 3300025910 Bacteria 2248
297 Ga0207654_10248734 3300025911 Bacteria 1191
298 Ga0207654_10551209 3300025911 Bacteria 819
299 Ga0207671_10000770 3300025914 Bacteria 40613
300 Ga0207693_10000030 3300025915 Bacteria 118049
301 Ga0207693_10027562 3300025915 Bacteria 4490
302 Ga0207693_10038032 3300025915 Unclassified 3790
303 Ga0207693_10266996 3300025915 Bacteria 1341
304 Ga0207693_10726408 3300025915 Bacteria 768
305 Ga0207663_10242571 3300025916 Bacteria 1322
306 Ga0207660_10017777 3300025917 Bacteria 4731
307 Ga0207660_10419227 3300025917 Bacteria 1080
308 Ga0207657_10197949 3300025919 Bacteria 1617
309 Ga0207657_10222850 3300025919 Bacteria 1510
310 Ga0207649_10212382 3300025920 Bacteria 1374
311 Ga0207646_10625728 3300025922 Bacteria 965
312 Ga0207681_10787994 3300025923 Bacteria 794
313 Ga0207694_10213437 3300025924 Bacteria 1573
314 Ga0207694_11769681 3300025924 Bacteria 519
315 Ga0207650_10358620 3300025925 Bacteria 1201
316 Ga0207650_11498320 3300025925 Bacteria 573
317 Ga0207687_10000075 3300025927 Bacteria 71856
318 Ga0207687_10055695 3300025927 Bacteria 2772
319 Ga0207700_11120389 3300025928 Bacteria 703
320 Ga0207700_11683181 3300025928 Bacteria 560
321 Ga0207664_10721618 3300025929 Bacteria 896
322 Ga0207664_10935981 3300025929 Bacteria 777
323 Ga0207664_11388042 3300025929 Bacteria 623
324 Ga0207644_10074347 3300025931 Bacteria 2494
325 Ga0207644_10733419 3300025931 Bacteria 825
326 Ga0207690_10289437 3300025932 Bacteria 1278
327 Ga0207690_10538398 3300025932 Bacteria 948
328 Ga0207706_10026648 3300025933 Bacteria 5174
329 Ga0207686_10142767 3300025934 Bacteria 1657
330 Ga0207709_10244871 3300025935 Bacteria 1306
331 Ga0207670_10062758 3300025936 Bacteria 2540
332 Ga0207669_10803380 3300025937 Bacteria 780
333 Ga0207704_10055419 3300025938 Bacteria 2423
334 Ga0207704_10529894 3300025938 Bacteria 954
335 Ga0207665_10003333 3300025939 Bacteria 10764
336 Ga0207665_10024121 3300025939 Bacteria 4009
337 Ga0207691_10805454 3300025940 Bacteria 789
338 Ga0207711_10108052 3300025941 Bacteria 2471
339 Ga0207711_10816874 3300025941 Bacteria 868
340 Ga0207711_11555004 3300025941 Bacteria 605
341 Ga0207711_12105304 3300025941 Bacteria 507
342 Ga0207689_11464107 3300025942 Bacteria 571
343 Ga0207661_10007432 3300025944 Bacteria 7799
344 Ga0207661_10430586 3300025944 Bacteria 1199
345 Ga0207679_10011719 3300025945 Bacteria 5692
346 Ga0207679_10578467 3300025945 Bacteria 1010
347 Ga0207667_10039317 3300025949 Bacteria 5043
348 Ga0207667_11074930 3300025949 Bacteria 789
349 Ga0207667_11478830 3300025949 Bacteria 651
350 Ga0207651_10791455 3300025960 Bacteria 840
351 Ga0207712_10150907 3300025961 Bacteria 1795
352 Ga0207712_10259495 3300025961 Bacteria 1409
353 Ga0207712_10364425 3300025961 Bacteria 1205
354 Ga0207668_10288660 3300025972 Bacteria 1349
355 Ga0207668_10460951 3300025972 Bacteria 1087
356 Ga0207668_10682151 3300025972 Bacteria 902
357 Ga0207640_11571369 3300025981 Bacteria 592
358 Ga0207677_10055941 3300026023 Bacteria 2700
359 Ga0207703_10130559 3300026035 Bacteria 2169
360 Ga0207639_10575475 3300026041 Bacteria 1036
361 Ga0207708_10036676 3300026075 Bacteria 3733
362 Ga0207708_10060336 3300026075 Bacteria 2895
363 Ga0207708_10568818 3300026075 Bacteria 957
364 Ga0207702_10011983 3300026078 Bacteria 7208
365 Ga0207702_10108827 3300026078 Bacteria 2460
366 Ga0207702_10133539 3300026078 Bacteria 2236
367 Ga0207641_12019766 3300026088 Bacteria 578
368 Ga0207648_10016547 3300026089 Bacteria 6735
369 Ga0207648_10021170 3300026089 Bacteria 5846
370 Ga0207648_10114958 3300026089 Bacteria 2364
371 Ga0207648_10464256 3300026089 Bacteria 1154
372 Ga0207648_10980948 3300026089 Bacteria 791
373 Ga0207676_10043299 3300026095 Bacteria 3466
374 Ga0207676_10113004 3300026095 Bacteria 2276
375 Ga0207674_11845896 3300026116 Bacteria 571
376 Ga0207675_100067443 3300026118 Bacteria 3345
377 Ga0207675_100134900 3300026118 Bacteria 2341
378 Ga0207675_100272538 3300026118 Bacteria 1643
379 Ga0207675_101156194 3300026118 Bacteria 794
380 Ga0207683_10032315 3300026121 Bacteria 4546
381 Ga0207683_10229859 3300026121 Bacteria 1691
382 Ga0207683_10292946 3300026121 Bacteria 1488
383 Ga0207683_10407459 3300026121 Bacteria 1251
384 Ga0207698_10097364 3300026142 Bacteria 2428
385 Ga0207698_10243536 3300026142 Bacteria 1640
386 Ga0209998_10033807 3300027717 Bacteria 1141
387 Ga0207428_10013670 3300027907 Bacteria 7080
388 Ga0207428_10817237 3300027907 Bacteria 662
389 Ga0207428_11130245 3300027907 Unclassified 547
390 Ga0268265_10064059 3300028380 Bacteria 2831
391 Ga0268264_10120583 3300028381 Bacteria 2311
392 Ga0268264_12359803 3300028381 Bacteria 538
393 Ga0307410_10538271 3300031852 Bacteria 966
394 Ga0307409_100148564 3300031995 Bacteria 2031
395 Ga0307416_100797732 3300032002 Bacteria 1040
396 Ga0307416_101491172 3300032002 Bacteria 782
397 Ga0307414_11618413 3300032004 Bacteria 604
398 Ga0307415_100484234 3300032126 Bacteria 1078
399 Ga0373948_0038603 3300034817 Bacteria 991
400 Ga0373938_0002635 3300034957 Bacteria 2895
401 Ga0373938_0153603 3300034957 Bacteria 614
402 Ga0373926_0375091 3300035083 Bacteria 560
403 Ga0373928_0001755 3300035084 Bacteria 4223
404 Ga0373940_0021716 3300035088 Bacteria 1644
405 Ga0373944_0009900 3300035089 Bacteria 2591
406 Ga0373949_0008702 3300035090 Bacteria 2222
407 Ga0373949_0099248 3300035090 Bacteria 796
408 Ga0373951_0053886 3300035091 Bacteria 994
409 Ga0373952_0021658 3300035092 Bacteria 1358
410 Ga0373952_0162362 3300035092 Bacteria 634
411 Ga0373923_0544975 3300035111 Bacteria 568
412 Ga0373932_0007185 3300035112 Bacteria 2646
413 Ga0373941_0028490 3300035115 Bacteria 1640
414 Ga0373941_0345612 3300035115 Bacteria 604
415 Ga0373945_0160545 3300035116 Bacteria 916
416 Ga0373945_0297487 3300035116 Bacteria 691
417 Ga0373953_0307113 3300035117 Bacteria 693
418 Ga0373956_0232241 3300035119 Bacteria 876
419 Ga0373960_0047071 3300035121 Bacteria 1267
420 Ga0373943_0019765 3300035170 Bacteria 3101
421 Ga0373943_0029115 3300035170 Bacteria 2608
422 Ga0373946_0041418 3300035171 Bacteria 1889
423 Ga0373942_0195777 3300035207 Bacteria 668
424 Ga0373961_0013528 3300035241 Bacteria 2059
425 Ga0373962_0002078 3300035242 Bacteria 4780
426 Ga0373962_0050513 3300035242 Bacteria 1198
427 Ga0373931_0035482 3300035691 Bacteria 2593
428 Ga0373931_0566719 3300035691 Bacteria 739
429 Ga0373947_0008966 3300035725 Bacteria 5749
430 Ga0373925_0103348 3300037068 Bacteria 2193
431 Ga0395899_0037746 3300037312 Bacteria 3620
432 Ga0395899_0041313 3300037312 Bacteria 3446
433 Ga0395899_0634737 3300037312 Bacteria 677
434 Ga0395900_0005605 3300037418 Bacteria 13128
435 Ga0395900_0117068 3300037418 Bacteria 2734
436 Ga0395900_0202426 3300037418 Bacteria 2008
437 Ga0395900_0304553 3300037418 Bacteria 1578
438 Ga0395900_0638859 3300037418 Bacteria 1002
439 Ga0395900_0772238 3300037418 Bacteria 890
440 Ga0395900_0813165 3300037418 Bacteria 862
441 Ga0395900_1574161 3300037418 Bacteria 569
442 Ga0395898_0018531 3300037466 Bacteria 7095
443 Ga0395898_0072155 3300037466 Bacteria 3335
444 Ga0395898_0621979 3300037466 Bacteria 1022
445 Ga0395898_1337198 3300037466 Bacteria 645
446 Ga0395905_0017416 3300037471 Bacteria 6821
447 Ga0395905_0053061 3300037471 Bacteria 3795
448 Ga0395905_0381323 3300037471 Bacteria 1304
449 Ga0395905_0428913 3300037471 Bacteria 1219
450 Ga0395901_0010517 3300038443 Bacteria 9371
451 Ga0395901_0079204 3300038443 Bacteria 3430
452 Ga0395901_0138821 3300038443 Bacteria 2555
453 Ga0395901_0648951 3300038443 Bacteria 1059
454 Ga0395901_1259423 3300038443 Bacteria 703
455 Ga0395901_1792898 3300038443 Bacteria 563
456 Ga0451845_0864229 3300041501 Bacteria 706
457 Ga0451849_0034861 3300041505 Bacteria 568
458 Ga0451851_0347102 3300041507 Bacteria 673
459 Ga0451843_1106634 3300041509 Bacteria 543
460 Ga0451853_3133616 3300041512 Bacteria 1435
461 Ga0451853_3586855 3300041512 Bacteria 1689
462 Ga0439448_0028095 3300042005 Bacteria 1775
463 Ga0439448_0042866 3300042005 Bacteria 1468
464 Ga0439455_0042830 3300042012 Bacteria 1164
465 Ga0439463_015226 3300042016 Bacteria 1902
466 Ga0439458_0042246 3300042157 Bacteria 1109
467 Ga0439464_0155349 3300042439 Bacteria 717
468 Ga0439460_0035970 3300042461 Bacteria 1434
469 Ga0450916_050459 3300042530 Bacteria 655
470 Ga0466969_0224359 3300044656 Bacteria 854
471 Ga0466966_0056774 3300044684 Bacteria 2476
472 Ga0466961_0048829 3300044693 Bacteria 2705
473 Ga0466963_1333787 3300044694 Bacteria 503
474 Ga0466964_0183442 3300044706 Bacteria 994
475 Ga0466964_0331501 3300044706 Bacteria 776
476 Ga0466971_0374438 3300044719 Bacteria 691
477 Ga0466968_0511629 3300044735 Bacteria 599
478 Ga0466959_0082180 3300045049 Bacteria 2321
479 Ga0451576_0123507 3300045051 Bacteria 2696
480 Ga0466958_0382127 3300045836 Bacteria 908
481 Ga0466958_0823067 3300045836 Bacteria 605
482 Ga0466967_0006817 3300045976 Bacteria 8143
483 Ga0466967_0430820 3300045976 Bacteria 1287
484 Ga0466967_1409751 3300045976 Bacteria 694
485 Ga0495603_0003706 3300046455 Bacteria 9097
486 Ga0495591_146452 3300046458 Bacteria 568
487 Ga0495641_0005237 3300046461 Bacteria 8836
488 Ga0495641_0063001 3300046461 Bacteria 1672
489 Ga0495653_0656485 3300046463 Bacteria 640
490 Ga0495582_0058980 3300046473 Bacteria 2117
491 Ga0495582_0105401 3300046473 Bacteria 1581
492 Ga0495582_0614792 3300046473 Bacteria 629
493 Ga0495639_0364190 3300046475 Bacteria 727
494 Ga0495584_0133942 3300046491 Bacteria 1258
495 Ga0495584_0308492 3300046491 Bacteria 804
496 Ga0495585_0361558 3300046492 Bacteria 704
497 Ga0495594_0000927 3300046499 Bacteria 15176
498 Ga0495630_0001557 3300046517 Bacteria 15924
499 Ga0495630_0038975 3300046517 Bacteria 3554
500 Ga0495663_0319379 3300046525 Bacteria 562
501 Ga0495666_0017192 3300046526 Bacteria 3602
502 Ga0495652_0036488 3300046529 Bacteria 4274
503 Ga0495665_0158964 3300046531 Bacteria 1178
504 Ga0495665_0335675 3300046531 Bacteria 771
505 Ga0495640_0817169 3300046533 Bacteria 555
506 Ga0495588_0003423 3300046674 Bacteria 6894
507 Ga0495588_0586760 3300046674 Bacteria 584
508 Ga0495657_0000008 3300046675 Bacteria 221090
509 Ga0495599_0048753 3300046678 Bacteria 2655
510 Ga0495613_0443541 3300046689 Bacteria 880
511 Ga0495670_0175229 3300046691 Unclassified 1131
512 Ga0495649_0000320 3300046694 Bacteria 41735
513 Ga0495600_0202747 3300046809 Bacteria 1273
514 Ga0495600_0329599 3300046809 Bacteria 959
515 Ga0495604_0174199 3300047317 Bacteria 1510
516 Ga0495676_0000204 3300047321 Bacteria 46818
517 Ga0495676_0006624 3300047321 Bacteria 10681
518 Ga0495676_0119731 3300047321 Bacteria 1917
519 Ga0495680_0751385 3300047322 Bacteria 640
520 Ga0495593_0105254 3300047673 Bacteria 1444
521 Ga0496100_0001005 3300048903 Bacteria 13598
522 Ga0496100_0032783 3300048903 Bacteria 3244
523 Ga0496100_0237988 3300048903 Bacteria 1342
524 Ga0496100_0522469 3300048903 Bacteria 916
525 Ga0496101_0009726 3300048904 Bacteria 6329
526 Ga0496101_0112799 3300048904 Bacteria 2048
527 Ga0496101_0189128 3300048904 Bacteria 1588
528 Ga0496101_0898398 3300048904 Bacteria 697
529 Ga0496102_0025710 3300048905 Bacteria 5244
530 Ga0496102_0145217 3300048905 Bacteria 2226
531 Ga0496102_0147329 3300048905 Bacteria 2210
532 Ga0496102_0499639 3300048905 Bacteria 1138
533 Ga0496102_0651937 3300048905 Bacteria 976
534 Ga0496102_0775048 3300048905 Bacteria 882
535 Ga0496102_1223179 3300048905 Bacteria 671
536 Ga0496102_1844549 3300048905 Bacteria 522
537 Ga0496103_0086753 3300048906 Bacteria 1973
538 Ga0496103_0205001 3300048906 Bacteria 1268
539 Ga0496104_0003336 3300048907 Bacteria 13855
540 Ga0496104_0072353 3300048907 Bacteria 3278
541 Ga0496104_0417804 3300048907 Bacteria 1253
542 Ga0496104_0829597 3300048907 Bacteria 830
543 Ga0496105_0000671 3300048908 Bacteria 22997
544 Ga0496105_0025383 3300048908 Bacteria 4824
545 Ga0496105_0062025 3300048908 Bacteria 3085
546 Ga0496106_0011147 3300048909 Bacteria 6651
547 Ga0496106_0050477 3300048909 Bacteria 3135
548 Ga0496106_0334686 3300048909 Bacteria 1215
549 Ga0496106_0363974 3300048909 Bacteria 1162
550 Ga0496106_1310570 3300048909 Bacteria 562
551 Ga0496107_0008053 3300048910 Bacteria 7277
552 Ga0496107_0017905 3300048910 Bacteria 4987
553 Ga0496107_0586627 3300048910 Bacteria 824
554 Ga0496107_0965741 3300048910 Bacteria 619
555 Ga0496108_0000317 3300048911 Bacteria 40920
556 Ga0496108_0003773 3300048911 Bacteria 12129
557 Ga0496108_0019040 3300048911 Bacteria 5631
558 Ga0496108_0123220 3300048911 Bacteria 2224
559 Ga0496108_1370280 3300048911 Bacteria 593
560 Ga0496109_0007014 3300048912 Bacteria 9505
561 Ga0496109_0062491 3300048912 Bacteria 3405
562 Ga0496109_0082943 3300048912 Bacteria 2956
563 Ga0496109_0090036 3300048912 Bacteria 2837
564 Ga0496109_0290400 3300048912 Bacteria 1541
565 Ga0496109_0388874 3300048912 Bacteria 1318
566 Ga0496109_0524848 3300048912 Bacteria 1117
567 Ga0496110_0000774 3300048913 Bacteria 22221
568 Ga0496110_0003926 3300048913 Bacteria 11441
569 Ga0496110_0023700 3300048913 Bacteria 5222
570 Ga0496110_0041097 3300048913 Bacteria 4033
571 Ga0496110_0142582 3300048913 Bacteria 2166
572 Ga0496110_0343214 3300048913 Bacteria 1360
573 Ga0496110_1203207 3300048913 Bacteria 667
574 Ga0496110_1332176 3300048913 Bacteria 627
575 Ga0496111_0001461 3300048914 Bacteria 13512
576 Ga0496111_0035877 3300048914 Bacteria 3545
577 Ga0496111_0086730 3300048914 Bacteria 2290
578 Ga0496111_0117232 3300048914 Bacteria 1964
579 Ga0496111_0162573 3300048914 Bacteria 1658
580 Ga0496111_0302204 3300048914 Bacteria 1186
581 Ga0496111_0620848 3300048914 Bacteria 790
582 Ga0496112_0059782 3300048915 Bacteria 3755
583 Ga0496112_0117971 3300048915 Unclassified 2624
584 Ga0496112_0315777 3300048915 Bacteria 1507
585 Ga0496112_0635782 3300048915 Bacteria 997
586 Ga0496113_0001684 3300048916 Bacteria 12527
587 Ga0496113_0014555 3300048916 Bacteria 5370
588 Ga0496113_0091637 3300048916 Bacteria 2343
589 Ga0496113_0342847 3300048916 Bacteria 1198
590 Ga0496113_0502710 3300048916 Bacteria 973
591 Ga0496113_0571137 3300048916 Bacteria 906
592 Ga0496114_0012171 3300048917 Bacteria 6885
593 Ga0496114_0032146 3300048917 Bacteria 4318
594 Ga0496114_0080759 3300048917 Bacteria 2746
595 Ga0496114_0501200 3300048917 Bacteria 1074
596 Ga0496114_1304659 3300048917 Bacteria 613
597 Ga0496114_1787862 3300048917 Bacteria 503
598 Ga0496115_0000006 3300048918 Bacteria 252944
599 Ga0496115_0000344 3300048918 Bacteria 39346
600 Ga0496115_0137281 3300048918 Bacteria 2016
601 Ga0496115_0412095 3300048918 Bacteria 1095
602 Ga0496115_0511586 3300048918 Bacteria 964
603 Ga0496115_0542452 3300048918 Bacteria 930
604 Ga0501031_0119077 3300049568 Bacteria 1725
605 Ga0501032_0524473 3300049569 Bacteria 756
606 Ga0501033_0489207 3300049570 Bacteria 852
607 Ga0501033_0581461 3300049570 Bacteria 769
608 Ga0501036_0010832 3300049572 Bacteria 7533
609 Ga0501036_0179126 3300049572 Bacteria 1785
610 Ga0501036_0644663 3300049572 Bacteria 877
611 Ga0501038_0038211 3300049574 Bacteria 4205
612 Ga0501038_0565988 3300049574 Bacteria 863
613 Ga0501039_0101661 3300049575 Bacteria 2243
614 Ga0501039_0523063 3300049575 Bacteria 931
615 Ga0501039_1439883 3300049575 Bacteria 530
616 Ga0501040_0105426 3300049576 Bacteria 1969
617 Ga0501040_0231069 3300049576 Bacteria 1317
618 Ga0501040_0762921 3300049576 Bacteria 700
619 Ga0501041_0262927 3300049577 Bacteria 1085
620 Ga0501042_0008043 3300049578 Bacteria 6941
621 Ga0501042_0180118 3300049578 Bacteria 1525
622 Ga0501043_1170746 3300049579 Bacteria 541
623 Ga0501046_0263251 3300049580 Bacteria 1266
624 Ga0501048_0028256 3300049582 Bacteria 4071
625 Ga0501068_0470159 3300049584 Bacteria 814
626 Ga0501068_1152165 3300049584 Bacteria 513
627 Ga0501071_1004819 3300049587 Bacteria 644
628 Ga0501072_0311255 3300049588 Bacteria 1252
629 Ga0501072_0708503 3300049588 Bacteria 791
630 Ga0501073_0339470 3300049589 Bacteria 1037
631 Ga0501074_0061481 3300049590 Bacteria 2706
632 Ga0501074_0534282 3300049590 Bacteria 830
633 Ga0501075_0015408 3300049591 Bacteria 5487
634 Ga0501075_0206334 3300049591 Bacteria 1499
635 Ga0501075_0209043 3300049591 Bacteria 1489
636 Ga0501075_0636704 3300049591 Bacteria 813
637 Ga0501076_0082208 3300049592 Bacteria 2586
638 Ga0501076_0111303 3300049592 Bacteria 2213
639 Ga0501077_0075046 3300049593 Bacteria 2141
640 Ga0501077_0243231 3300049593 Bacteria 1144
641 Ga0501077_0449752 3300049593 Bacteria 825
642 Ga0501079_0045155 3300049741 Bacteria 3401
643 Ga0501079_0168637 3300049741 Bacteria 1707
644 Ga0501079_0474470 3300049741 Bacteria 983
645 Ga0501079_0519467 3300049741 Bacteria 936
646 Ga0501080_1824888 3300049742 Bacteria 510
647 Ga0501081_0198152 3300049743 Bacteria 1456
648 Ga0501081_0253269 3300049743 Bacteria 1285
649 Ga0501081_0498168 3300049743 Bacteria 908
650 Ga0501083_0383102 3300049744 Bacteria 915
651 Ga0501035_0079395 3300049822 Bacteria 2899
652 Ga0501044_0521546 3300049823 Bacteria 1088
653 Ga0501045_0070312 3300049824 Bacteria 2575
654 Ga0501045_1185375 3300049824 Bacteria 557
655 nmdc:mga03n38_48985_c1 3300050490 Bacteria 1876
656 nmdc:mga00v17_103522_c1 3300050491 Bacteria 1799
657 nmdc:mga0yw44_202902_c1 3300050492 Bacteria 1310
658 nmdc:mga0yw44_393010_c1 3300050492 Bacteria 937
659 nmdc:mga0yw44_80395_c1 3300050492 Bacteria 2042
660 nmdc:mga05p37_145726_c1 3300050507 Bacteria 2900
661 nmdc:mga05p37_354341_c1 3300050507 Bacteria 1727
662 nmdc:mga05p37_356842_c1 3300050507 Bacteria 1720
663 nmdc:mga0qj67_1168012_c1 3300050509 Bacteria 600
664 nmdc:mga0qj67_437967_c1 3300050509 Bacteria 1053
665 nmdc:mga06r32_1786285_c1 3300050510 Bacteria 551
666 nmdc:mga06r32_240504_c1 3300050510 Bacteria 1798
667 nmdc:mga06r32_524306_c1 3300050510 Bacteria 1160
668 nmdc:mga06r32_554586_c1 3300050510 Bacteria 1123
669 nmdc:mga08y16_1102905_c1 3300050511 Bacteria 769
670 nmdc:mga08y16_1561098_c1 3300050511 Bacteria 619
671 nmdc:mga08y16_27600_c1 3300050511 Bacteria 5982
672 nmdc:mga0n895_1286835_c1 3300050512 Bacteria 703
673 nmdc:mga0n895_1551336_c1 3300050512 Bacteria 628
674 nmdc:mga0n895_48692_c1 3300050512 Bacteria 4150
675 nmdc:mga0n895_7454_c1 3300050512 Bacteria 9393
676 nmdc:mga0rr50_1356020_c1 3300050513 Bacteria 603
677 nmdc:mga0rr50_441412_c1 3300050513 Bacteria 1103
678 nmdc:mga0rr50_49082_c1 3300050513 Bacteria 3124
679 nmdc:mga0rr50_652630_c1 3300050513 Bacteria 898
680 nmdc:mga08x19_63526_c1 3300050514 Bacteria 2396
681 nmdc:mga0a205_127261_c1 3300050515 Bacteria 2447
682 nmdc:mga0a205_268777_c1 3300050515 Bacteria 1582
683 nmdc:mga0a205_642577_c1 3300050515 Bacteria 913
684 nmdc:mga0a205_84787_c1 3300050515 Bacteria 3061
685 Ga0495601_0020486 3300053077 Unclassified 4040
686 Ga0495619_0012634 3300053085 Bacteria 5315
687 Ga0495619_0033556 3300053085 Bacteria 3334
688 Ga0501084_0009716 3300054114 Bacteria 7956
689 Ga0501084_0134152 3300054114 Bacteria 2084
690 Ga0501082_0053899 3300060353 Bacteria 3467
691 Ga0501082_0087990 3300060353 Bacteria 2680
692 Ga0501082_0443753 3300060353 Bacteria 1134
693 Ga0501082_1607679 3300060353 Bacteria 567
694 Ga0466962_0232710 3300061719 Bacteria 903
695 Ga0530510_0079885 3300061734 Bacteria 2379
696 Ga0530510_1114863 3300061734 Bacteria 605

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0019765 Ga0373943_0019765_185_466 82
2 3300006846 Ga0075430_100456027 Ga0075430_1004560272 88
3 3300007076 Ga0075435_100374808 Ga0075435_1003748081 88
4 3300009147 Ga0114129_10177731 Ga0114129_101777313 88
5 3300035111 Ga0373923_0544975 Ga0373923_0544975_70_336 88
6 3300035117 Ga0373953_0307113 Ga0373953_0307113_221_487 88
7 3300035119 Ga0373956_0232241 Ga0373956_0232241_377_643 88
8 3300046463 Ga0495653_0656485 Ga0495653_0656485_198_464 88
9 3300046533 Ga0495640_0817169 Ga0495640_0817169_133_399 88
10 3300046809 Ga0495600_0329599 Ga0495600_0329599_61_327 88
11 3300047317 Ga0495604_0174199 Ga0495604_0174199_412_678 88
12 3300047673 Ga0495593_0105254 Ga0495593_0105254_1122_1388 88
13 3300050507 nmdc:mga05p37_354341_c1 nmdc:mga05p37_354341_c1_452_718 88
14 3300050509 nmdc:mga0qj67_437967_c1 nmdc:mga0qj67_437967_c1_367_633 88
15 3300050510 nmdc:mga06r32_524306_c1 nmdc:mga06r32_524306_c1_632_898 88
16 3300053085 Ga0495619_0012634 Ga0495619_0012634_4638_4904 88
17 3300053085 Ga0495619_0033556 Ga0495619_0033556_16_282 88
18 3300060353 Ga0501082_0443753 Ga0501082_0443753_38_304 88
19 3300005328 Ga0070676_10373089 Ga0070676_103730892 89
20 3300005330 Ga0070690_100088487 Ga0070690_1000884872 89
21 3300005338 Ga0068868_100150235 Ga0068868_1001502352 89
22 3300005338 Ga0068868_100925291 Ga0068868_1009252912 89
23 3300005340 Ga0070689_100226686 Ga0070689_1002266862 89
24 3300005341 Ga0070691_10099916 Ga0070691_100999162 89
25 3300005341 Ga0070691_10564950 Ga0070691_105649502 89
26 3300005343 Ga0070687_100033984 Ga0070687_1000339842 89
27 3300005344 Ga0070661_100127074 Ga0070661_1001270742 89
28 3300005345 Ga0070692_10021909 Ga0070692_100219094 89
29 3300005353 Ga0070669_101176318 Ga0070669_1011763182 89
30 3300005356 Ga0070674_100166036 Ga0070674_1001660363 89
31 3300005365 Ga0070688_101569382 Ga0070688_1015693821 89
32 3300005435 Ga0070714_100122115 Ga0070714_1001221151 89
33 3300005438 Ga0070701_10008802 Ga0070701_100088023 89
34 3300005441 Ga0070700_100010634 Ga0070700_1000106344 89
35 3300005444 Ga0070694_100135146 Ga0070694_1001351462 89
36 3300005456 Ga0070678_100854057 Ga0070678_1008540572 89
37 3300005466 Ga0070685_10677636 Ga0070685_106776362 89
38 3300005530 Ga0070679_101530584 Ga0070679_1015305842 89
39 3300005535 Ga0070684_100020586 Ga0070684_1000205865 89
40 3300005535 Ga0070684_100156536 Ga0070684_1001565362 89
41 3300005535 Ga0070684_100790428 Ga0070684_1007904282 89
42 3300005535 Ga0070684_101802004 Ga0070684_1018020041 89
43 3300005543 Ga0070672_100241964 Ga0070672_1002419642 89
44 3300005544 Ga0070686_100018190 Ga0070686_1000181905 89
45 3300005564 Ga0070664_100144377 Ga0070664_1001443773 89
46 3300005614 Ga0068856_100188380 Ga0068856_1001883802 89
47 3300005614 Ga0068856_101294970 Ga0068856_1012949701 89
48 3300005614 Ga0068856_102506794 Ga0068856_1025067941 89
49 3300005615 Ga0070702_100018341 Ga0070702_1000183413 89
50 3300005616 Ga0068852_100066678 Ga0068852_1000666785 89
51 3300005617 Ga0068859_100111263 Ga0068859_1001112632 89
52 3300005617 Ga0068859_102615070 Ga0068859_1026150702 89
53 3300005618 Ga0068864_100166944 Ga0068864_1001669442 89
54 3300005618 Ga0068864_100537376 Ga0068864_1005373762 89
55 3300005718 Ga0068866_10012856 Ga0068866_100128565 89
56 3300005718 Ga0068866_11118390 Ga0068866_111183902 89
57 3300005719 Ga0068861_100403037 Ga0068861_1004030372 89
58 3300005840 Ga0068870_10510676 Ga0068870_105106762 89
59 3300005842 Ga0068858_100103031 Ga0068858_1001030314 89
60 3300005981 Ga0081538_10004666 Ga0081538_1000466613 89
61 3300005981 Ga0081538_10009134 Ga0081538_100091345 89
62 3300005981 Ga0081538_10011726 Ga0081538_1001172610 89
63 3300005981 Ga0081538_10011801 Ga0081538_100118017 89
64 3300005981 Ga0081538_10016040 Ga0081538_100160404 89
65 3300005981 Ga0081538_10040648 Ga0081538_100406482 89
66 3300005981 Ga0081538_10043061 Ga0081538_100430616 89
67 3300005981 Ga0081538_10138225 Ga0081538_101382253 89
68 3300005981 Ga0081538_10160454 Ga0081538_101604541 89
69 3300005983 Ga0081540_1197022 Ga0081540_11970221 89
70 3300005985 Ga0081539_10154109 Ga0081539_101541092 89
71 3300006038 Ga0075365_10011921 Ga0075365_100119215 89
72 3300006038 Ga0075365_10193190 Ga0075365_101931903 89
73 3300006038 Ga0075365_11053908 Ga0075365_110539082 89
74 3300006048 Ga0075363_100030031 Ga0075363_1000300313 89
75 3300006051 Ga0075364_10110756 Ga0075364_101107564 89
76 3300006051 Ga0075364_10318677 Ga0075364_103186772 89
77 3300006175 Ga0070712_100568582 Ga0070712_1005685823 89
78 3300006847 Ga0075431_101888886 Ga0075431_1018888862 89
79 3300006852 Ga0075433_10331953 Ga0075433_103319532 89
80 3300006871 Ga0075434_100386849 Ga0075434_1003868492 89
81 3300006881 Ga0068865_100076837 Ga0068865_1000768373 89
82 3300006931 Ga0097620_100111263 Ga0097620_1001112632 89
83 3300006931 Ga0097620_102615167 Ga0097620_1026151671 89
84 3300009093 Ga0105240_10968291 Ga0105240_109682912 89
85 3300009098 Ga0105245_10000438 Ga0105245_1000043819 89
86 3300009101 Ga0105247_10016614 Ga0105247_100166142 89
87 3300009147 Ga0114129_10256293 Ga0114129_102562933 89
88 3300009147 Ga0114129_11779054 Ga0114129_117790542 89
89 3300009147 Ga0114129_12646663 Ga0114129_126466632 89
90 3300009148 Ga0105243_10153368 Ga0105243_101533683 89
91 3300009148 Ga0105243_12653208 Ga0105243_126532082 89
92 3300009176 Ga0105242_10048158 Ga0105242_100481583 89
93 3300009177 Ga0105248_11127871 Ga0105248_111278712 89
94 3300009177 Ga0105248_11982758 Ga0105248_119827582 89
95 3300009545 Ga0105237_10001241 Ga0105237_1000124130 89
96 3300009545 Ga0105237_12367658 Ga0105237_123676582 89
97 3300009551 Ga0105238_10167241 Ga0105238_101672413 89
98 3300009553 Ga0105249_10077959 Ga0105249_100779595 89
99 3300009553 Ga0105249_12449475 Ga0105249_124494752 89
100 3300009553 Ga0105249_13456085 Ga0105249_134560851 89
101 3300010375 Ga0105239_10234284 Ga0105239_102342842 89
102 3300010375 Ga0105239_12011416 Ga0105239_120114162 89
103 3300013104 Ga0157370_10658974 Ga0157370_106589742 89
104 3300013307 Ga0157372_10892395 Ga0157372_108923952 89
105 3300013308 Ga0157375_10483647 Ga0157375_104836472 89
106 3300014326 Ga0157380_13544168 Ga0157380_135441682 89
107 3300014969 Ga0157376_12535651 Ga0157376_125356511 89
108 3300014969 Ga0157376_12645324 Ga0157376_126453241 89
109 3300017792 Ga0163161_10295322 Ga0163161_102953222 89
110 3300020082 Ga0206353_10290208 Ga0206353_102902082 89
111 3300025899 Ga0207642_10026907 Ga0207642_100269072 89
112 3300025899 Ga0207642_10501675 Ga0207642_105016752 89
113 3300025900 Ga0207710_10212642 Ga0207710_102126422 89
114 3300025901 Ga0207688_10087669 Ga0207688_100876692 89
115 3300025914 Ga0207671_10000770 Ga0207671_1000077011 89
116 3300025915 Ga0207693_10266996 Ga0207693_102669963 89
117 3300025917 Ga0207660_10419227 Ga0207660_104192272 89
118 3300025919 Ga0207657_10222850 Ga0207657_102228502 89
119 3300025920 Ga0207649_10212382 Ga0207649_102123822 89
120 3300025924 Ga0207694_11769681 Ga0207694_117696812 89
121 3300025925 Ga0207650_10358620 Ga0207650_103586201 89
122 3300025927 Ga0207687_10000075 Ga0207687_1000007519 89
123 3300025929 Ga0207664_10935981 Ga0207664_109359812 89
124 3300025929 Ga0207664_11388042 Ga0207664_113880421 89
125 3300025932 Ga0207690_10538398 Ga0207690_105383983 89
126 3300025934 Ga0207686_10142767 Ga0207686_101427671 89
127 3300025936 Ga0207670_10062758 Ga0207670_100627584 89
128 3300025938 Ga0207704_10055419 Ga0207704_100554193 89
129 3300025940 Ga0207691_10805454 Ga0207691_108054542 89
130 3300025941 Ga0207711_11555004 Ga0207711_115550042 89
131 3300025941 Ga0207711_12105304 Ga0207711_121053042 89
132 3300025944 Ga0207661_10007432 Ga0207661_100074324 89
133 3300025945 Ga0207679_10011719 Ga0207679_100117193 89
134 3300025945 Ga0207679_10578467 Ga0207679_105784673 89
135 3300025949 Ga0207667_11478830 Ga0207667_114788301 89
136 3300025961 Ga0207712_10364425 Ga0207712_103644252 89
137 3300026023 Ga0207677_10055941 Ga0207677_100559412 89
138 3300026035 Ga0207703_10130559 Ga0207703_101305594 89
139 3300026075 Ga0207708_10060336 Ga0207708_100603363 89
140 3300026078 Ga0207702_10108827 Ga0207702_101088272 89
141 3300026089 Ga0207648_10021170 Ga0207648_100211703 89
142 3300026089 Ga0207648_10114958 Ga0207648_101149582 89
143 3300026089 Ga0207648_10464256 Ga0207648_104642563 89
144 3300026089 Ga0207648_10980948 Ga0207648_109809482 89
145 3300026095 Ga0207676_10043299 Ga0207676_100432994 89
146 3300026118 Ga0207675_100134900 Ga0207675_1001349003 89
147 3300026118 Ga0207675_100272538 Ga0207675_1002725382 89
148 3300026121 Ga0207683_10292946 Ga0207683_102929462 89
149 3300026142 Ga0207698_10097364 Ga0207698_100973642 89
150 3300028380 Ga0268265_10064059 Ga0268265_100640594 89
151 3300028381 Ga0268264_10120583 Ga0268264_101205832 89
152 3300035115 Ga0373941_0345612 Ga0373941_0345612_41_346 89
153 3300035116 Ga0373945_0297487 Ga0373945_0297487_364_633 89
154 3300037312 Ga0395899_0634737 Ga0395899_0634737_252_521 89
155 3300037418 Ga0395900_0005605 Ga0395900_0005605_2607_2876 89
156 3300037418 Ga0395900_0813165 Ga0395900_0813165_418_687 89
157 3300037466 Ga0395898_0018531 Ga0395898_0018531_3743_4012 89
158 3300037466 Ga0395898_1337198 Ga0395898_1337198_106_375 89
159 3300037471 Ga0395905_0017416 Ga0395905_0017416_5001_5270 89
160 3300038443 Ga0395901_0010517 Ga0395901_0010517_947_1216 89
161 3300038443 Ga0395901_0138821 Ga0395901_0138821_93_362 89
162 3300041509 Ga0451843_1106634 Ga0451843_1106634_264_533 89
163 3300041512 Ga0451853_3586855 Ga0451853_3586855_859_1128 89
164 3300042461 Ga0439460_0035970 Ga0439460_0035970_760_1029 89
165 3300042530 Ga0450916_050459 Ga0450916_050459_212_481 89
166 3300044656 Ga0466969_0224359 Ga0466969_0224359_209_478 89
167 3300044684 Ga0466966_0056774 Ga0466966_0056774_1938_2207 89
168 3300044693 Ga0466961_0048829 Ga0466961_0048829_1554_1823 89
169 3300044694 Ga0466963_1333787 Ga0466963_1333787_88_357 89
170 3300044706 Ga0466964_0183442 Ga0466964_0183442_253_522 89
171 3300044706 Ga0466964_0331501 Ga0466964_0331501_274_543 89
172 3300044719 Ga0466971_0374438 Ga0466971_0374438_378_647 89
173 3300045049 Ga0466959_0082180 Ga0466959_0082180_1580_1849 89
174 3300045836 Ga0466958_0382127 Ga0466958_0382127_590_859 89
175 3300045836 Ga0466958_0823067 Ga0466958_0823067_108_377 89
176 3300045976 Ga0466967_0006817 Ga0466967_0006817_1806_2075 89
177 3300045976 Ga0466967_0430820 Ga0466967_0430820_115_384 89
178 3300045976 Ga0466967_1409751 Ga0466967_1409751_141_410 89
179 3300046458 Ga0495591_146452 Ga0495591_146452_235_504 89
180 3300046517 Ga0495630_0001557 Ga0495630_0001557_5610_5879 89
181 3300046517 Ga0495630_0038975 Ga0495630_0038975_796_1065 89
182 3300046529 Ga0495652_0036488 Ga0495652_0036488_3351_3620 89
183 3300046675 Ga0495657_0000008 Ga0495657_0000008_19201_19470 89
184 3300046678 Ga0495599_0048753 Ga0495599_0048753_1192_1461 89
185 3300046689 Ga0495613_0443541 Ga0495613_0443541_81_350 89
186 3300046694 Ga0495649_0000320 Ga0495649_0000320_16891_17160 89
187 3300046809 Ga0495600_0202747 Ga0495600_0202747_516_785 89
188 3300047321 Ga0495676_0000204 Ga0495676_0000204_35793_36062 89
189 3300047322 Ga0495680_0751385 Ga0495680_0751385_227_496 89
190 3300048903 Ga0496100_0032783 Ga0496100_0032783_2322_2591 89
191 3300048904 Ga0496101_0898398 Ga0496101_0898398_221_490 89
192 3300048905 Ga0496102_0499639 Ga0496102_0499639_355_624 89
193 3300048905 Ga0496102_0775048 Ga0496102_0775048_520_825 89
194 3300048905 Ga0496102_1223179 Ga0496102_1223179_56_325 89
195 3300048905 Ga0496102_1844549 Ga0496102_1844549_83_352 89
196 3300048906 Ga0496103_0205001 Ga0496103_0205001_108_377 89
197 3300048909 Ga0496106_0050477 Ga0496106_0050477_1533_1802 89
198 3300048910 Ga0496107_0017905 Ga0496107_0017905_1715_1984 89
199 3300048911 Ga0496108_1370280 Ga0496108_1370280_56_325 89
200 3300048912 Ga0496109_0062491 Ga0496109_0062491_1579_1848 89
201 3300048912 Ga0496109_0388874 Ga0496109_0388874_53_322 89
202 3300048912 Ga0496109_0524848 Ga0496109_0524848_473_778 89
203 3300048913 Ga0496110_1332176 Ga0496110_1332176_256_561 89
204 3300048914 Ga0496111_0620848 Ga0496111_0620848_11_280 89
205 3300048915 Ga0496112_0315777 Ga0496112_0315777_710_979 89
206 3300048916 Ga0496113_0502710 Ga0496113_0502710_77_382 89
207 3300048916 Ga0496113_0571137 Ga0496113_0571137_128_397 89
208 3300048917 Ga0496114_0012171 Ga0496114_0012171_5949_6218 89
209 3300048917 Ga0496114_0501200 Ga0496114_0501200_383_652 89
210 3300048917 Ga0496114_1787862 Ga0496114_1787862_160_429 89
211 3300048918 Ga0496115_0000006 Ga0496115_0000006_166821_167090 89
212 3300048918 Ga0496115_0000344 Ga0496115_0000344_24508_24777 89
213 3300048918 Ga0496115_0542452 Ga0496115_0542452_559_828 89
214 3300049568 Ga0501031_0119077 Ga0501031_0119077_241_513 89
215 3300049569 Ga0501032_0524473 Ga0501032_0524473_402_674 89
216 3300049570 Ga0501033_0489207 Ga0501033_0489207_25_297 89
217 3300049570 Ga0501033_0581461 Ga0501033_0581461_25_297 89
218 3300049572 Ga0501036_0010832 Ga0501036_0010832_2775_3047 89
219 3300049572 Ga0501036_0644663 Ga0501036_0644663_523_792 89
220 3300049574 Ga0501038_0038211 Ga0501038_0038211_1857_2129 89
221 3300049574 Ga0501038_0565988 Ga0501038_0565988_439_708 89
222 3300049575 Ga0501039_0101661 Ga0501039_0101661_979_1251 89
223 3300049575 Ga0501039_0523063 Ga0501039_0523063_439_708 89
224 3300049575 Ga0501039_1439883 Ga0501039_1439883_198_467 89
225 3300049576 Ga0501040_0105426 Ga0501040_0105426_1126_1398 89
226 3300049576 Ga0501040_0231069 Ga0501040_0231069_946_1215 89
227 3300049578 Ga0501042_0008043 Ga0501042_0008043_2044_2316 89
228 3300049578 Ga0501042_0180118 Ga0501042_0180118_520_789 89
229 3300049579 Ga0501043_1170746 Ga0501043_1170746_170_442 89
230 3300049580 Ga0501046_0263251 Ga0501046_0263251_624_896 89
231 3300049582 Ga0501048_0028256 Ga0501048_0028256_3289_3561 89
232 3300049584 Ga0501068_0470159 Ga0501068_0470159_509_778 89
233 3300049584 Ga0501068_1152165 Ga0501068_1152165_212_484 89
234 3300049587 Ga0501071_1004819 Ga0501071_1004819_59_328 89
235 3300049588 Ga0501072_0311255 Ga0501072_0311255_775_1044 89
236 3300049588 Ga0501072_0708503 Ga0501072_0708503_262_531 89
237 3300049589 Ga0501073_0339470 Ga0501073_0339470_163_432 89
238 3300049590 Ga0501074_0061481 Ga0501074_0061481_516_788 89
239 3300049590 Ga0501074_0534282 Ga0501074_0534282_401_670 89
240 3300049591 Ga0501075_0015408 Ga0501075_0015408_1025_1294 89
241 3300049591 Ga0501075_0209043 Ga0501075_0209043_681_950 89
242 3300049591 Ga0501075_0636704 Ga0501075_0636704_55_327 89
243 3300049592 Ga0501076_0082208 Ga0501076_0082208_1348_1617 89
244 3300049592 Ga0501076_0111303 Ga0501076_0111303_572_844 89
245 3300049593 Ga0501077_0075046 Ga0501077_0075046_1467_1739 89
246 3300049593 Ga0501077_0243231 Ga0501077_0243231_206_475 89
247 3300049593 Ga0501077_0449752 Ga0501077_0449752_322_591 89
248 3300049741 Ga0501079_0045155 Ga0501079_0045155_1659_1931 89
249 3300049741 Ga0501079_0168637 Ga0501079_0168637_1199_1468 89
250 3300049741 Ga0501079_0474470 Ga0501079_0474470_159_428 89
251 3300049742 Ga0501080_1824888 Ga0501080_1824888_49_318 89
252 3300049743 Ga0501081_0198152 Ga0501081_0198152_27_299 89
253 3300049743 Ga0501081_0253269 Ga0501081_0253269_343_615 89
254 3300049744 Ga0501083_0383102 Ga0501083_0383102_84_356 89
255 3300049822 Ga0501035_0079395 Ga0501035_0079395_675_947 89
256 3300049823 Ga0501044_0521546 Ga0501044_0521546_82_354 89
257 3300049824 Ga0501045_0070312 Ga0501045_0070312_1358_1627 89
258 3300049824 Ga0501045_1185375 Ga0501045_1185375_242_514 89
259 3300050490 nmdc:mga03n38_48985_c1 nmdc:mga03n38_48985_c1_422_691 89
260 3300050491 nmdc:mga00v17_103522_c1 nmdc:mga00v17_103522_c1_241_510 89
261 3300050492 nmdc:mga0yw44_202902_c1 nmdc:mga0yw44_202902_c1_406_675 89
262 3300050492 nmdc:mga0yw44_393010_c1 nmdc:mga0yw44_393010_c1_474_743 89
263 3300050492 nmdc:mga0yw44_80395_c1 nmdc:mga0yw44_80395_c1_1735_2004 89
264 3300050509 nmdc:mga0qj67_1168012_c1 nmdc:mga0qj67_1168012_c1_64_336 89
265 3300050510 nmdc:mga06r32_1786285_c1 nmdc:mga06r32_1786285_c1_154_423 89
266 3300050511 nmdc:mga08y16_1561098_c1 nmdc:mga08y16_1561098_c1_205_474 89
267 3300050515 nmdc:mga0a205_268777_c1 nmdc:mga0a205_268777_c1_65_334 89
268 3300053077 Ga0495601_0020486 Ga0495601_0020486_2110_2379 89
269 3300054114 Ga0501084_0009716 Ga0501084_0009716_6805_7077 89
270 3300054114 Ga0501084_0134152 Ga0501084_0134152_971_1240 89
271 3300060353 Ga0501082_0053899 Ga0501082_0053899_1234_1503 89
272 3300060353 Ga0501082_0087990 Ga0501082_0087990_627_899 89
273 3300060353 Ga0501082_1607679 Ga0501082_1607679_79_348 89
274 3300061719 Ga0466962_0232710 Ga0466962_0232710_330_599 89
275 3300061734 Ga0530510_0079885 Ga0530510_0079885_496_765 89
276 3300003373 JGI25407J50210_10084194 JGI25407J50210_100841942 90
277 3300005327 Ga0070658_11965389 Ga0070658_119653892 90
278 3300005330 Ga0070690_100139436 Ga0070690_1001394362 90
279 3300005330 Ga0070690_101043692 Ga0070690_1010436922 90
280 3300005335 Ga0070666_10219068 Ga0070666_102190682 90
281 3300005336 Ga0070680_100050076 Ga0070680_1000500762 90
282 3300005336 Ga0070680_100053040 Ga0070680_1000530404 90
283 3300005336 Ga0070680_100800706 Ga0070680_1008007062 90
284 3300005336 Ga0070680_101098288 Ga0070680_1010982882 90
285 3300005337 Ga0070682_100293570 Ga0070682_1002935702 90
286 3300005338 Ga0068868_100057737 Ga0068868_1000577374 90
287 3300005338 Ga0068868_100187508 Ga0068868_1001875083 90
288 3300005339 Ga0070660_100097164 Ga0070660_1000971643 90
289 3300005341 Ga0070691_10080342 Ga0070691_100803423 90
290 3300005343 Ga0070687_100106830 Ga0070687_1001068302 90
291 3300005345 Ga0070692_10255794 Ga0070692_102557942 90
292 3300005353 Ga0070669_100075770 Ga0070669_1000757703 90
293 3300005355 Ga0070671_100133814 Ga0070671_1001338143 90
294 3300005355 Ga0070671_100429762 Ga0070671_1004297622 90
295 3300005356 Ga0070674_100052965 Ga0070674_1000529652 90
296 3300005365 Ga0070688_100155783 Ga0070688_1001557832 90
297 3300005366 Ga0070659_100233430 Ga0070659_1002334301 90
298 3300005366 Ga0070659_101924823 Ga0070659_1019248232 90
299 3300005406 Ga0070703_10220328 Ga0070703_102203281 90
300 3300005434 Ga0070709_10175103 Ga0070709_101751033 90
301 3300005434 Ga0070709_10337355 Ga0070709_103373554 90
302 3300005435 Ga0070714_100129462 Ga0070714_1001294624 90
303 3300005435 Ga0070714_101701952 Ga0070714_1017019522 90
304 3300005436 Ga0070713_100730322 Ga0070713_1007303222 90
305 3300005436 Ga0070713_101501922 Ga0070713_1015019222 90
306 3300005437 Ga0070710_10034252 Ga0070710_100342524 90
307 3300005438 Ga0070701_10007614 Ga0070701_100076144 90
308 3300005439 Ga0070711_100005295 Ga0070711_10000529510 90
309 3300005439 Ga0070711_100169269 Ga0070711_1001692692 90
310 3300005439 Ga0070711_100205509 Ga0070711_1002055092 90
311 3300005439 Ga0070711_100661771 Ga0070711_1006617712 90
312 3300005440 Ga0070705_100003385 Ga0070705_10000338512 90
313 3300005441 Ga0070700_100260943 Ga0070700_1002609432 90
314 3300005444 Ga0070694_100458399 Ga0070694_1004583993 90
315 3300005445 Ga0070708_100110352 Ga0070708_1001103522 90
316 3300005445 Ga0070708_100288335 Ga0070708_1002883351 90
317 3300005455 Ga0070663_100536595 Ga0070663_1005365951 90
318 3300005456 Ga0070678_100672331 Ga0070678_1006723312 90
319 3300005456 Ga0070678_100984296 Ga0070678_1009842962 90
320 3300005458 Ga0070681_10021937 Ga0070681_100219372 90
321 3300005459 Ga0068867_100150678 Ga0068867_1001506783 90
322 3300005466 Ga0070685_10118398 Ga0070685_101183983 90
323 3300005467 Ga0070706_100116713 Ga0070706_1001167133 90
324 3300005467 Ga0070706_100234612 Ga0070706_1002346122 90
325 3300005468 Ga0070707_100177575 Ga0070707_1001775752 90
326 3300005471 Ga0070698_100017096 Ga0070698_10001709614 90
327 3300005518 Ga0070699_100135215 Ga0070699_1001352154 90
328 3300005518 Ga0070699_100337167 Ga0070699_1003371671 90
329 3300005518 Ga0070699_100534815 Ga0070699_1005348152 90
330 3300005535 Ga0070684_100006697 Ga0070684_1000066979 90
331 3300005535 Ga0070684_100465069 Ga0070684_1004650691 90
332 3300005535 Ga0070684_100549318 Ga0070684_1005493182 90
333 3300005539 Ga0068853_100192017 Ga0068853_1001920171 90
334 3300005539 Ga0068853_100625846 Ga0068853_1006258463 90
335 3300005543 Ga0070672_101408579 Ga0070672_1014085791 90
336 3300005544 Ga0070686_100047573 Ga0070686_1000475731 90
337 3300005544 Ga0070686_100499061 Ga0070686_1004990611 90
338 3300005544 Ga0070686_101534784 Ga0070686_1015347841 90
339 3300005545 Ga0070695_100017405 Ga0070695_1000174054 90
340 3300005545 Ga0070695_100059120 Ga0070695_1000591202 90
341 3300005546 Ga0070696_100020918 Ga0070696_1000209183 90
342 3300005546 Ga0070696_100121166 Ga0070696_1001211662 90
343 3300005547 Ga0070693_100018095 Ga0070693_1000180955 90
344 3300005547 Ga0070693_100021785 Ga0070693_1000217855 90
345 3300005547 Ga0070693_100054746 Ga0070693_1000547461 90
346 3300005549 Ga0070704_100109126 Ga0070704_1001091261 90
347 3300005577 Ga0068857_102455766 Ga0068857_1024557662 90
348 3300005614 Ga0068856_100112299 Ga0068856_1001122992 90
349 3300005614 Ga0068856_100296614 Ga0068856_1002966142 90
350 3300005614 Ga0068856_101781248 Ga0068856_1017812482 90
351 3300005615 Ga0070702_100019258 Ga0070702_1000192583 90
352 3300005615 Ga0070702_100145094 Ga0070702_1001450941 90
353 3300005615 Ga0070702_100339215 Ga0070702_1003392152 90
354 3300005616 Ga0068852_101563486 Ga0068852_1015634862 90
355 3300005618 Ga0068864_100707218 Ga0068864_1007072182 90
356 3300005718 Ga0068866_10019471 Ga0068866_100194712 90
357 3300005840 Ga0068870_10258637 Ga0068870_102586372 90
358 3300005844 Ga0068862_100149026 Ga0068862_1001490262 90
359 3300005937 Ga0081455_10007478 Ga0081455_1000747815 90
360 3300005937 Ga0081455_10105305 Ga0081455_101053052 90
361 3300005981 Ga0081538_10001960 Ga0081538_100019607 90
362 3300005981 Ga0081538_10002508 Ga0081538_100025089 90
363 3300005981 Ga0081538_10043342 Ga0081538_100433423 90
364 3300005983 Ga0081540_1010122 Ga0081540_10101224 90
365 3300006028 Ga0070717_10220519 Ga0070717_102205192 90
366 3300006028 Ga0070717_10250716 Ga0070717_102507162 90
367 3300006038 Ga0075365_10020204 Ga0075365_100202044 90
368 3300006048 Ga0075363_100858746 Ga0075363_1008587462 90
369 3300006058 Ga0075432_10053194 Ga0075432_100531942 90
370 3300006058 Ga0075432_10108741 Ga0075432_101087412 90
371 3300006163 Ga0070715_10000495 Ga0070715_1000049513 90
372 3300006163 Ga0070715_10029689 Ga0070715_100296893 90
373 3300006163 Ga0070715_10239938 Ga0070715_102399382 90
374 3300006173 Ga0070716_101066677 Ga0070716_1010666772 90
375 3300006175 Ga0070712_100000012 Ga0070712_10000001213 90
376 3300006175 Ga0070712_100060393 Ga0070712_1000603937 90
377 3300006175 Ga0070712_100679565 Ga0070712_1006795652 90
378 3300006175 Ga0070712_101748251 Ga0070712_1017482511 90
379 3300006177 Ga0075362_10262768 Ga0075362_102627682 90
380 3300006178 Ga0075367_10949822 Ga0075367_109498222 90
381 3300006237 Ga0097621_100460078 Ga0097621_1004600781 90
382 3300006844 Ga0075428_100107582 Ga0075428_1001075823 90
383 3300006846 Ga0075430_100228590 Ga0075430_1002285902 90
384 3300006847 Ga0075431_100381989 Ga0075431_1003819892 90
385 3300006847 Ga0075431_100666609 Ga0075431_1006666092 90
386 3300006852 Ga0075433_10299799 Ga0075433_102997991 90
387 3300006852 Ga0075433_10519590 Ga0075433_105195902 90
388 3300006871 Ga0075434_100199305 Ga0075434_1001993055 90
389 3300006871 Ga0075434_100366150 Ga0075434_1003661502 90
390 3300006871 Ga0075434_101215764 Ga0075434_1012157643 90
391 3300006914 Ga0075436_100005811 Ga0075436_1000058117 90
392 3300006914 Ga0075436_100166322 Ga0075436_1001663223 90
393 3300006914 Ga0075436_100260819 Ga0075436_1002608192 90
394 3300007076 Ga0075435_100026571 Ga0075435_1000265714 90
395 3300007076 Ga0075435_100175518 Ga0075435_1001755182 90
396 3300007076 Ga0075435_100445515 Ga0075435_1004455154 90
397 3300009092 Ga0105250_10441324 Ga0105250_104413242 90
398 3300009093 Ga0105240_10328973 Ga0105240_103289733 90
399 3300009094 Ga0111539_10355322 Ga0111539_103553222 90
400 3300009094 Ga0111539_11199630 Ga0111539_111996302 90
401 3300009094 Ga0111539_11983094 Ga0111539_119830942 90
402 3300009098 Ga0105245_10011634 Ga0105245_100116348 90
403 3300009098 Ga0105245_10112892 Ga0105245_101128923 90
404 3300009098 Ga0105245_10159400 Ga0105245_101594003 90
405 3300009098 Ga0105245_10510630 Ga0105245_105106302 90
406 3300009098 Ga0105245_12093121 Ga0105245_120931211 90
407 3300009101 Ga0105247_10767344 Ga0105247_107673442 90
408 3300009147 Ga0114129_10061875 Ga0114129_100618753 90
409 3300009147 Ga0114129_10080698 Ga0114129_100806984 90
410 3300009147 Ga0114129_10155732 Ga0114129_101557324 90
411 3300009147 Ga0114129_10560216 Ga0114129_105602163 90
412 3300009147 Ga0114129_10589599 Ga0114129_105895991 90
413 3300009147 Ga0114129_12026956 Ga0114129_120269561 90
414 3300009147 Ga0114129_12062753 Ga0114129_120627532 90
415 3300009148 Ga0105243_10057760 Ga0105243_100577601 90
416 3300009148 Ga0105243_10064578 Ga0105243_100645782 90
417 3300009148 Ga0105243_10551995 Ga0105243_105519952 90
418 3300009174 Ga0105241_10326989 Ga0105241_103269892 90
419 3300009174 Ga0105241_10634788 Ga0105241_106347881 90
420 3300009176 Ga0105242_10037976 Ga0105242_100379769 90
421 3300009176 Ga0105242_10073924 Ga0105242_100739242 90
422 3300009176 Ga0105242_12212014 Ga0105242_122120141 90
423 3300009177 Ga0105248_10132102 Ga0105248_101321025 90
424 3300009177 Ga0105248_10402244 Ga0105248_104022442 90
425 3300009545 Ga0105237_11123617 Ga0105237_111236172 90
426 3300009545 Ga0105237_12109555 Ga0105237_121095551 90
427 3300009553 Ga0105249_10139821 Ga0105249_101398212 90
428 3300009553 Ga0105249_10226499 Ga0105249_102264993 90
429 3300009553 Ga0105249_10510123 Ga0105249_105101231 90
430 3300010375 Ga0105239_10569018 Ga0105239_105690182 90
431 3300010375 Ga0105239_10904316 Ga0105239_109043161 90
432 3300010375 Ga0105239_12527219 Ga0105239_125272192 90
433 3300010375 Ga0105239_12774107 Ga0105239_127741072 90
434 3300011119 Ga0105246_10449155 Ga0105246_104491552 90
435 3300012491 Ga0157329_1016661 Ga0157329_10166612 90
436 3300012498 Ga0157345_1009168 Ga0157345_10091681 90
437 3300012502 Ga0157347_1011188 Ga0157347_10111882 90
438 3300012508 Ga0157315_1067161 Ga0157315_10671612 90
439 3300013100 Ga0157373_10365092 Ga0157373_103650921 90
440 3300013102 Ga0157371_10042662 Ga0157371_100426624 90
441 3300013104 Ga0157370_11077329 Ga0157370_110773292 90
442 3300013105 Ga0157369_10844686 Ga0157369_108446862 90
443 3300013306 Ga0163162_10066115 Ga0163162_100661154 90
444 3300013307 Ga0157372_10464310 Ga0157372_104643102 90
445 3300013307 Ga0157372_11435744 Ga0157372_114357441 90
446 3300013308 Ga0157375_10226983 Ga0157375_102269832 90
447 3300013308 Ga0157375_11079152 Ga0157375_110791521 90
448 3300014325 Ga0163163_11187903 Ga0163163_111879032 90
449 3300014325 Ga0163163_11683161 Ga0163163_116831612 90
450 3300014325 Ga0163163_12430830 Ga0163163_124308302 90
451 3300014326 Ga0157380_10087295 Ga0157380_100872952 90
452 3300014326 Ga0157380_10338911 Ga0157380_103389112 90
453 3300014745 Ga0157377_10610317 Ga0157377_106103172 90
454 3300014968 Ga0157379_10093938 Ga0157379_100939383 90
455 3300017792 Ga0163161_10642490 Ga0163161_106424902 90
456 3300020082 Ga0206353_10988080 Ga0206353_109880802 90
457 3300020082 Ga0206353_12036647 Ga0206353_120366472 90
458 3300025885 Ga0207653_10001268 Ga0207653_100012686 90
459 3300025885 Ga0207653_10246722 Ga0207653_102467222 90
460 3300025899 Ga0207642_10304142 Ga0207642_103041422 90
461 3300025904 Ga0207647_10287451 Ga0207647_102874512 90
462 3300025905 Ga0207685_10004045 Ga0207685_100040452 90
463 3300025905 Ga0207685_10125879 Ga0207685_101258792 90
464 3300025906 Ga0207699_10058481 Ga0207699_100584811 90
465 3300025908 Ga0207643_10270978 Ga0207643_102709782 90
466 3300025908 Ga0207643_10953197 Ga0207643_109531971 90
467 3300025910 Ga0207684_10120613 Ga0207684_101206135 90
468 3300025911 Ga0207654_10248734 Ga0207654_102487343 90
469 3300025911 Ga0207654_10551209 Ga0207654_105512092 90
470 3300025915 Ga0207693_10000030 Ga0207693_1000003013 90
471 3300025915 Ga0207693_10027562 Ga0207693_100275623 90
472 3300025915 Ga0207693_10038032 Ga0207693_100380327 90
473 3300025915 Ga0207693_10726408 Ga0207693_107264081 90
474 3300025916 Ga0207663_10242571 Ga0207663_102425713 90
475 3300025917 Ga0207660_10017777 Ga0207660_100177773 90
476 3300025919 Ga0207657_10197949 Ga0207657_101979492 90
477 3300025922 Ga0207646_10625728 Ga0207646_106257282 90
478 3300025923 Ga0207681_10787994 Ga0207681_107879941 90
479 3300025924 Ga0207694_10213437 Ga0207694_102134373 90
480 3300025925 Ga0207650_11498320 Ga0207650_114983202 90
481 3300025927 Ga0207687_10055695 Ga0207687_100556953 90
482 3300025928 Ga0207700_11120389 Ga0207700_111203891 90
483 3300025928 Ga0207700_11683181 Ga0207700_116831812 90
484 3300025929 Ga0207664_10721618 Ga0207664_107216182 90
485 3300025931 Ga0207644_10074347 Ga0207644_100743472 90
486 3300025931 Ga0207644_10733419 Ga0207644_107334192 90
487 3300025932 Ga0207690_10289437 Ga0207690_102894372 90
488 3300025933 Ga0207706_10026648 Ga0207706_100266485 90
489 3300025935 Ga0207709_10244871 Ga0207709_102448715 90
490 3300025937 Ga0207669_10803380 Ga0207669_108033802 90
491 3300025938 Ga0207704_10529894 Ga0207704_105298942 90
492 3300025939 Ga0207665_10003333 Ga0207665_100033336 90
493 3300025939 Ga0207665_10024121 Ga0207665_1002412110 90
494 3300025941 Ga0207711_10108052 Ga0207711_101080522 90
495 3300025941 Ga0207711_10816874 Ga0207711_108168742 90
496 3300025942 Ga0207689_11464107 Ga0207689_114641071 90
497 3300025944 Ga0207661_10430586 Ga0207661_104305862 90
498 3300025949 Ga0207667_10039317 Ga0207667_100393171 90
499 3300025949 Ga0207667_11074930 Ga0207667_110749302 90
500 3300025960 Ga0207651_10791455 Ga0207651_107914551 90
501 3300025961 Ga0207712_10150907 Ga0207712_101509072 90
502 3300025961 Ga0207712_10259495 Ga0207712_102594952 90
503 3300025972 Ga0207668_10288660 Ga0207668_102886602 90
504 3300025972 Ga0207668_10460951 Ga0207668_104609511 90
505 3300025972 Ga0207668_10682151 Ga0207668_106821511 90
506 3300025981 Ga0207640_11571369 Ga0207640_115713692 90
507 3300026041 Ga0207639_10575475 Ga0207639_105754753 90
508 3300026075 Ga0207708_10036676 Ga0207708_100366765 90
509 3300026075 Ga0207708_10568818 Ga0207708_105688182 90
510 3300026078 Ga0207702_10011983 Ga0207702_100119833 90
511 3300026078 Ga0207702_10133539 Ga0207702_101335394 90
512 3300026088 Ga0207641_12019766 Ga0207641_120197662 90
513 3300026089 Ga0207648_10016547 Ga0207648_100165474 90
514 3300026095 Ga0207676_10113004 Ga0207676_101130042 90
515 3300026116 Ga0207674_11845896 Ga0207674_118458962 90
516 3300026118 Ga0207675_100067443 Ga0207675_1000674434 90
517 3300026118 Ga0207675_101156194 Ga0207675_1011561942 90
518 3300026121 Ga0207683_10032315 Ga0207683_100323152 90
519 3300026121 Ga0207683_10229859 Ga0207683_102298592 90
520 3300026121 Ga0207683_10407459 Ga0207683_104074592 90
521 3300026142 Ga0207698_10243536 Ga0207698_102435362 90
522 3300027717 Ga0209998_10033807 Ga0209998_100338072 90
523 3300027907 Ga0207428_10013670 Ga0207428_100136706 90
524 3300027907 Ga0207428_10817237 Ga0207428_108172372 90
525 3300027907 Ga0207428_11130245 Ga0207428_111302451 90
526 3300028381 Ga0268264_12359803 Ga0268264_123598032 90
527 3300031852 Ga0307410_10538271 Ga0307410_105382712 90
528 3300031995 Ga0307409_100148564 Ga0307409_1001485643 90
529 3300032002 Ga0307416_101491172 Ga0307416_1014911722 90
530 3300032004 Ga0307414_11618413 Ga0307414_116184132 90
531 3300032126 Ga0307415_100484234 Ga0307415_1004842341 90
532 3300034817 Ga0373948_0038603 Ga0373948_0038603_685_957 90
533 3300034957 Ga0373938_0002635 Ga0373938_0002635_1011_1283 90
534 3300034957 Ga0373938_0153603 Ga0373938_0153603_64_345 90
535 3300035083 Ga0373926_0375091 Ga0373926_0375091_74_346 90
536 3300035084 Ga0373928_0001755 Ga0373928_0001755_17_289 90
537 3300035088 Ga0373940_0021716 Ga0373940_0021716_685_957 90
538 3300035089 Ga0373944_0009900 Ga0373944_0009900_1014_1286 90
539 3300035090 Ga0373949_0008702 Ga0373949_0008702_332_604 90
540 3300035090 Ga0373949_0099248 Ga0373949_0099248_82_354 90
541 3300035091 Ga0373951_0053886 Ga0373951_0053886_691_963 90
542 3300035092 Ga0373952_0021658 Ga0373952_0021658_503_775 90
543 3300035092 Ga0373952_0162362 Ga0373952_0162362_173_445 90
544 3300035112 Ga0373932_0007185 Ga0373932_0007185_1718_1990 90
545 3300035115 Ga0373941_0028490 Ga0373941_0028490_962_1234 90
546 3300035116 Ga0373945_0160545 Ga0373945_0160545_250_522 90
547 3300035121 Ga0373960_0047071 Ga0373960_0047071_653_925 90
548 3300035170 Ga0373943_0029115 Ga0373943_0029115_1698_1970 90
549 3300035171 Ga0373946_0041418 Ga0373946_0041418_443_715 90
550 3300035207 Ga0373942_0195777 Ga0373942_0195777_285_566 90
551 3300035241 Ga0373961_0013528 Ga0373961_0013528_1123_1395 90
552 3300035242 Ga0373962_0002078 Ga0373962_0002078_4478_4750 90
553 3300035242 Ga0373962_0050513 Ga0373962_0050513_706_978 90
554 3300035691 Ga0373931_0035482 Ga0373931_0035482_395_667 90
555 3300035691 Ga0373931_0566719 Ga0373931_0566719_368_649 90
556 3300035725 Ga0373947_0008966 Ga0373947_0008966_3079_3351 90
557 3300037068 Ga0373925_0103348 Ga0373925_0103348_367_639 90
558 3300037312 Ga0395899_0037746 Ga0395899_0037746_1633_1905 90
559 3300037312 Ga0395899_0041313 Ga0395899_0041313_1042_1314 90
560 3300037418 Ga0395900_0117068 Ga0395900_0117068_2356_2628 90
561 3300037418 Ga0395900_0304553 Ga0395900_0304553_649_921 90
562 3300037418 Ga0395900_0638859 Ga0395900_0638859_518_790 90
563 3300037418 Ga0395900_0772238 Ga0395900_0772238_438_710 90
564 3300037466 Ga0395898_0072155 Ga0395898_0072155_1348_1620 90
565 3300037466 Ga0395898_0621979 Ga0395898_0621979_651_923 90
566 3300037471 Ga0395905_0053061 Ga0395905_0053061_930_1202 90
567 3300037471 Ga0395905_0381323 Ga0395905_0381323_621_893 90
568 3300038443 Ga0395901_0079204 Ga0395901_0079204_957_1229 90
569 3300041501 Ga0451845_0864229 Ga0451845_0864229_278_550 90
570 3300041505 Ga0451849_0034861 Ga0451849_0034861_137_409 90
571 3300041507 Ga0451851_0347102 Ga0451851_0347102_79_351 90
572 3300041512 Ga0451853_3133616 Ga0451853_3133616_937_1209 90
573 3300042005 Ga0439448_0028095 Ga0439448_0028095_535_807 90
574 3300042005 Ga0439448_0042866 Ga0439448_0042866_1094_1366 90
575 3300042012 Ga0439455_0042830 Ga0439455_0042830_272_544 90
576 3300042016 Ga0439463_015226 Ga0439463_015226_768_1040 90
577 3300042157 Ga0439458_0042246 Ga0439458_0042246_240_512 90
578 3300042439 Ga0439464_0155349 Ga0439464_0155349_425_697 90
579 3300044735 Ga0466968_0511629 Ga0466968_0511629_25_306 90
580 3300045051 Ga0451576_0123507 Ga0451576_0123507_1514_1786 90
581 3300046455 Ga0495603_0003706 Ga0495603_0003706_4941_5213 90
582 3300046461 Ga0495641_0005237 Ga0495641_0005237_7946_8218 90
583 3300046461 Ga0495641_0063001 Ga0495641_0063001_804_1085 90
584 3300046473 Ga0495582_0058980 Ga0495582_0058980_384_656 90
585 3300046473 Ga0495582_0105401 Ga0495582_0105401_1220_1492 90
586 3300046473 Ga0495582_0614792 Ga0495582_0614792_331_612 90
587 3300046475 Ga0495639_0364190 Ga0495639_0364190_298_570 90
588 3300046491 Ga0495584_0133942 Ga0495584_0133942_255_527 90
589 3300046492 Ga0495585_0361558 Ga0495585_0361558_265_537 90
590 3300046499 Ga0495594_0000927 Ga0495594_0000927_12527_12799 90
591 3300046525 Ga0495663_0319379 Ga0495663_0319379_143_415 90
592 3300046526 Ga0495666_0017192 Ga0495666_0017192_1739_2011 90
593 3300046531 Ga0495665_0158964 Ga0495665_0158964_473_745 90
594 3300046531 Ga0495665_0335675 Ga0495665_0335675_330_602 90
595 3300046674 Ga0495588_0003423 Ga0495588_0003423_2766_3038 90
596 3300046674 Ga0495588_0586760 Ga0495588_0586760_19_291 90
597 3300047321 Ga0495676_0006624 Ga0495676_0006624_7138_7410 90
598 3300047321 Ga0495676_0119731 Ga0495676_0119731_816_1088 90
599 3300048903 Ga0496100_0001005 Ga0496100_0001005_1894_2166 90
600 3300048903 Ga0496100_0237988 Ga0496100_0237988_1040_1312 90
601 3300048903 Ga0496100_0522469 Ga0496100_0522469_63_335 90
602 3300048904 Ga0496101_0009726 Ga0496101_0009726_4569_4841 90
603 3300048904 Ga0496101_0112799 Ga0496101_0112799_81_362 90
604 3300048904 Ga0496101_0189128 Ga0496101_0189128_641_913 90
605 3300048905 Ga0496102_0025710 Ga0496102_0025710_2567_2839 90
606 3300048905 Ga0496102_0145217 Ga0496102_0145217_1132_1404 90
607 3300048905 Ga0496102_0147329 Ga0496102_0147329_1756_2028 90
608 3300048905 Ga0496102_0651937 Ga0496102_0651937_283_555 90
609 3300048906 Ga0496103_0086753 Ga0496103_0086753_416_688 90
610 3300048907 Ga0496104_0003336 Ga0496104_0003336_12999_13271 90
611 3300048907 Ga0496104_0072353 Ga0496104_0072353_130_402 90
612 3300048907 Ga0496104_0417804 Ga0496104_0417804_275_556 90
613 3300048907 Ga0496104_0829597 Ga0496104_0829597_304_576 90
614 3300048908 Ga0496105_0000671 Ga0496105_0000671_7263_7535 90
615 3300048908 Ga0496105_0025383 Ga0496105_0025383_4230_4511 90
616 3300048908 Ga0496105_0062025 Ga0496105_0062025_1819_2091 90
617 3300048909 Ga0496106_0011147 Ga0496106_0011147_5941_6222 90
618 3300048909 Ga0496106_0334686 Ga0496106_0334686_558_830 90
619 3300048909 Ga0496106_0363974 Ga0496106_0363974_87_359 90
620 3300048909 Ga0496106_1310570 Ga0496106_1310570_277_549 90
621 3300048910 Ga0496107_0008053 Ga0496107_0008053_4570_4842 90
622 3300048910 Ga0496107_0586627 Ga0496107_0586627_202_474 90
623 3300048910 Ga0496107_0965741 Ga0496107_0965741_146_418 90
624 3300048911 Ga0496108_0000317 Ga0496108_0000317_29378_29650 90
625 3300048911 Ga0496108_0003773 Ga0496108_0003773_833_1114 90
626 3300048911 Ga0496108_0019040 Ga0496108_0019040_3785_4057 90
627 3300048911 Ga0496108_0123220 Ga0496108_0123220_1216_1488 90
628 3300048912 Ga0496109_0007014 Ga0496109_0007014_5567_5839 90
629 3300048912 Ga0496109_0082943 Ga0496109_0082943_672_944 90
630 3300048912 Ga0496109_0090036 Ga0496109_0090036_794_1066 90
631 3300048912 Ga0496109_0290400 Ga0496109_0290400_448_729 90
632 3300048913 Ga0496110_0000774 Ga0496110_0000774_3795_4067 90
633 3300048913 Ga0496110_0003926 Ga0496110_0003926_6921_7202 90
634 3300048913 Ga0496110_0023700 Ga0496110_0023700_4099_4371 90
635 3300048913 Ga0496110_0041097 Ga0496110_0041097_3278_3559 90
636 3300048913 Ga0496110_0142582 Ga0496110_0142582_853_1125 90
637 3300048913 Ga0496110_0343214 Ga0496110_0343214_848_1120 90
638 3300048913 Ga0496110_1203207 Ga0496110_1203207_45_317 90
639 3300048914 Ga0496111_0001461 Ga0496111_0001461_8421_8693 90
640 3300048914 Ga0496111_0035877 Ga0496111_0035877_1439_1711 90
641 3300048914 Ga0496111_0086730 Ga0496111_0086730_1612_1893 90
642 3300048914 Ga0496111_0117232 Ga0496111_0117232_15_296 90
643 3300048914 Ga0496111_0162573 Ga0496111_0162573_363_635 90
644 3300048914 Ga0496111_0302204 Ga0496111_0302204_334_606 90
645 3300048915 Ga0496112_0059782 Ga0496112_0059782_377_658 90
646 3300048915 Ga0496112_0117971 Ga0496112_0117971_1581_1853 90
647 3300048915 Ga0496112_0635782 Ga0496112_0635782_386_658 90
648 3300048916 Ga0496113_0001684 Ga0496113_0001684_6817_7089 90
649 3300048916 Ga0496113_0014555 Ga0496113_0014555_657_929 90
650 3300048916 Ga0496113_0091637 Ga0496113_0091637_1696_1977 90
651 3300048916 Ga0496113_0342847 Ga0496113_0342847_217_489 90
652 3300048917 Ga0496114_0032146 Ga0496114_0032146_3154_3426 90
653 3300048917 Ga0496114_0080759 Ga0496114_0080759_1123_1395 90
654 3300048917 Ga0496114_1304659 Ga0496114_1304659_88_369 90
655 3300048918 Ga0496115_0137281 Ga0496115_0137281_693_965 90
656 3300048918 Ga0496115_0412095 Ga0496115_0412095_326_598 90
657 3300048918 Ga0496115_0511586 Ga0496115_0511586_149_421 90
658 3300049572 Ga0501036_0179126 Ga0501036_0179126_758_1030 90
659 3300049576 Ga0501040_0762921 Ga0501040_0762921_55_327 90
660 3300049577 Ga0501041_0262927 Ga0501041_0262927_718_990 90
661 3300049591 Ga0501075_0206334 Ga0501075_0206334_392_664 90
662 3300049741 Ga0501079_0519467 Ga0501079_0519467_566_838 90
663 3300049743 Ga0501081_0498168 Ga0501081_0498168_148_420 90
664 3300050507 nmdc:mga05p37_145726_c1 nmdc:mga05p37_145726_c1_740_1012 90
665 3300050507 nmdc:mga05p37_356842_c1 nmdc:mga05p37_356842_c1_505_777 90
666 3300050510 nmdc:mga06r32_240504_c1 nmdc:mga06r32_240504_c1_141_413 90
667 3300050510 nmdc:mga06r32_554586_c1 nmdc:mga06r32_554586_c1_173_445 90
668 3300050511 nmdc:mga08y16_1102905_c1 nmdc:mga08y16_1102905_c1_186_458 90
669 3300050511 nmdc:mga08y16_27600_c1 nmdc:mga08y16_27600_c1_2754_3026 90
670 3300050512 nmdc:mga0n895_1286835_c1 nmdc:mga0n895_1286835_c1_172_444 90
671 3300050512 nmdc:mga0n895_1551336_c1 nmdc:mga0n895_1551336_c1_322_594 90
672 3300050512 nmdc:mga0n895_48692_c1 nmdc:mga0n895_48692_c1_3351_3623 90
673 3300050512 nmdc:mga0n895_7454_c1 nmdc:mga0n895_7454_c1_7099_7371 90
674 3300050513 nmdc:mga0rr50_1356020_c1 nmdc:mga0rr50_1356020_c1_78_350 90
675 3300050513 nmdc:mga0rr50_441412_c1 nmdc:mga0rr50_441412_c1_104_376 90
676 3300050513 nmdc:mga0rr50_49082_c1 nmdc:mga0rr50_49082_c1_2775_3047 90
677 3300050513 nmdc:mga0rr50_652630_c1 nmdc:mga0rr50_652630_c1_120_392 90
678 3300050514 nmdc:mga08x19_63526_c1 nmdc:mga08x19_63526_c1_1275_1547 90
679 3300050515 nmdc:mga0a205_127261_c1 nmdc:mga0a205_127261_c1_119_391 90
680 3300050515 nmdc:mga0a205_642577_c1 nmdc:mga0a205_642577_c1_400_672 90
681 3300050515 nmdc:mga0a205_84787_c1 nmdc:mga0a205_84787_c1_1619_1891 90
682 3300061734 Ga0530510_1114863 Ga0530510_1114863_50_322 90
683 3300003373 JGI25407J50210_10021184 JGI25407J50210_100211841 91
684 3300005341 Ga0070691_10814738 Ga0070691_108147382 91
685 3300005439 Ga0070711_101276558 Ga0070711_1012765581 91
686 3300005981 Ga0081538_10002566 Ga0081538_100025666 91
687 3300009094 Ga0111539_10041528 Ga0111539_100415283 91
688 3300032002 Ga0307416_100797732 Ga0307416_1007977321 91
689 3300037418 Ga0395900_0202426 Ga0395900_0202426_1513_1788 91
690 3300037418 Ga0395900_1574161 Ga0395900_1574161_46_321 91
691 3300037471 Ga0395905_0428913 Ga0395905_0428913_380_655 91
692 3300038443 Ga0395901_0648951 Ga0395901_0648951_369_644 91
693 3300038443 Ga0395901_1259423 Ga0395901_1259423_121_396 91
694 3300038443 Ga0395901_1792898 Ga0395901_1792898_49_324 91
695 3300046491 Ga0495584_0308492 Ga0495584_0308492_501_776 91
696 3300046691 Ga0495670_0175229 Ga0495670_0175229_410_685 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

4

73

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8glv-assembly1.cif.gz_AR 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.6358 15 60
8j07-assembly1.cif.gz_n8 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.6334 15 61
3hes-assembly3.cif.gz_B human prion protein variant f198s with m129 0.6274 5 61
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5938 6 61
8glv-assembly1.cif.gz_MK 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.5932 12 57
ID Description Score Start End Superfamily
af_G3V8D8_119_217_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.7491 15 60 3.30.1140.40
af_Q6TGT3_15_113_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.6538 19 57 3.30.1140.40
3hesB00 Mainly Alpha;Orthogonal Bundle;Major Prion Protein;Prion/Doppel protein, beta-ribbon domain 0.6274 5 61 1.10.790.10
af_P77475_18_87_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.627 16 63 3.40.50.1000
af_Q4CSR2_869_1039_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6066 7 39 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 1.007 1 70
AF-A0A6P2EKU9-F1-model_v4 DUF2277 domain-containing protein 0.9996 1 87
AF-E0I5X4-F1-model_v4 DUF2277 domain-containing protein 0.9985 1 86
AF-A0A327XPT1-F1-model_v4 deleted 0.998 1 87
AF-A0A7W1U879-F1-model_v4 DUF2277 domain-containing protein 0.9977 1 87

Feature Viewer

pLDDT pTM Quality
91.66 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map