F475873

General Info

Members Datasets Scaffolds Average Seq Length
696 564 1392 307

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|650716007|650740059
Length 329
Sequence WSAWKRARYSAKSFCGWIDALKLFITRIVLKLDHFRQWLIATFAFGLLNLLKIFPADAGIRAADRLARFVGPKTGRHKLMLYNLARAFPEKSEEERLTIAMDSWGSMGRLAAEYVFLDRLFDFDPENSEPGRIRVEGISTFIELRDNPRPFIVFTAHSGNFELLPVASSAFGLDVTVLFRPPNNPFVADKVFKFRKERMGNLVPSHAGSSFALARQLERGGGVGVLVDQKFGKGLTTKFFGHEVRTNPLLAKLVRQFNCDVYPARCVRLPDNRYRLEIEPRVEIPRDEKGNVDIQATAQLLNDKVESWVREYPEQWLWYHDRWDVKHQI

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
53 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
54 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
55 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
56 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
57 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
100 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
175 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
176 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
177 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
178 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
179 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
189 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
190 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
191 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
192 2509276019 Ensifer aridi TW10 Isolate Nodule
193 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
194 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
195 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
196 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
197 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
198 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
199 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
200 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
201 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
202 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
203 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
204 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
205 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
206 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
207 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
208 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
209 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
210 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
211 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
212 2516143018 Ensifer sp. BR816 Isolate Nodule
213 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
214 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
215 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
216 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
217 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
218 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
219 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
220 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
221 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
222 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
223 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
224 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
225 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
226 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
227 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
228 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
229 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
230 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
231 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
232 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
233 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
234 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
235 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
236 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
237 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
238 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
239 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
240 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
241 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
242 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
243 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
244 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
245 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
246 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
247 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
248 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
249 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
250 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
251 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
252 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
253 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
254 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
255 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
256 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
257 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
258 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
259 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
260 2643221557 Ensifer sp. Root558 Isolate Unclassified
261 2643221558 Rhizobium sp. Root149 Isolate Unclassified
262 2643221568 Rhizobium sp. Root564 Isolate Unclassified
263 2643221582 Rhizobium sp. Root651 Isolate Unclassified
264 2643221599 Rhizobium sp. Root708 Isolate Unclassified
265 2643221607 Rhizobium sp. Root73 Isolate Unclassified
266 2643221610 Ensifer sp. Root74 Isolate Unclassified
267 2643221618 Ensifer sp. Root231 Isolate Unclassified
268 2643221626 Ensifer sp. Root31 Isolate Unclassified
269 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
270 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
271 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
272 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
273 2643221655 Ensifer sp. Root1252 Isolate Unclassified
274 2643221659 Ensifer sp. Root127 Isolate Unclassified
275 2643221668 Ensifer sp. Root423 Isolate Unclassified
276 2643221675 Ensifer sp. Root1298 Isolate Unclassified
277 2643221680 Ensifer sp. Root1312 Isolate Unclassified
278 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
279 2643221688 Rhizobium sp. Root482 Isolate Unclassified
280 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
281 2643221693 Rhizobium sp. Root491 Isolate Unclassified
282 2643221698 Ensifer sp. Root142 Isolate Unclassified
283 2643221712 Ensifer sp. Root258 Isolate Unclassified
284 2643221719 Rhizobium sp. Root274 Isolate Unclassified
285 2643221723 Ensifer sp. Root278 Isolate Unclassified
286 2643221726 Ensifer sp. Root954 Isolate Unclassified
287 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
288 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
289 2738541293 Rhizobium sp. GV031 Isolate Unclassified
290 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
291 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
292 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
293 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
294 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
295 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
296 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
297 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
298 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
299 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
300 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
301 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
302 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
303 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
304 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
305 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
306 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
307 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
308 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
309 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
310 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
311 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
312 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
313 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
314 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
315 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
316 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
317 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
318 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
319 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
320 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
321 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
322 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
323 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
324 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
325 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
326 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
327 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
328 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
329 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
330 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
331 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
332 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
333 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
334 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
335 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
336 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
337 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
338 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
339 2844163670 Ensifer sp. 1H6 Isolate Unclassified
340 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
341 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
342 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
343 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
344 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
345 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
346 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
347 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
348 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
349 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
350 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
351 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
352 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
353 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
354 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
355 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
356 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
357 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
358 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
359 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
360 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
361 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
362 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
363 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
364 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
365 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
366 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
367 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
368 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
369 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
370 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
371 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
372 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
373 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
374 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
375 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
376 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
377 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
378 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
379 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
380 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
381 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
382 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
383 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
384 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
385 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
386 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
387 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
388 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
389 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
390 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
391 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
392 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
393 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
394 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
395 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
396 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
397 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
398 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
399 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
400 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
401 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
402 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
403 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
404 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
405 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
406 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
407 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
408 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
409 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
410 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
411 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
412 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
413 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
414 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
415 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
416 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
417 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
418 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
419 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
420 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
421 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
422 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
423 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
424 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
425 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
426 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
427 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
428 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
429 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
430 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
431 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
432 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
433 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
434 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
435 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
436 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
437 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
438 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
439 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
440 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
441 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
442 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
443 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
444 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
445 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
446 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
447 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
448 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
449 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
450 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
451 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
452 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
453 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
454 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
455 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
456 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
457 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
458 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
459 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
460 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
461 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
462 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
463 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
464 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
465 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
466 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
467 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
468 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
469 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
470 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
471 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
472 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
473 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
474 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
475 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
476 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
477 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
478 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
479 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
480 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
481 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
482 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
483 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
484 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
485 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
486 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
487 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
488 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
489 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
490 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
491 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
492 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
493 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
494 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
495 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
496 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
497 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
498 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
499 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
500 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
501 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
502 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
503 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
504 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
505 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
506 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
507 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
508 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
509 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
510 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
511 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
512 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
513 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
514 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
515 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
516 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
517 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
518 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
519 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
520 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
521 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
522 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
523 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
524 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
525 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
526 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
527 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
528 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
529 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
530 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
531 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
532 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
533 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
534 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
535 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
536 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
537 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
538 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
539 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
540 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
541 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
542 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
543 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
544 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
545 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
546 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
547 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
548 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
549 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
550 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
551 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
552 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
553 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
554 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
555 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
556 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
557 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
558 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
559 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
560 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
561 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
562 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
563 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
564 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.55
Metatranscriptomes 0
Isolates 54.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 15.23
Nodule 38.79
Rhizoplane 1.72
Rhizosphere 20.98
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000033 3300001979 Bacteria 46151
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000209 3300002737 Bacteria 61889
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25157J39369_1000030 3300002741 Bacteria 146112
7 JGI25152J39213_1001321 3300002773 Bacteria 11013
8 JGI25150J39212_1000409 3300002774 Bacteria 19950
9 JGI25150J39212_1000439 3300002774 Bacteria 18618
10 JGI25159J45721_1000020 3300002987 Bacteria 124791
11 JGI25159J45721_1000530 3300002987 Bacteria 17359
12 JGI25151J46595_10000083 3300003187 Bacteria 130658
13 JGI25151J46595_10005174 3300003187 Bacteria 6768
14 JGI25151J46595_10014023 3300003187 Bacteria 3587
15 JGI25151J46595_10018587 3300003187 Bacteria 2978
16 JGI25165J46597_1000302 3300003214 Bacteria 61889
17 JGI25165J46597_1000682 3300003214 Bacteria 27253
18 JGI25165J46597_1008351 3300003214 Bacteria 1629
19 JGI25153J46596_10000210 3300003215 Bacteria 52714
20 rootH2_10062869 3300003320 Bacteria 2697
21 rootL2_10044579 3300003322 Bacteria 5714
22 rootH1_10117726 3300003323 Bacteria 3410
23 JGI25160J50197_1000055 3300003354 Bacteria 124791
24 JGI25160J50197_1000087 3300003354 Bacteria 93379
25 JGI25161J50226_1000066 3300003374 Bacteria 94505
26 JGI25161J50226_1000374 3300003374 Bacteria 22499
27 JGI25161J50226_1003621 3300003374 Bacteria 3464
28 Ga0055526_1000508 3300003771 Bacteria 30971
29 Ga0055524_1000319 3300003775 Bacteria 45208
30 Ga0055536_1007640 3300003781 Bacteria 4795
31 Ga0055536_1008572 3300003781 Bacteria 4373
32 Ga0055528_1000358 3300003790 Bacteria 37118
33 Ga0055530_10011096 3300003791 Bacteria 3265
34 Ga0055540_1002260 3300003792 Bacteria 10397
35 Ga0055531_10001342 3300003794 Bacteria 18368
36 Ga0058692_1001657 3300003856 Bacteria 7995
37 Ga0055543_1000068 3300004625 Bacteria 94795
38 Ga0055543_1000240 3300004625 Bacteria 42475
39 Ga0065165_1000839 3300005262 Bacteria 40355
40 Ga0065165_1001002 3300005262 Bacteria 34597
41 Ga0065165_1003362 3300005262 Bacteria 11360
42 Ga0070658_10434436 3300005327 Bacteria 1130
43 Ga0070670_100013849 3300005331 Bacteria 6916
44 Ga0070665_100071267 3300005548 Bacteria 3482
45 Ga0070665_100329624 3300005548 Bacteria 1531
46 Ga0070664_100543975 3300005564 Unclassified 1073
47 Ga0068852_100388732 3300005616 Bacteria 1370
48 Ga0075365_10032679 3300006038 Bacteria 3348
49 Ga0075368_10007710 3300006042 Bacteria 3807
50 Ga0075362_10005100 3300006177 Bacteria 4779
51 Ga0075366_10033148 3300006195 Bacteria 3042
52 Ga0075370_10090400 3300006353 Bacteria 1766
53 Ga0075428_100017904 3300006844 Bacteria 7830
54 Ga0075431_100019285 3300006847 Bacteria 6952
55 Ga0099826_10000184 3300006948 Bacteria 26251
56 Ga0105240_10000005 3300009093 Bacteria 702630
57 Ga0105243_10016141 3300009148 Bacteria 5648
58 Ga0105243_10117627 3300009148 Bacteria 2235
59 Ga0105237_10000766 3300009545 Bacteria 44044
60 Ga0105239_10001069 3300010375 Bacteria 38061
61 Ga0157373_10007546 3300013100 Bacteria 8085
62 Ga0157373_10025926 3300013100 Bacteria 4236
63 Ga0157371_10000015 3300013102 Bacteria 339838
64 Ga0157371_10023587 3300013102 Bacteria 4499
65 Ga0157370_10000046 3300013104 Bacteria 125612
66 Ga0157370_10001762 3300013104 Bacteria 26694
67 Ga0157369_10011018 3300013105 Bacteria 10288
68 Ga0157369_10041214 3300013105 Bacteria 5040
69 Ga0157369_10598548 3300013105 Bacteria 1138
70 Ga0157378_10409018 3300013297 Bacteria 1339
71 Ga0182008_10035258 3300014497 Bacteria 2507
72 Ga0182007_10005374 3300015262 Bacteria 5631
73 Ga0183363_1276 3300015690 Bacteria 7968
74 Ga0214542_1001614 3300021321 Bacteria 46380
75 Ga0214543_1000078 3300021327 Bacteria 119775
76 Ga0214543_1001395 3300021327 Bacteria 46435
77 Ga0228711_1000016 3300022739 Bacteria 126351
78 Ga0228710_1000013 3300022740 Bacteria 145976
79 Ga0209435_100012 3300025206 Bacteria 401621
80 Ga0209436_105532 3300025208 Bacteria 2894
81 Ga0209672_103025 3300025228 Bacteria 3669
82 Ga0209563_102861 3300025230 Bacteria 3753
83 Ga0209437_100047 3300025233 Bacteria 405163
84 Ga0209437_100165 3300025233 Bacteria 145009
85 Ga0209437_105595 3300025233 Bacteria 2134
86 Ga0207425_1000024 3300025245 Bacteria 328978
87 Ga0209646_1000026 3300025246 Bacteria 401621
88 Ga0209026_1000014 3300025250 Bacteria 401621
89 Ga0209677_100656 3300025253 Bacteria 18202
90 Ga0209759_1000012 3300025256 Bacteria 401621
91 Ga0209129_1000161 3300025258 Bacteria 102017
92 Ga0209129_1000184 3300025258 Bacteria 87102
93 Ga0209233_1000048 3300025261 Bacteria 453669
94 Ga0209233_1000069 3300025261 Bacteria 367639
95 Ga0209233_1000257 3300025261 Bacteria 80366
96 Ga0209455_1011076 3300025272 Bacteria 2244
97 Ga0209673_1000010 3300025273 Bacteria 596656
98 Ga0209673_1008200 3300025273 Bacteria 4688
99 Ga0209130_1000021 3300025284 Bacteria 374278
100 Ga0209130_1000026 3300025284 Bacteria 334058
101 Ga0209130_1008956 3300025284 Bacteria 2899
102 Ga0209025_1000050 3300025294 Bacteria 331531
103 Ga0209025_1000094 3300025294 Bacteria 241080
104 Ga0209025_1000119 3300025294 Bacteria 210606
105 Ga0209025_1000767 3300025294 Bacteria 53337
106 Ga0209025_1011121 3300025294 Bacteria 5990
107 Ga0209025_1023772 3300025294 Bacteria 3189
108 Ga0209025_1057261 3300025294 Bacteria 1491
109 Ga0209564_1000208 3300025295 Bacteria 134794
110 Ga0209564_1007273 3300025295 Bacteria 5748
111 Ga0209758_1000083 3300025297 Bacteria 257283
112 Ga0209758_1000418 3300025297 Bacteria 72150
113 Ga0209050_1007130 3300025298 Bacteria 6381
114 Ga0209050_1009774 3300025298 Bacteria 4842
115 Ga0209256_1000042 3300025299 Bacteria 341821
116 Ga0209256_1002161 3300025299 Bacteria 16949
117 Ga0207426_1000006 3300025302 Bacteria 1025969
118 Ga0207426_1000010 3300025302 Bacteria 796003
119 Ga0209051_1000482 3300025303 Bacteria 51474
120 Ga0209257_1001560 3300025304 Bacteria 26487
121 Ga0209257_1004267 3300025304 Bacteria 11276
122 Ga0207695_10000011 3300025913 Bacteria 910221
123 Ga0207671_10000241 3300025914 Bacteria 81847
124 Ga0207650_10001517 3300025925 Bacteria 16599
125 Ga0207709_10122485 3300025935 Bacteria 1758
126 Ga0209281_1000036 3300027111 Bacteria 369415
127 Ga0209281_1000047 3300027111 Bacteria 326514
128 Ga0209281_1000221 3300027111 Bacteria 122380
129 Ga0209281_1000453 3300027111 Bacteria 58584
130 Ga0209371_1000021 3300027312 Bacteria 555864
131 Ga0209371_1001579 3300027312 Bacteria 14899
132 Ga0209371_1004293 3300027312 Bacteria 6307
133 Ga0209371_1013229 3300027312 Unclassified 2332
134 Ga0209282_1000041 3300027666 Bacteria 122268
135 Ga0209282_1003765 3300027666 Bacteria 9090
136 Ga0209813_10002676 3300027866 Bacteria 4100
137 Ga0268266_10231163 3300028379 Bacteria 1703
138 Ga0307515_10000023 3300028794 Bacteria 400846
139 Ga0268256_1000020 3300030500 Bacteria 557873
140 Ga0268256_1004089 3300030500 Bacteria 6237
141 Ga0268256_1007091 3300030500 Bacteria 4058
142 Ga0268256_1017617 3300030500 Unclassified 2007
143 Ga0316182_1023026 3300030745 Bacteria 7438
144 Ga0307513_10003030 3300031456 Bacteria 22903
145 Ga0307405_10015711 3300031731 Bacteria 4107
146 Ga0307410_10326702 3300031852 Bacteria 1219
147 Ga0307412_10007804 3300031911 Bacteria 6090
148 Ga0307412_10217805 3300031911 Bacteria 1461
149 Ga0315914_1000030 3300031967 Bacteria 102599
150 Ga0307409_100035811 3300031995 Bacteria 3641
151 Ga0307414_10100624 3300032004 Bacteria 2174
152 Ga0307414_10376599 3300032004 Bacteria 1226
153 Ga0315913_1000017 3300033430 Bacteria 102835
154 Ga0315915_1000017 3300033464 Bacteria 148111
155 Ga0373927_0000178 3300035695 Bacteria 50343
156 Ga0373925_0005414 3300037068 Bacteria 9509
157 Ga0439466_0068615 3300041411 Bacteria 1132
158 Ga0439465_0013292 3300041413 Bacteria 2569
159 Ga0439465_0017025 3300041413 Bacteria 2268
160 Ga0439449_0022039 3300042007 Bacteria 2385
161 Ga0450906_021326 3300042145 Bacteria 1158
162 Ga0439434_0061724 3300042435 Bacteria 1172
163 Ga0450918_004163 3300042531 Bacteria 2650
164 Ga0466963_0016488 3300044694 Bacteria 4595
165 Ga0466971_0079692 3300044719 Bacteria 1492
166 Ga0466968_0083900 3300044735 Bacteria 1404
167 Ga0466970_0006941 3300044765 Bacteria 5670
168 Ga0466957_0076006 3300044842 Bacteria 2085
169 Ga0466958_0021197 3300045836 Bacteria 3795
170 Ga0466967_0317764 3300045976 Bacteria 1501
171 Ga0495638_0000638 3300046460 Bacteria 38456
172 Ga0495605_0002606 3300046474 Bacteria 11082
173 Ga0495585_0155436 3300046492 Bacteria 1190
174 Ga0495607_0087235 3300046501 Bacteria 1699
175 Ga0495583_0019044 3300046506 Bacteria 3593
176 Ga0495606_0001613 3300046507 Bacteria 29410
177 Ga0495610_0020563 3300046512 Bacteria 3662
178 Ga0495616_0039950 3300046513 Bacteria 2400
179 Ga0495620_0019205 3300046515 Bacteria 3368
180 Ga0495628_0122289 3300046516 Bacteria 1996
181 Ga0495631_0008540 3300046518 Bacteria 5156
182 Ga0495632_0020569 3300046519 Bacteria 3570
183 Ga0495643_0024984 3300046522 Bacteria 3385
184 Ga0495643_0026352 3300046522 Bacteria 3281
185 Ga0495652_0248275 3300046529 Bacteria 1320
186 Ga0495654_0000090 3300046530 Bacteria 101947
187 Ga0495633_0032538 3300046558 Bacteria 2519
188 Ga0495625_0001863 3300046660 Bacteria 23982
189 Ga0495625_0078944 3300046660 Bacteria 2297
190 Ga0495625_0102713 3300046660 Bacteria 1962
191 Ga0495588_0003082 3300046674 Bacteria 7215
192 Ga0495658_0043835 3300046683 Bacteria 2504
193 Ga0495670_0068029 3300046691 Bacteria 1799
194 Ga0495600_0064586 3300046809 Bacteria 2393
195 Ga0495660_0112038 3300046810 Bacteria 1391
196 Ga0495604_0020662 3300047317 Bacteria 5257
197 Ga0495636_0029347 3300047318 Bacteria 2245
198 Ga0495672_0060834 3300047320 Bacteria 2179
199 Ga0495681_0015571 3300047470 Bacteria 4295
200 Ga0495686_0029245 3300047472 Bacteria 3585
201 Ga0495686_0101788 3300047472 Bacteria 1732
202 Ga0496100_0039896 3300048903 Bacteria 2983
203 Ga0496102_0010757 3300048905 Bacteria 7880
204 Ga0496103_0008326 3300048906 Bacteria 6162
205 Ga0496104_0231206 3300048907 Bacteria 1761
206 Ga0496113_0045539 3300048916 Bacteria 3254
207 Ga0496113_0120303 3300048916 Bacteria 2052
208 Ga0496116_0000043 3300048919 Bacteria 328085
209 Ga0496116_0001006 3300048919 Bacteria 34404
210 Ga0496116_0004065 3300048919 Bacteria 14149
211 Ga0496116_0005431 3300048919 Bacteria 11825
212 Ga0496116_0013472 3300048919 Bacteria 6590
213 Ga0496116_0036529 3300048919 Bacteria 3435
214 Ga0496116_0186293 3300048919 Bacteria 1104
215 Ga0496117_0000002 3300048920 Bacteria 2483758
216 Ga0496117_0000353 3300048920 Bacteria 81061
217 Ga0496117_0026911 3300048920 Bacteria 4491
218 Ga0496117_0039731 3300048920 Bacteria 3468
219 Ga0496117_0052211 3300048920 Bacteria 2881
220 Ga0496117_0130651 3300048920 Bacteria 1523
221 Ga0496117_0185146 3300048920 Bacteria 1192
222 Ga0496118_0000204 3300048921 Bacteria 104260
223 Ga0496118_0000355 3300048921 Bacteria 77500
224 Ga0496118_0050550 3300048921 Bacteria 3188
225 Ga0496118_0068749 3300048921 Bacteria 2570
226 Ga0496118_0166674 3300048921 Bacteria 1353
227 Ga0496119_0004804 3300048922 Bacteria 13257
228 Ga0496119_0058483 3300048922 Bacteria 2323
229 Ga0496119_0063405 3300048922 Bacteria 2198
230 Ga0496119_0097382 3300048922 Bacteria 1658
231 Ga0496120_0001026 3300048923 Bacteria 37324
232 Ga0496120_0029376 3300048923 Bacteria 3356
233 Ga0496120_0037861 3300048923 Bacteria 2859
234 Ga0496120_0046749 3300048923 Bacteria 2499
235 Ga0496120_0143256 3300048923 Bacteria 1210
236 Ga0496121_0000001 3300048924 Bacteria 1830318
237 Ga0496121_0000363 3300048924 Bacteria 93101
238 Ga0496121_0000378 3300048924 Bacteria 91381
239 Ga0496121_0007058 3300048924 Bacteria 13639
240 Ga0496121_0024423 3300048924 Bacteria 5779
241 Ga0496121_0055231 3300048924 Bacteria 3310
242 Ga0496121_0076302 3300048924 Bacteria 2673
243 Ga0496121_0154664 3300048924 Bacteria 1684
244 Ga0496122_0000001 3300048925 Bacteria 1827766
245 Ga0496122_0000369 3300048925 Bacteria 96672
246 Ga0496122_0000525 3300048925 Bacteria 79294
247 Ga0496122_0027055 3300048925 Bacteria 4917
248 Ga0496122_0046119 3300048925 Bacteria 3379
249 Ga0496122_0046580 3300048925 Bacteria 3357
250 Ga0496122_0057575 3300048925 Bacteria 2885
251 Ga0496122_0062640 3300048925 Bacteria 2721
252 Ga0496122_0193556 3300048925 Bacteria 1197
253 Ga0496123_0000001 3300048926 Bacteria 1831497
254 Ga0496123_0000054 3300048926 Bacteria 234046
255 Ga0496123_0000448 3300048926 Bacteria 73842
256 Ga0496123_0038815 3300048926 Bacteria 3340
257 Ga0496123_0053999 3300048926 Bacteria 2649
258 Ga0496123_0082765 3300048926 Bacteria 1944
259 Ga0496124_0000112 3300048927 Bacteria 166282
260 Ga0496124_0000687 3300048927 Bacteria 55709
261 Ga0496124_0003536 3300048927 Bacteria 19010
262 Ga0496124_0020289 3300048927 Bacteria 6148
263 Ga0496124_0032627 3300048927 Bacteria 4594
264 Ga0496124_0039751 3300048927 Bacteria 4074
265 Ga0496124_0066354 3300048927 Bacteria 3005
266 Ga0496124_0113824 3300048927 Bacteria 2173
267 Ga0496124_0250524 3300048927 Bacteria 1310
268 Ga0496124_0274645 3300048927 Bacteria 1232
269 Ga0496125_0000001 3300048928 Bacteria 1766138
270 Ga0496125_0001127 3300048928 Bacteria 40785
271 Ga0496125_0022186 3300048928 Bacteria 5900
272 Ga0496125_0031484 3300048928 Bacteria 4727
273 Ga0496125_0041365 3300048928 Bacteria 3940
274 Ga0496126_0000362 3300048929 Bacteria 94734
275 Ga0496126_0001019 3300048929 Bacteria 47578
276 Ga0496126_0052978 3300048929 Bacteria 3684
277 Ga0496126_0173980 3300048929 Bacteria 1832
278 Ga0495678_021490 3300049459 Bacteria 2841
279 Ga0501033_0000167 3300049570 Bacteria 63051
280 Ga0501033_0035869 3300049570 Bacteria 3717
281 Ga0501036_0249012 3300049572 Bacteria 1489
282 Ga0501038_0118862 3300049574 Bacteria 2182
283 Ga0501043_0015861 3300049579 Bacteria 5905
284 Ga0501035_0000927 3300049822 Bacteria 31062
285 Ga0501035_0178189 3300049822 Bacteria 1832
286 Ga0501044_0507555 3300049823 Bacteria 1106
287 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
288 nmdc:mga00v17_728_c1 3300050491 Bacteria 17963
289 nmdc:mga00v17_8342_c1 3300050491 Bacteria 5575
290 nmdc:mga0yw44_281_c1 3300050492 Bacteria 17502
291 nmdc:mga0k408_25643_c1 3300050493 Bacteria 3340
292 nmdc:mga04h51_2829_c1 3300050495 Bacteria 4153
293 nmdc:mga07m45_62259_c1 3300050496 Bacteria 2114
294 nmdc:mga06r32_3526_c1 3300050510 Bacteria 13976
295 nmdc:mga0sz30_14999_c1 3300050516 Bacteria 3058
296 Ga0495601_0049414 3300053077 Bacteria 2652
297 Ga0500610_0009038 3300053079 Bacteria 4385
298 Ga0500557_030748 3300053105 Bacteria 1624
299 Ga0500569_002293 3300053109 Bacteria 3747
300 Ga0500594_0004119 3300053118 Bacteria 3204
301 Ga0500607_098473 3300053121 Bacteria 1457
302 Ga0500608_098345 3300053122 Bacteria 1358
303 Ga0500618_000569 3300053125 Bacteria 22814
304 Ga0500618_000744 3300053125 Bacteria 18532
305 Ga0500618_007837 3300053125 Bacteria 3017
306 Ga0500618_020250 3300053125 Bacteria 1630
307 Ga0500658_0077534 3300053134 Bacteria 1415
308 Ga0500561_0001002 3300053137 Bacteria 4529
309 Ga0500568_0003520 3300053139 Bacteria 8686
310 Ga0500573_0030647 3300053140 Bacteria 3102
311 Ga0500590_001701 3300053148 Bacteria 9215
312 Ga0500616_0001178 3300053153 Bacteria 26604
313 Ga0500616_0001219 3300053153 Bacteria 25876
314 Ga0500624_000862 3300053157 Bacteria 6678
315 Ga0500634_0000400 3300053161 Bacteria 13935
316 Ga0500634_0006874 3300053161 Bacteria 5548
317 Ga0500636_0000015 3300053177 Bacteria 123980
318 650740059 650716007 Bacteria 5573770
319 2509111409 2508501122 Bacteria 6292184
320 2509375652 2509276019 Bacteria 6802256
321 2510303277 2510065057 Bacteria 6649661
322 2510842796 2510461069 Bacteria 5505000
323 2511135226 2510917022 Bacteria 6504556
324 2511171659 2510917026 Bacteria 7046020
325 2511501985 2511231052 Bacteria 6974333
326 2512533354 2512047086 Bacteria 6850303
327 2512971079 2512875026 Bacteria 6861065
328 2513582618 2513237086 Bacteria 7265287
329 2513604564 2513237089 Bacteria 6553624
330 2513615480 2513237091 Bacteria 6900273
331 2513864776 2513237138 Bacteria 7368160
332 2513881269 2513237140 Bacteria 7076289
333 2513902400 2513237143 Bacteria 6664116
334 2513914124 2513237144 Bacteria 7530820
335 2513926052 2513237146 Bacteria 7166346
336 2513984580 2513237156 Bacteria 6402557
337 2513997052 2513237159 Bacteria 6810126
338 2514007617 2513237160 Bacteria 6650282
339 2515608778 2515154107 Bacteria 6795637
340 2516209721 2516143018 Bacteria 6951533
341 2516893281 2516653046 Bacteria 6989037
342 2517570037 2517487022 Bacteria 7227575
343 2524448818 2524023207 Bacteria 6813453
344 2524459384 2524023209 Bacteria 6679728
345 2537877618 2537561587 Bacteria 5425293
346 2551675141 2551306084 Bacteria 8942552
347 2551680533 2551306084 Bacteria 8942552
348 2551688066 2551306085 Bacteria 7347181
349 2551691124 2551306086 Bacteria 6843938
350 2551698597 2551306087 Bacteria 7351905
351 2551712031 2551306089 Bacteria 7162724
352 2551722496 2551306090 Bacteria 7953713
353 2551727870 2551306091 Bacteria 7086830
354 2551736524 2551306092 Bacteria 6992595
355 2551741794 2551306093 Bacteria 7064773
356 2554247670 2554235003 Bacteria 5877155
357 2554249133 2554235003 Bacteria 5877155
358 2558867967 2558860100 Bacteria 8458965
359 2559294803 2558860242 Bacteria 5568029
360 2585166149 2582581283 Bacteria 6030556
361 2585229880 2582581299 Bacteria 6518058
362 2585254886 2582581304 Bacteria 5831370
363 2585267648 2582581306 Bacteria 6450535
364 2585270963 2582581307 Bacteria 6597605
365 2585277312 2582581308 Bacteria 7413247
366 2585323515 2582581315 Bacteria 7318924
367 2585331650 2582581316 Bacteria 7774528
368 2585386707 2582581865 Bacteria 6644329
369 2585393063 2582581866 Bacteria 6859583
370 2585404378 2582581867 Bacteria 7184437
371 2585533952 2585427527 Bacteria 7273426
372 2585552197 2585427530 Bacteria 7383882
373 2585558687 2585427531 Bacteria 6992870
374 2585821922 2585427590 Bacteria 6824633
375 2585842993 2585427594 Bacteria 6180594
376 2585898052 2585427608 Bacteria 6544331
377 2585904343 2585427609 Bacteria 6667127
378 2585996037 2585427633 Bacteria 6413184
379 2586000641 2585427634 Bacteria 6455027
380 2587980540 2585428125 Bacteria 6662905
381 2599417528 2599185170 Bacteria 7295545
382 2599604070 2599185210 Bacteria 5624189
383 2600195653 2599185352 Bacteria 7228948
384 2600375694 2600254933 Bacteria 4750527
385 2601608198 2600255279 Bacteria 5605316
386 2601744972 2600255308 Bacteria 5611129
387 2616308692 2615840626 Bacteria 7921970
388 2616557005 2615840698 Bacteria 7319877
389 2617385788 2617270742 Bacteria 6808054
390 2643803561 2643221557 Bacteria 7184309
391 2643811641 2643221558 Bacteria 5460675
392 2643855599 2643221568 Bacteria 5187270
393 2643919291 2643221582 Bacteria 5804683
394 2644003889 2643221599 Bacteria 6292121
395 2644050718 2643221607 Bacteria 6314006
396 2644067528 2643221610 Bacteria 7480339
397 2644107677 2643221618 Bacteria 7717186
398 2644148652 2643221626 Bacteria 8069654
399 2644192585 2643221634 Bacteria 6705461
400 2644205192 2643221636 Bacteria 6583769
401 2644239695 2643221643 Bacteria 5749658
402 2644298419 2643221653 Bacteria 4569637
403 2644309071 2643221655 Bacteria 7722067
404 2644332899 2643221659 Bacteria 7890716
405 2644375208 2643221668 Bacteria 7306521
406 2644418581 2643221675 Bacteria 7473456
407 2644451948 2643221680 Bacteria 7473610
408 2644483636 2643221686 Bacteria 6310811
409 2644491811 2643221688 Bacteria 5260751
410 2644501364 2643221689 Bacteria 6042950
411 2644522196 2643221693 Bacteria 5513853
412 2644545929 2643221698 Bacteria 7756764
413 2644615013 2643221712 Bacteria 7729434
414 2644656648 2643221719 Bacteria 4568197
415 2644676549 2643221723 Bacteria 7095460
416 2644690710 2643221726 Bacteria 7455827
417 2671111611 2667528174 Bacteria 6435400
418 2692315822 2690316117 Bacteria 6800650
419 2738804194 2738541293 Bacteria 7065685
420 2753461885 2751185821 Bacteria 6189929
421 2778174125 2775507266 Bacteria 7392367
422 2792581711 2791355082 Bacteria 5973319
423 2792620185 2791355091 Bacteria 6135441
424 2792626395 2791355092 Bacteria 6248105
425 2792639342 2791355094 Bacteria 7011481
426 2802719532 2802428858 Bacteria 6636079
427 2802726875 2802428859 Bacteria 6667919
428 2802732266 2802428860 Bacteria 6525526
429 2802739869 2802428861 Bacteria 6534206
430 2802745375 2802428862 Bacteria 6633353
431 2802752767 2802428863 Bacteria 6410669
432 2804752435 2802429268 Bacteria 6094027
433 2808985426 2808606387 Bacteria 5697198
434 2819241720 2818991272 Bacteria 4622173
435 2819559860 2818991439 Bacteria 6907412
436 2819608972 2818991448 Bacteria 6772224
437 2819637799 2818991453 Bacteria 7181617
438 2819684760 2818991461 Bacteria 7026071
439 2821129459 2821123053 Bacteria 7836056
440 2838029982 2838029111 Bacteria 6603031
441 2838038259 2838035591 Bacteria 7166484
442 2838079567 2838074704 Bacteria 6785777
443 2838661864 2838661181 Bacteria 7385261
444 2838715157 2838714209 Bacteria 5525906
445 2838721043 2838719591 Bacteria 5523910
446 2838725915 2838724970 Bacteria 4908691
447 2838738508 2838736955 Bacteria 5760694
448 2841841123 2841840854 Bacteria 5761912
449 2841848002 2841846520 Bacteria 5345850
450 2841859447 2841859092 Bacteria 5436171
451 2842125968 2842124991 Bacteria 5346824
452 2842131168 2842130223 Bacteria 4909145
453 2842140901 2842140634 Bacteria 5759631
454 2842153662 2842152218 Bacteria 4908957
455 2842171400 2842170452 Bacteria 5525737
456 2842177282 2842175837 Bacteria 4908771
457 2842188265 2842187318 Bacteria 5524014
458 2842212576 2842211629 Bacteria 5523832
459 2842225805 2842224351 Bacteria 5524473
460 2842301925 2842298080 Bacteria 6123127
461 2842357609 2842357229 Bacteria 6485165
462 2842476733 2842475841 Bacteria 6603183
463 2842484728 2842482326 Bacteria 7212537
464 2842503510 2842502639 Bacteria 6604161
465 2842511317 2842509118 Bacteria 6850950
466 2842516231 2842515876 Bacteria 5436280
467 2842522706 2842521101 Bacteria 6569494
468 2842923994 2842922631 Bacteria 5824079
469 2844167776 2844163670 Bacteria 7266046
470 2847419114 2847417321 Bacteria 6913799
471 2848994143 2848992105 Bacteria 6810864
472 2850081173 2850079185 Bacteria 6848280
473 2852390016 2852387548 Bacteria 8025568
474 2854899368 2854896431 Bacteria 5869725
475 2855826004 2855825444 Bacteria 6785811
476 2855841349 2855839649 Bacteria 7135830
477 2855876786 2855872281 Bacteria 6964271
478 2857535138 2857531043 Bacteria 6754041
479 2858802336 2858800743 Bacteria 6603254
480 2891373178 2891373044 Bacteria 5202277
481 2896384874 2896384573 Bacteria 7700774
482 2899796244 2899792073 Bacteria 4926588
483 2899847399 2899845264 Bacteria 5672268
484 2913300823 2913295892 Bacteria 6333755
485 2915981874 2915980308 Bacteria 6624279
486 2915991325 2915986958 Bacteria 6739310
487 2915994349 2915993759 Bacteria 7016183
488 2916004370 2916000859 Bacteria 6865702
489 2916008134 2916007675 Bacteria 6898660
490 2916015073 2916014648 Bacteria 6946486
491 2916024220 2916021584 Bacteria 6854472
492 2916031752 2916028427 Bacteria 6748433
493 2916041286 2916035215 Bacteria 6755766
494 2916045220 2916041962 Bacteria 6820487
495 2916052292 2916048683 Bacteria 6543552
496 2916056421 2916055098 Bacteria 6758838
497 2916067560 2916061851 Bacteria 6737736
498 2916072314 2916068649 Bacteria 6943657
499 2919115247 2919114240 Bacteria 5700270
500 2919167636 2919166419 Bacteria 4952238
501 2919174949 2919171160 Bacteria 6499771
502 2919411582 2919408235 Bacteria 6149349
503 2920765773 2920760137 Bacteria 7427611
504 2920824749 2920822456 Bacteria 6897201
505 2921205150 2921201388 Bacteria 6926299
506 2921209549 2921208531 Bacteria 6745326
507 2921240739 2921237296 Bacteria 6876710
508 2921244650 2921244191 Bacteria 6568419
509 2921251157 2921250672 Bacteria 6677771
510 2921258648 2921257292 Bacteria 6808382
511 2921265100 2921263974 Bacteria 6864552
512 2921283511 2921282425 Bacteria 6826397
513 2921296309 2921289301 Bacteria 7316391
514 2921300883 2921296804 Bacteria 7176999
515 2924147114 2924144063 Bacteria 6883928
516 2924155242 2924150972 Bacteria 7169444
517 2924160779 2924158325 Bacteria 7188855
518 2924167357 2924165586 Bacteria 7260590
519 2924178998 2924172951 Bacteria 6749356
520 2924184086 2924179722 Bacteria 6843264
521 2924189053 2924186466 Bacteria 6876637
522 2924194780 2924193448 Bacteria 6955718
523 2924203372 2924200457 Bacteria 6757188
524 2924208847 2924207177 Bacteria 6917007
525 2924215159 2924214083 Bacteria 7080103
526 2924226524 2924221636 Bacteria 7113495
527 2924229934 2924228884 Bacteria 6633132
528 2926756295 2926754445 Bacteria 5964435
529 2926760517 2926760298 Bacteria 5505990
530 2929139847 2929138655 Bacteria 5810547
531 2933008309 2933006813 Bacteria 4912075
532 2933013126 2933011516 Bacteria 5439334
533 2933018123 2933016740 Bacteria 6355406
534 2933597816 2933594066 Bacteria 5594265
535 2936998107 2936996657 Bacteria 6298727
536 2937005080 2937002841 Bacteria 6934057
537 2937012192 2937009748 Bacteria 6746052
538 2937018649 2937016420 Bacteria 6782579
539 2937028988 2937023124 Bacteria 6815156
540 2937031292 2937029754 Bacteria 6424026
541 2937038567 2937036028 Bacteria 6846469
542 2937047338 2937042894 Bacteria 6741576
543 2937050933 2937049772 Bacteria 6757901
544 2937061528 2937056579 Bacteria 7107896
545 2937065213 2937063883 Bacteria 7199456
546 2937073064 2937071275 Bacteria 6984483
547 2937079813 2937078374 Bacteria 6610289
548 2937088276 2937084907 Bacteria 6618516
549 2937097604 2937091812 Bacteria 6979387
550 2937099551 2937098957 Bacteria 7249374
551 2937110024 2937106411 Bacteria 6947143
552 2937116253 2937113482 Bacteria 6505872
553 2937123063 2937119839 Bacteria 6597547
554 2937128724 2937126314 Bacteria 6771275
555 2941504946 2941499720 Bacteria 7599444
556 2957376600 2957375807 Bacteria 6425588
557 2957384818 2957382221 Bacteria 6737050
558 2957394861 2957388812 Bacteria 6778072
559 2957398254 2957395598 Bacteria 6822399
560 2957403190 2957402308 Bacteria 6741770
561 2957411583 2957408893 Bacteria 6558585
562 2957418307 2957415311 Bacteria 6991633
563 2957426605 2957422303 Bacteria 7172205
564 2957432815 2957430029 Bacteria 7022557
565 2957441280 2957437181 Bacteria 6568994
566 2957455985 2957450854 Bacteria 6765715
567 2957459904 2957457609 Bacteria 6967680
568 2957466008 2957464669 Bacteria 6568877
569 2957477103 2957471148 Bacteria 6797643
570 2957479203 2957478035 Bacteria 6756658
571 2957486272 2957484790 Bacteria 6703082
572 2957498023 2957491536 Bacteria 6695180
573 2957507641 2957505466 Bacteria 7253085
574 2960584319 2960584000 Bacteria 6864594
575 2960592701 2960591022 Bacteria 6622873
576 2960602671 2960597568 Bacteria 6550735
577 2960605950 2960603979 Bacteria 6898737
578 2960612436 2960610863 Bacteria 6691244
579 2960619998 2960617483 Bacteria 6727748
580 2960630908 2960624210 Bacteria 6875384
581 2960632818 2960631154 Bacteria 6732508
582 2960639167 2960637947 Bacteria 7296468
583 2960650521 2960645483 Bacteria 7211087
584 2960660023 2960652885 Bacteria 7083688
585 2960660834 2960660292 Bacteria 7041660
586 2960670982 2960667422 Bacteria 6763020
587 2960679035 2960674078 Bacteria 6609048
588 2960681875 2960680706 Bacteria 6624464
589 2960689966 2960687367 Bacteria 6535474
590 2960694268 2960693952 Bacteria 6749742
591 2964609179 2964607997 Bacteria 7101408
592 2964616592 2964615318 Bacteria 6809089
593 2964622566 2964621998 Bacteria 6834995
594 2964635787 2964628898 Bacteria 7083044
595 2964640963 2964636051 Bacteria 7091832
596 2964649489 2964643177 Bacteria 6820887
597 2964651770 2964649959 Bacteria 6675118
598 2964660995 2964656573 Bacteria 7100150
599 2964667060 2964663802 Bacteria 7019362
600 2964677517 2964670856 Bacteria 6851364
601 2964684107 2964678106 Bacteria 6792020
602 2964686480 2964685014 Bacteria 6839111
603 2964698106 2964691889 Bacteria 6802758
604 2964702306 2964698721 Bacteria 6765331
605 2964711860 2964705432 Bacteria 7114648
606 2964716755 2964712639 Bacteria 6695970
607 2964723906 2964719344 Bacteria 7286602
608 2967664711 2967664464 Bacteria 6948836
609 2967674455 2967671571 Bacteria 7021409
610 2967681841 2967678726 Bacteria 7264382
611 2967690791 2967686174 Bacteria 6678622
612 2967695238 2967693043 Bacteria 6804451
613 2967700813 2967699805 Bacteria 6854538
614 2967713299 2967706974 Bacteria 7186053
615 2967716677 2967714385 Bacteria 7000047
616 2967721678 2967721400 Bacteria 7073753
617 2967734999 2967728569 Bacteria 6641507
618 2967736876 2967735183 Bacteria 6827012
619 2967745740 2967742019 Bacteria 6794534
620 2967755497 2967748971 Bacteria 6733771
621 2967758765 2967755722 Bacteria 6814706
622 2967765395 2967762386 Bacteria 6923502
623 2967775673 2967769361 Bacteria 6587838
624 2967782276 2967775926 Bacteria 6738189
625 2970026503 2970019648 Bacteria 7072033
626 2970030995 2970026789 Bacteria 6785236
627 2970039737 2970033650 Bacteria 7118744
628 2970046728 2970040964 Bacteria 6731123
629 2970054437 2970047711 Bacteria 7088379
630 2970057796 2970054988 Bacteria 6611507
631 2970066713 2970061556 Bacteria 7099761
632 2970072984 2970068827 Bacteria 7123112
633 2970077474 2970076120 Bacteria 6697332
634 2970086181 2970082768 Bacteria 6183754
635 2970091157 2970088815 Bacteria 6933825
636 2970100668 2970095765 Bacteria 6936963
637 2970107515 2970102677 Bacteria 6812532
638 2970110850 2970109326 Bacteria 6863976
639 2970122149 2970116247 Bacteria 6501857
640 2970122996 2970122695 Bacteria 6625855
641 2970131700 2970129317 Bacteria 6806560
642 2970142513 2970136068 Bacteria 7207982
643 2970144084 2970143518 Bacteria 6446480
644 2970154240 2970149975 Bacteria 6779706
645 2970160201 2970156795 Bacteria 7168044
646 2970167138 2970164137 Bacteria 6861252
647 2970173268 2970170962 Bacteria 6876229
648 2970180305 2970177841 Bacteria 6768001
649 2970187595 2970184632 Bacteria 7054431
650 2970193352 2970191845 Bacteria 7032787
651 2977522387 2977516862 Bacteria 6940108
652 2977529027 2977523885 Bacteria 6960446
653 2977531685 2977530762 Bacteria 6951399
654 2977540548 2977537788 Bacteria 6929320
655 2977549100 2977544691 Bacteria 6875412
656 2977554402 2977551784 Bacteria 7125765
657 2977559743 2977558990 Bacteria 6863948
658 2977572244 2977565890 Bacteria 6901543
659 2977575305 2977572785 Bacteria 6763888
660 2977580190 2977579622 Bacteria 6772100
661 2978974087 2978969890 Bacteria 5400756
662 2979094203 2979089926 Bacteria 5670289
663 2979094873 2979089926 Bacteria 5670289
664 2979097753 2979095461 Bacteria 5669583
665 2979098415 2979095461 Bacteria 5669583
666 2979106207 2979100975 Bacteria 5423623
667 2984511997 2984509177 Bacteria 5274802
668 2984521642 2984518228 Bacteria 5277463
669 2984540937 2984537506 Bacteria 5277481
670 2984589416 2984587000 Bacteria 5263363
671 2984603198 2984601300 Bacteria 5455244
672 2989349438 2989349275 Bacteria 6349068
673 2989774960 2989771324 Bacteria 5605128
674 2989778947 2989776772 Bacteria 4843317
675 3003933798 3003930520 Bacteria 5667563
676 3005419995 3005416602 Bacteria 7064308
677 3005454370 3005452660 Bacteria 5889319
678 643826003 643692032 Bacteria 6891900
679 648739573 648276728 Bacteria 6968865
680 8003571056 8003570095 Bacteria 5747666
681 8003993864 8003992118 Bacteria 7266902
682 8004001409 8003999396 Bacteria 7063185
683 8005248500 8005246636 Bacteria 4933972
684 8005316946 8005314921 Bacteria 7072929
685 8005485256 8005484373 Bacteria 6297373
686 8005649759 8005645114 Bacteria 6950293
687 8005659642 8005658619 Bacteria 4500593
688 8005683075 8005682033 Bacteria 6726518
689 8018151478 8018150411 Bacteria 5549903
690 8024492150 8024486573 Bacteria 6540512
691 8046770423 8046767195 Bacteria 7547379
692 8049295006 8049293176 Bacteria 6128433
693 8054462289 8054460903 Bacteria 4872905
694 8054560278 8054558443 Bacteria 5204801
695 8055435077 8055431914 Bacteria 4551896
696 8057575928 8057575449 Bacteria 7367519
697 JGI24740J21852_10000033
698 JGI25155J39150_1000001
699 JGI25156J39149_1000001
700 JGI25162J39368_1000209
701 JGI25154J39366_1000011
702 JGI25157J39369_1000030
703 JGI25152J39213_1001321
704 JGI25150J39212_1000409
705 JGI25150J39212_1000439
706 JGI25159J45721_1000020
707 JGI25159J45721_1000530
708 JGI25151J46595_10000083
709 JGI25151J46595_10005174
710 JGI25151J46595_10014023
711 JGI25151J46595_10018587
712 JGI25165J46597_1000302
713 JGI25165J46597_1000682
714 JGI25165J46597_1008351
715 JGI25153J46596_10000210
716 rootH2_10062869
717 rootL2_10044579
718 rootH1_10117726
719 JGI25160J50197_1000055
720 JGI25160J50197_1000087
721 JGI25161J50226_1000066
722 JGI25161J50226_1000374
723 JGI25161J50226_1003621
724 Ga0055526_1000508
725 Ga0055524_1000319
726 Ga0055536_1007640
727 Ga0055536_1008572
728 Ga0055528_1000358
729 Ga0055530_10011096
730 Ga0055540_1002260
731 Ga0055531_10001342
732 Ga0058692_1001657
733 Ga0055543_1000068
734 Ga0055543_1000240
735 Ga0065165_1000839
736 Ga0065165_1001002
737 Ga0065165_1003362
738 Ga0070658_10434436
739 Ga0070670_100013849
740 Ga0070665_100071267
741 Ga0070665_100329624
742 Ga0070664_100543975
743 Ga0068852_100388732
744 Ga0075365_10032679
745 Ga0075368_10007710
746 Ga0075362_10005100
747 Ga0075366_10033148
748 Ga0075370_10090400
749 Ga0075428_100017904
750 Ga0075431_100019285
751 Ga0099826_10000184
752 Ga0105240_10000005
753 Ga0105243_10016141
754 Ga0105243_10117627
755 Ga0105237_10000766
756 Ga0105239_10001069
757 Ga0157373_10007546
758 Ga0157373_10025926
759 Ga0157371_10000015
760 Ga0157371_10023587
761 Ga0157370_10000046
762 Ga0157370_10001762
763 Ga0157369_10011018
764 Ga0157369_10041214
765 Ga0157369_10598548
766 Ga0157378_10409018
767 Ga0182008_10035258
768 Ga0182007_10005374
769 Ga0183363_1276
770 Ga0214542_1001614
771 Ga0214543_1000078
772 Ga0214543_1001395
773 Ga0228711_1000016
774 Ga0228710_1000013
775 Ga0209435_100012
776 Ga0209436_105532
777 Ga0209672_103025
778 Ga0209563_102861
779 Ga0209437_100047
780 Ga0209437_100165
781 Ga0209437_105595
782 Ga0207425_1000024
783 Ga0209646_1000026
784 Ga0209026_1000014
785 Ga0209677_100656
786 Ga0209759_1000012
787 Ga0209129_1000161
788 Ga0209129_1000184
789 Ga0209233_1000048
790 Ga0209233_1000069
791 Ga0209233_1000257
792 Ga0209455_1011076
793 Ga0209673_1000010
794 Ga0209673_1008200
795 Ga0209130_1000021
796 Ga0209130_1000026
797 Ga0209130_1008956
798 Ga0209025_1000050
799 Ga0209025_1000094
800 Ga0209025_1000119
801 Ga0209025_1000767
802 Ga0209025_1011121
803 Ga0209025_1023772
804 Ga0209025_1057261
805 Ga0209564_1000208
806 Ga0209564_1007273
807 Ga0209758_1000083
808 Ga0209758_1000418
809 Ga0209050_1007130
810 Ga0209050_1009774
811 Ga0209256_1000042
812 Ga0209256_1002161
813 Ga0207426_1000006
814 Ga0207426_1000010
815 Ga0209051_1000482
816 Ga0209257_1001560
817 Ga0209257_1004267
818 Ga0207695_10000011
819 Ga0207671_10000241
820 Ga0207650_10001517
821 Ga0207709_10122485
822 Ga0209281_1000036
823 Ga0209281_1000047
824 Ga0209281_1000221
825 Ga0209281_1000453
826 Ga0209371_1000021
827 Ga0209371_1001579
828 Ga0209371_1004293
829 Ga0209371_1013229
830 Ga0209282_1000041
831 Ga0209282_1003765
832 Ga0209813_10002676
833 Ga0268266_10231163
834 Ga0307515_10000023
835 Ga0268256_1000020
836 Ga0268256_1004089
837 Ga0268256_1007091
838 Ga0268256_1017617
839 Ga0316182_1023026
840 Ga0307513_10003030
841 Ga0307405_10015711
842 Ga0307410_10326702
843 Ga0307412_10007804
844 Ga0307412_10217805
845 Ga0315914_1000030
846 Ga0307409_100035811
847 Ga0307414_10100624
848 Ga0307414_10376599
849 Ga0315913_1000017
850 Ga0315915_1000017
851 Ga0373927_0000178
852 Ga0373925_0005414
853 Ga0439466_0068615
854 Ga0439465_0013292
855 Ga0439465_0017025
856 Ga0439449_0022039
857 Ga0450906_021326
858 Ga0439434_0061724
859 Ga0450918_004163
860 Ga0466963_0016488
861 Ga0466971_0079692
862 Ga0466968_0083900
863 Ga0466970_0006941
864 Ga0466957_0076006
865 Ga0466958_0021197
866 Ga0466967_0317764
867 Ga0495638_0000638
868 Ga0495605_0002606
869 Ga0495585_0155436
870 Ga0495607_0087235
871 Ga0495583_0019044
872 Ga0495606_0001613
873 Ga0495610_0020563
874 Ga0495616_0039950
875 Ga0495620_0019205
876 Ga0495628_0122289
877 Ga0495631_0008540
878 Ga0495632_0020569
879 Ga0495643_0024984
880 Ga0495643_0026352
881 Ga0495652_0248275
882 Ga0495654_0000090
883 Ga0495633_0032538
884 Ga0495625_0001863
885 Ga0495625_0078944
886 Ga0495625_0102713
887 Ga0495588_0003082
888 Ga0495658_0043835
889 Ga0495670_0068029
890 Ga0495600_0064586
891 Ga0495660_0112038
892 Ga0495604_0020662
893 Ga0495636_0029347
894 Ga0495672_0060834
895 Ga0495681_0015571
896 Ga0495686_0029245
897 Ga0495686_0101788
898 Ga0496100_0039896
899 Ga0496102_0010757
900 Ga0496103_0008326
901 Ga0496104_0231206
902 Ga0496113_0045539
903 Ga0496113_0120303
904 Ga0496116_0000043
905 Ga0496116_0001006
906 Ga0496116_0004065
907 Ga0496116_0005431
908 Ga0496116_0013472
909 Ga0496116_0036529
910 Ga0496116_0186293
911 Ga0496117_0000002
912 Ga0496117_0000353
913 Ga0496117_0026911
914 Ga0496117_0039731
915 Ga0496117_0052211
916 Ga0496117_0130651
917 Ga0496117_0185146
918 Ga0496118_0000204
919 Ga0496118_0000355
920 Ga0496118_0050550
921 Ga0496118_0068749
922 Ga0496118_0166674
923 Ga0496119_0004804
924 Ga0496119_0058483
925 Ga0496119_0063405
926 Ga0496119_0097382
927 Ga0496120_0001026
928 Ga0496120_0029376
929 Ga0496120_0037861
930 Ga0496120_0046749
931 Ga0496120_0143256
932 Ga0496121_0000001
933 Ga0496121_0000363
934 Ga0496121_0000378
935 Ga0496121_0007058
936 Ga0496121_0024423
937 Ga0496121_0055231
938 Ga0496121_0076302
939 Ga0496121_0154664
940 Ga0496122_0000001
941 Ga0496122_0000369
942 Ga0496122_0000525
943 Ga0496122_0027055
944 Ga0496122_0046119
945 Ga0496122_0046580
946 Ga0496122_0057575
947 Ga0496122_0062640
948 Ga0496122_0193556
949 Ga0496123_0000001
950 Ga0496123_0000054
951 Ga0496123_0000448
952 Ga0496123_0038815
953 Ga0496123_0053999
954 Ga0496123_0082765
955 Ga0496124_0000112
956 Ga0496124_0000687
957 Ga0496124_0003536
958 Ga0496124_0020289
959 Ga0496124_0032627
960 Ga0496124_0039751
961 Ga0496124_0066354
962 Ga0496124_0113824
963 Ga0496124_0250524
964 Ga0496124_0274645
965 Ga0496125_0000001
966 Ga0496125_0001127
967 Ga0496125_0022186
968 Ga0496125_0031484
969 Ga0496125_0041365
970 Ga0496126_0000362
971 Ga0496126_0001019
972 Ga0496126_0052978
973 Ga0496126_0173980
974 Ga0495678_021490
975 Ga0501033_0000167
976 Ga0501033_0035869
977 Ga0501036_0249012
978 Ga0501038_0118862
979 Ga0501043_0015861
980 Ga0501035_0000927
981 Ga0501035_0178189
982 Ga0501044_0507555
983 nmdc:mga00v17_6_c1
984 nmdc:mga00v17_728_c1
985 nmdc:mga00v17_8342_c1
986 nmdc:mga0yw44_281_c1
987 nmdc:mga0k408_25643_c1
988 nmdc:mga04h51_2829_c1
989 nmdc:mga07m45_62259_c1
990 nmdc:mga06r32_3526_c1
991 nmdc:mga0sz30_14999_c1
992 Ga0495601_0049414
993 Ga0500610_0009038
994 Ga0500557_030748
995 Ga0500569_002293
996 Ga0500594_0004119
997 Ga0500607_098473
998 Ga0500608_098345
999 Ga0500618_000569
1000 Ga0500618_000744
1001 Ga0500618_007837
1002 Ga0500618_020250
1003 Ga0500658_0077534
1004 Ga0500561_0001002
1005 Ga0500568_0003520
1006 Ga0500573_0030647
1007 Ga0500590_001701
1008 Ga0500616_0001178
1009 Ga0500616_0001219
1010 Ga0500624_000862
1011 Ga0500634_0000400
1012 Ga0500634_0006874
1013 Ga0500636_0000015
1014 650740059
1015 2509111409
1016 2509375652
1017 2510303277
1018 2510842796
1019 2511135226
1020 2511171659
1021 2511501985
1022 2512533354
1023 2512971079
1024 2513582618
1025 2513604564
1026 2513615480
1027 2513864776
1028 2513881269
1029 2513902400
1030 2513914124
1031 2513926052
1032 2513984580
1033 2513997052
1034 2514007617
1035 2515608778
1036 2516209721
1037 2516893281
1038 2517570037
1039 2524448818
1040 2524459384
1041 2537877618
1042 2551675141
1043 2551680533
1044 2551688066
1045 2551691124
1046 2551698597
1047 2551712031
1048 2551722496
1049 2551727870
1050 2551736524
1051 2551741794
1052 2554247670
1053 2554249133
1054 2558867967
1055 2559294803
1056 2585166149
1057 2585229880
1058 2585254886
1059 2585267648
1060 2585270963
1061 2585277312
1062 2585323515
1063 2585331650
1064 2585386707
1065 2585393063
1066 2585404378
1067 2585533952
1068 2585552197
1069 2585558687
1070 2585821922
1071 2585842993
1072 2585898052
1073 2585904343
1074 2585996037
1075 2586000641
1076 2587980540
1077 2599417528
1078 2599604070
1079 2600195653
1080 2600375694
1081 2601608198
1082 2601744972
1083 2616308692
1084 2616557005
1085 2617385788
1086 2643803561
1087 2643811641
1088 2643855599
1089 2643919291
1090 2644003889
1091 2644050718
1092 2644067528
1093 2644107677
1094 2644148652
1095 2644192585
1096 2644205192
1097 2644239695
1098 2644298419
1099 2644309071
1100 2644332899
1101 2644375208
1102 2644418581
1103 2644451948
1104 2644483636
1105 2644491811
1106 2644501364
1107 2644522196
1108 2644545929
1109 2644615013
1110 2644656648
1111 2644676549
1112 2644690710
1113 2671111611
1114 2692315822
1115 2738804194
1116 2753461885
1117 2778174125
1118 2792581711
1119 2792620185
1120 2792626395
1121 2792639342
1122 2802719532
1123 2802726875
1124 2802732266
1125 2802739869
1126 2802745375
1127 2802752767
1128 2804752435
1129 2808985426
1130 2819241720
1131 2819559860
1132 2819608972
1133 2819637799
1134 2819684760
1135 2821129459
1136 2838029982
1137 2838038259
1138 2838079567
1139 2838661864
1140 2838715157
1141 2838721043
1142 2838725915
1143 2838738508
1144 2841841123
1145 2841848002
1146 2841859447
1147 2842125968
1148 2842131168
1149 2842140901
1150 2842153662
1151 2842171400
1152 2842177282
1153 2842188265
1154 2842212576
1155 2842225805
1156 2842301925
1157 2842357609
1158 2842476733
1159 2842484728
1160 2842503510
1161 2842511317
1162 2842516231
1163 2842522706
1164 2842923994
1165 2844167776
1166 2847419114
1167 2848994143
1168 2850081173
1169 2852390016
1170 2854899368
1171 2855826004
1172 2855841349
1173 2855876786
1174 2857535138
1175 2858802336
1176 2891373178
1177 2896384874
1178 2899796244
1179 2899847399
1180 2913300823
1181 2915981874
1182 2915991325
1183 2915994349
1184 2916004370
1185 2916008134
1186 2916015073
1187 2916024220
1188 2916031752
1189 2916041286
1190 2916045220
1191 2916052292
1192 2916056421
1193 2916067560
1194 2916072314
1195 2919115247
1196 2919167636
1197 2919174949
1198 2919411582
1199 2920765773
1200 2920824749
1201 2921205150
1202 2921209549
1203 2921240739
1204 2921244650
1205 2921251157
1206 2921258648
1207 2921265100
1208 2921283511
1209 2921296309
1210 2921300883
1211 2924147114
1212 2924155242
1213 2924160779
1214 2924167357
1215 2924178998
1216 2924184086
1217 2924189053
1218 2924194780
1219 2924203372
1220 2924208847
1221 2924215159
1222 2924226524
1223 2924229934
1224 2926756295
1225 2926760517
1226 2929139847
1227 2933008309
1228 2933013126
1229 2933018123
1230 2933597816
1231 2936998107
1232 2937005080
1233 2937012192
1234 2937018649
1235 2937028988
1236 2937031292
1237 2937038567
1238 2937047338
1239 2937050933
1240 2937061528
1241 2937065213
1242 2937073064
1243 2937079813
1244 2937088276
1245 2937097604
1246 2937099551
1247 2937110024
1248 2937116253
1249 2937123063
1250 2937128724
1251 2941504946
1252 2957376600
1253 2957384818
1254 2957394861
1255 2957398254
1256 2957403190
1257 2957411583
1258 2957418307
1259 2957426605
1260 2957432815
1261 2957441280
1262 2957455985
1263 2957459904
1264 2957466008
1265 2957477103
1266 2957479203
1267 2957486272
1268 2957498023
1269 2957507641
1270 2960584319
1271 2960592701
1272 2960602671
1273 2960605950
1274 2960612436
1275 2960619998
1276 2960630908
1277 2960632818
1278 2960639167
1279 2960650521
1280 2960660023
1281 2960660834
1282 2960670982
1283 2960679035
1284 2960681875
1285 2960689966
1286 2960694268
1287 2964609179
1288 2964616592
1289 2964622566
1290 2964635787
1291 2964640963
1292 2964649489
1293 2964651770
1294 2964660995
1295 2964667060
1296 2964677517
1297 2964684107
1298 2964686480
1299 2964698106
1300 2964702306
1301 2964711860
1302 2964716755
1303 2964723906
1304 2967664711
1305 2967674455
1306 2967681841
1307 2967690791
1308 2967695238
1309 2967700813
1310 2967713299
1311 2967716677
1312 2967721678
1313 2967734999
1314 2967736876
1315 2967745740
1316 2967755497
1317 2967758765
1318 2967765395
1319 2967775673
1320 2967782276
1321 2970026503
1322 2970030995
1323 2970039737
1324 2970046728
1325 2970054437
1326 2970057796
1327 2970066713
1328 2970072984
1329 2970077474
1330 2970086181
1331 2970091157
1332 2970100668
1333 2970107515
1334 2970110850
1335 2970122149
1336 2970122996
1337 2970131700
1338 2970142513
1339 2970144084
1340 2970154240
1341 2970160201
1342 2970167138
1343 2970173268
1344 2970180305
1345 2970187595
1346 2970193352
1347 2977522387
1348 2977529027
1349 2977531685
1350 2977540548
1351 2977549100
1352 2977554402
1353 2977559743
1354 2977572244
1355 2977575305
1356 2977580190
1357 2978974087
1358 2979094203
1359 2979094873
1360 2979097753
1361 2979098415
1362 2979106207
1363 2984511997
1364 2984521642
1365 2984540937
1366 2984589416
1367 2984603198
1368 2989349438
1369 2989774960
1370 2989778947
1371 3003933798
1372 3005419995
1373 3005454370
1374 643826003
1375 648739573
1376 8003571056
1377 8003993864
1378 8004001409
1379 8005248500
1380 8005316946
1381 8005485256
1382 8005649759
1383 8005659642
1384 8005683075
1385 8018151478
1386 8024492150
1387 8046770423
1388 8049295006
1389 8054462289
1390 8054560278
1391 8055435077
1392 8057575928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

26

325

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8368 58 296
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.7948 28 303
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.7725 58 296
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7573 25 302
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.6978 28 303
ID Description Score Start End Superfamily
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6823 128 243 3.40.50.2000
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.661 121 243 3.40.1010.10
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6343 127 243 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6179 127 243 3.40.50.2000
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6087 121 243 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A5Q0C9P8-F1-model_v4 Lipid A biosynthesis lauroyl acyltransferase 0.9902 1 310 GO:0005886
GO:0009247
GO:0016746
AF-A0A5Q0C9P8-F1-model_v4 Lipid A biosynthesis lauroyl acyltransferase 0.9871 1 310 GO:0005886
GO:0009247
GO:0016746
AF-A0A531KZV1-F1-model_v4 Lipid A biosynthesis lauroyl acyltransferase 0.9846 136 304 GO:0005886
GO:0009247
GO:0016746
AF-A0A0M4LH35-F1-model_v4 Lipid A biosynthesis lauroyl acyltransferase 0.9832 47 304 GO:0005886
GO:0009247
GO:0016746
AF-A0A0Q6RXK9-F1-model_v4 Lipid A biosynthesis lauroyl acyltransferase 0.9827 4 309 GO:0005886
GO:0009247
GO:0016746

Map