F475939
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 260 | 698 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_101060126|Ga0070660_1010601261 |
| Length | 158 |
| Sequence | LSMSLQCLFSVPDRARNAEDSVCHMELRMSARPKSKASASRKDDIIIPEKLYFRIGEVSTLCKLPAYVLRFWETEFPQLKPVKSSTGQRMYRRKEVETVLRIKQLLYDEGFTIAGARQQLRVENKTQAPLPFPTHSTGELKRLRHGLEEILTILSPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 110 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 184 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 1.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.59 |
| Rhizosphere | 92.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000091 | 3300000546 | Bacteria | 13390 |
| 2 | Ga0058862_10022584 | 3300004803 | Unclassified | 585 |
| 3 | Ga0065715_10944818 | 3300005293 | Bacteria | 539 |
| 4 | Ga0070676_10342775 | 3300005328 | Unclassified | 1025 |
| 5 | Ga0070683_100041890 | 3300005329 | Bacteria | 4215 |
| 6 | Ga0070683_100055107 | 3300005329 | Bacteria | 3689 |
| 7 | Ga0070683_100166343 | 3300005329 | Bacteria | 2093 |
| 8 | Ga0070683_100421325 | 3300005329 | Bacteria | 1274 |
| 9 | Ga0070683_101134526 | 3300005329 | Bacteria | 751 |
| 10 | Ga0070690_100089419 | 3300005330 | Bacteria | 2026 |
| 11 | Ga0070690_100096733 | 3300005330 | Unclassified | 1952 |
| 12 | Ga0070670_100274203 | 3300005331 | Unclassified | 1472 |
| 13 | Ga0070677_10197649 | 3300005333 | Unclassified | 968 |
| 14 | Ga0068869_100013081 | 3300005334 | Bacteria | 5508 |
| 15 | Ga0068869_100303751 | 3300005334 | Bacteria | 1289 |
| 16 | Ga0068869_101598788 | 3300005334 | Bacteria | 580 |
| 17 | Ga0070680_100114432 | 3300005336 | Bacteria | 2247 |
| 18 | Ga0070680_100123833 | 3300005336 | Bacteria | 2159 |
| 19 | Ga0070680_101307334 | 3300005336 | Unclassified | 627 |
| 20 | Ga0070682_100304981 | 3300005337 | Unclassified | 1170 |
| 21 | Ga0068868_100002034 | 3300005338 | Bacteria | 13907 |
| 22 | Ga0068868_100002728 | 3300005338 | Bacteria | 12233 |
| 23 | Ga0068868_100153053 | 3300005338 | Unclassified | 1900 |
| 24 | Ga0068868_100253272 | 3300005338 | Bacteria | 1482 |
| 25 | Ga0068868_100502822 | 3300005338 | Bacteria | 1062 |
| 26 | Ga0070660_101060126 | 3300005339 | Unclassified | 686 |
| 27 | Ga0070689_100061212 | 3300005340 | Bacteria | 2928 |
| 28 | Ga0070691_10389028 | 3300005341 | Unclassified | 783 |
| 29 | Ga0070687_100051207 | 3300005343 | Bacteria | 2137 |
| 30 | Ga0070661_100048115 | 3300005344 | Bacteria | 3121 |
| 31 | Ga0070661_100126962 | 3300005344 | Bacteria | 1914 |
| 32 | Ga0070661_100171795 | 3300005344 | Bacteria | 1646 |
| 33 | Ga0070692_10802856 | 3300005345 | Unclassified | 643 |
| 34 | Ga0070668_100032039 | 3300005347 | Bacteria | 3999 |
| 35 | Ga0070669_101733371 | 3300005353 | Unclassified | 545 |
| 36 | Ga0070675_101438080 | 3300005354 | Bacteria | 636 |
| 37 | Ga0070671_100082778 | 3300005355 | Bacteria | 2684 |
| 38 | Ga0070674_100142743 | 3300005356 | Unclassified | 1799 |
| 39 | Ga0070674_100563342 | 3300005356 | Bacteria | 958 |
| 40 | Ga0070688_100136020 | 3300005365 | Unclassified | 1664 |
| 41 | Ga0070659_100017759 | 3300005366 | Bacteria | 5358 |
| 42 | Ga0070659_100384395 | 3300005366 | Unclassified | 1183 |
| 43 | Ga0070667_100027674 | 3300005367 | Bacteria | 4717 |
| 44 | Ga0070709_10021013 | 3300005434 | Unclassified | 3799 |
| 45 | Ga0070709_10032620 | 3300005434 | Unclassified | 3142 |
| 46 | Ga0070709_10098978 | 3300005434 | Bacteria | 1939 |
| 47 | Ga0070709_10123350 | 3300005434 | Bacteria | 1759 |
| 48 | Ga0070709_10157464 | 3300005434 | Bacteria | 1576 |
| 49 | Ga0070709_10689149 | 3300005434 | Unclassified | 794 |
| 50 | Ga0070709_11436913 | 3300005434 | Unclassified | 559 |
| 51 | Ga0070714_100112760 | 3300005435 | Bacteria | 2410 |
| 52 | Ga0070714_100272936 | 3300005435 | Bacteria | 1569 |
| 53 | Ga0070714_101037114 | 3300005435 | Bacteria | 798 |
| 54 | Ga0070714_101072905 | 3300005435 | Unclassified | 784 |
| 55 | Ga0070713_100013356 | 3300005436 | Bacteria | 6061 |
| 56 | Ga0070713_100028081 | 3300005436 | Unclassified | 4439 |
| 57 | Ga0070713_100054800 | 3300005436 | Bacteria | 3310 |
| 58 | Ga0070713_100097782 | 3300005436 | Unclassified | 2537 |
| 59 | Ga0070713_100149313 | 3300005436 | Bacteria | 2077 |
| 60 | Ga0070713_100155762 | 3300005436 | Bacteria | 2036 |
| 61 | Ga0070713_100387847 | 3300005436 | Bacteria | 1302 |
| 62 | Ga0070713_100701449 | 3300005436 | Unclassified | 966 |
| 63 | Ga0070713_100902106 | 3300005436 | Bacteria | 850 |
| 64 | Ga0070713_101059829 | 3300005436 | Unclassified | 783 |
| 65 | Ga0070713_101363270 | 3300005436 | Unclassified | 687 |
| 66 | Ga0070713_101764982 | 3300005436 | Unclassified | 600 |
| 67 | Ga0070710_10005330 | 3300005437 | Bacteria | 6100 |
| 68 | Ga0070710_10025421 | 3300005437 | Unclassified | 3136 |
| 69 | Ga0070710_10063430 | 3300005437 | Bacteria | 2111 |
| 70 | Ga0070710_10146232 | 3300005437 | Bacteria | 1454 |
| 71 | Ga0070710_10181924 | 3300005437 | Unclassified | 1317 |
| 72 | Ga0070710_10288755 | 3300005437 | Bacteria | 1067 |
| 73 | Ga0070710_10805971 | 3300005437 | Bacteria | 671 |
| 74 | Ga0070711_100001830 | 3300005439 | Bacteria | 11867 |
| 75 | Ga0070711_100096368 | 3300005439 | Bacteria | 2143 |
| 76 | Ga0070711_100301176 | 3300005439 | Bacteria | 1275 |
| 77 | Ga0070711_100566650 | 3300005439 | Unclassified | 944 |
| 78 | Ga0070694_100897163 | 3300005444 | Bacteria | 731 |
| 79 | Ga0070708_100076072 | 3300005445 | Unclassified | 3031 |
| 80 | Ga0070708_100134356 | 3300005445 | Bacteria | 2291 |
| 81 | Ga0070708_100612428 | 3300005445 | Bacteria | 1026 |
| 82 | Ga0070678_100858172 | 3300005456 | Unclassified | 828 |
| 83 | Ga0070681_10000516 | 3300005458 | Bacteria | 31602 |
| 84 | Ga0070681_10129495 | 3300005458 | Bacteria | 2456 |
| 85 | Ga0070681_10177382 | 3300005458 | Bacteria | 2052 |
| 86 | Ga0070681_10303830 | 3300005458 | Bacteria | 1505 |
| 87 | Ga0070681_11092446 | 3300005458 | Unclassified | 718 |
| 88 | Ga0068867_100112974 | 3300005459 | Bacteria | 2089 |
| 89 | Ga0070685_10374665 | 3300005466 | Unclassified | 979 |
| 90 | Ga0070706_100001385 | 3300005467 | Bacteria | 25705 |
| 91 | Ga0070706_100493890 | 3300005467 | Bacteria | 1139 |
| 92 | Ga0070706_100588610 | 3300005467 | Bacteria | 1034 |
| 93 | Ga0070707_100029873 | 3300005468 | Bacteria | 5186 |
| 94 | Ga0070707_100460253 | 3300005468 | Bacteria | 1233 |
| 95 | Ga0070707_101167353 | 3300005468 | Unclassified | 736 |
| 96 | Ga0070707_101662294 | 3300005468 | Unclassified | 606 |
| 97 | Ga0070707_101906178 | 3300005468 | Unclassified | 562 |
| 98 | Ga0070707_101924214 | 3300005468 | Unclassified | 559 |
| 99 | Ga0070698_100095532 | 3300005471 | Bacteria | 2950 |
| 100 | Ga0070699_100020676 | 3300005518 | Bacteria | 5679 |
| 101 | Ga0070699_100070662 | 3300005518 | Unclassified | 3035 |
| 102 | Ga0070679_100077835 | 3300005530 | Bacteria | 3305 |
| 103 | Ga0070679_100177179 | 3300005530 | Unclassified | 2105 |
| 104 | Ga0070679_100179887 | 3300005530 | Bacteria | 2087 |
| 105 | Ga0070679_100251909 | 3300005530 | Bacteria | 1722 |
| 106 | Ga0070679_100456689 | 3300005530 | Bacteria | 1222 |
| 107 | Ga0070679_100937948 | 3300005530 | Bacteria | 809 |
| 108 | Ga0070679_101384700 | 3300005530 | Unclassified | 649 |
| 109 | Ga0070684_100023799 | 3300005535 | Bacteria | 5129 |
| 110 | Ga0070684_100250601 | 3300005535 | Bacteria | 1618 |
| 111 | Ga0070684_100268514 | 3300005535 | Bacteria | 1561 |
| 112 | Ga0070697_100000280 | 3300005536 | Bacteria | 41171 |
| 113 | Ga0070697_100077445 | 3300005536 | Bacteria | 2735 |
| 114 | Ga0068853_100215969 | 3300005539 | Bacteria | 1750 |
| 115 | Ga0068853_100233762 | 3300005539 | Unclassified | 1682 |
| 116 | Ga0068853_100508081 | 3300005539 | Bacteria | 1138 |
| 117 | Ga0068853_100509544 | 3300005539 | Bacteria | 1137 |
| 118 | Ga0068853_100892483 | 3300005539 | Unclassified | 853 |
| 119 | Ga0068853_101122270 | 3300005539 | Bacteria | 758 |
| 120 | Ga0070686_100015760 | 3300005544 | Bacteria | 4386 |
| 121 | Ga0070695_100118313 | 3300005545 | Bacteria | 1809 |
| 122 | Ga0070696_100088832 | 3300005546 | Bacteria | 2197 |
| 123 | Ga0070696_100509548 | 3300005546 | Bacteria | 958 |
| 124 | Ga0070696_101653486 | 3300005546 | Unclassified | 551 |
| 125 | Ga0070693_100044144 | 3300005547 | Unclassified | 2520 |
| 126 | Ga0070693_100137784 | 3300005547 | Bacteria | 1533 |
| 127 | Ga0070693_101138563 | 3300005547 | Unclassified | 597 |
| 128 | Ga0070665_100014347 | 3300005548 | Bacteria | 7956 |
| 129 | Ga0070704_100718116 | 3300005549 | Unclassified | 888 |
| 130 | Ga0068855_100027325 | 3300005563 | Bacteria | 6827 |
| 131 | Ga0068855_100035605 | 3300005563 | Bacteria | 5929 |
| 132 | Ga0068855_100035798 | 3300005563 | Bacteria | 5912 |
| 133 | Ga0068855_100047460 | 3300005563 | Bacteria | 5074 |
| 134 | Ga0068855_100087385 | 3300005563 | Unclassified | 3603 |
| 135 | Ga0070664_100000972 | 3300005564 | Bacteria | 22427 |
| 136 | Ga0070664_100013788 | 3300005564 | Bacteria | 6589 |
| 137 | Ga0070664_100137058 | 3300005564 | Unclassified | 2153 |
| 138 | Ga0070664_100182628 | 3300005564 | Bacteria | 1865 |
| 139 | Ga0070664_100318401 | 3300005564 | Bacteria | 1409 |
| 140 | Ga0068857_100000335 | 3300005577 | Bacteria | 32411 |
| 141 | Ga0068857_100019182 | 3300005577 | Bacteria | 6003 |
| 142 | Ga0068857_100788941 | 3300005577 | Unclassified | 906 |
| 143 | Ga0068857_101329688 | 3300005577 | Bacteria | 698 |
| 144 | Ga0068857_101917281 | 3300005577 | Unclassified | 580 |
| 145 | Ga0068854_100003073 | 3300005578 | Bacteria | 10393 |
| 146 | Ga0068854_100010276 | 3300005578 | Bacteria | 6067 |
| 147 | Ga0068854_100020761 | 3300005578 | Bacteria | 4451 |
| 148 | Ga0068854_100165129 | 3300005578 | Bacteria | 1718 |
| 149 | Ga0068854_100527621 | 3300005578 | Bacteria | 998 |
| 150 | Ga0068856_100002426 | 3300005614 | Bacteria | 19184 |
| 151 | Ga0068856_100005963 | 3300005614 | Bacteria | 11992 |
| 152 | Ga0068856_100024175 | 3300005614 | Bacteria | 5912 |
| 153 | Ga0068856_100044883 | 3300005614 | Bacteria | 4350 |
| 154 | Ga0068856_100066238 | 3300005614 | Bacteria | 3569 |
| 155 | Ga0068856_100081676 | 3300005614 | Bacteria | 3207 |
| 156 | Ga0068856_100160862 | 3300005614 | Unclassified | 2255 |
| 157 | Ga0068856_100744112 | 3300005614 | Bacteria | 1000 |
| 158 | Ga0068856_100807791 | 3300005614 | Bacteria | 957 |
| 159 | Ga0070702_101777403 | 3300005615 | Unclassified | 514 |
| 160 | Ga0068852_100042898 | 3300005616 | Bacteria | 3832 |
| 161 | Ga0068852_100062259 | 3300005616 | Bacteria | 3245 |
| 162 | Ga0068852_100099595 | 3300005616 | Bacteria | 2620 |
| 163 | Ga0068852_102051425 | 3300005616 | Bacteria | 594 |
| 164 | Ga0068859_100008421 | 3300005617 | Bacteria | 10445 |
| 165 | Ga0068859_100015248 | 3300005617 | Bacteria | 7717 |
| 166 | Ga0068864_100003998 | 3300005618 | Bacteria | 12141 |
| 167 | Ga0068864_100204214 | 3300005618 | Bacteria | 1817 |
| 168 | Ga0068864_100549922 | 3300005618 | Bacteria | 1116 |
| 169 | Ga0068866_10028210 | 3300005718 | Bacteria | 2672 |
| 170 | Ga0068866_10317213 | 3300005718 | Unclassified | 979 |
| 171 | Ga0068861_100342375 | 3300005719 | Unclassified | 1309 |
| 172 | Ga0068851_10038848 | 3300005834 | Bacteria | 2389 |
| 173 | Ga0068863_100011279 | 3300005841 | Bacteria | 8657 |
| 174 | Ga0068863_100802871 | 3300005841 | Unclassified | 939 |
| 175 | Ga0068863_101163399 | 3300005841 | Bacteria | 777 |
| 176 | Ga0068858_100000404 | 3300005842 | Bacteria | 44997 |
| 177 | Ga0068858_100022305 | 3300005842 | Bacteria | 5912 |
| 178 | Ga0068858_100022664 | 3300005842 | Bacteria | 5857 |
| 179 | Ga0068858_100103720 | 3300005842 | Bacteria | 2653 |
| 180 | Ga0068860_100192651 | 3300005843 | Bacteria | 1973 |
| 181 | Ga0068860_101315204 | 3300005843 | Unclassified | 744 |
| 182 | Ga0068862_100013092 | 3300005844 | Bacteria | 6860 |
| 183 | Ga0068862_100609478 | 3300005844 | Unclassified | 1049 |
| 184 | Ga0070717_10020255 | 3300006028 | Bacteria | 5227 |
| 185 | Ga0070717_10102757 | 3300006028 | Bacteria | 2429 |
| 186 | Ga0070717_10227267 | 3300006028 | Bacteria | 1642 |
| 187 | Ga0070717_10237682 | 3300006028 | Unclassified | 1605 |
| 188 | Ga0070717_10283545 | 3300006028 | Bacteria | 1470 |
| 189 | Ga0070717_10309452 | 3300006028 | Bacteria | 1406 |
| 190 | Ga0070717_10437062 | 3300006028 | Bacteria | 1178 |
| 191 | Ga0070717_11162393 | 3300006028 | Unclassified | 702 |
| 192 | Ga0070715_10019936 | 3300006163 | Bacteria | 2579 |
| 193 | Ga0070715_10036685 | 3300006163 | Bacteria | 2024 |
| 194 | Ga0070715_10065909 | 3300006163 | Bacteria | 1604 |
| 195 | Ga0070715_10195657 | 3300006163 | Bacteria | 1024 |
| 196 | Ga0070715_10272486 | 3300006163 | Unclassified | 894 |
| 197 | Ga0070716_100000719 | 3300006173 | Bacteria | 14140 |
| 198 | Ga0070716_100174921 | 3300006173 | Bacteria | 1404 |
| 199 | Ga0070716_100337527 | 3300006173 | Bacteria | 1062 |
| 200 | Ga0070716_100764457 | 3300006173 | Bacteria | 745 |
| 201 | Ga0070716_101321018 | 3300006173 | Unclassified | 584 |
| 202 | Ga0070712_100000188 | 3300006175 | Bacteria | 34294 |
| 203 | Ga0070712_100002110 | 3300006175 | Bacteria | 12215 |
| 204 | Ga0070712_100032463 | 3300006175 | Bacteria | 3526 |
| 205 | Ga0070712_100100205 | 3300006175 | Bacteria | 2140 |
| 206 | Ga0070712_100638822 | 3300006175 | Bacteria | 904 |
| 207 | Ga0070712_100728309 | 3300006175 | Unclassified | 847 |
| 208 | Ga0070712_100754853 | 3300006175 | Bacteria | 833 |
| 209 | Ga0070712_100988416 | 3300006175 | Unclassified | 728 |
| 210 | Ga0070712_101262539 | 3300006175 | Unclassified | 643 |
| 211 | Ga0070712_101271065 | 3300006175 | Unclassified | 641 |
| 212 | Ga0097621_100014867 | 3300006237 | Bacteria | 5839 |
| 213 | Ga0097621_100035312 | 3300006237 | Bacteria | 3994 |
| 214 | Ga0097621_100050913 | 3300006237 | Unclassified | 3369 |
| 215 | Ga0097621_100058450 | 3300006237 | Bacteria | 3155 |
| 216 | Ga0097621_100098010 | 3300006237 | Bacteria | 2462 |
| 217 | Ga0097621_100581949 | 3300006237 | Unclassified | 1022 |
| 218 | Ga0068871_100026130 | 3300006358 | Bacteria | 4552 |
| 219 | Ga0068871_100048947 | 3300006358 | Bacteria | 3414 |
| 220 | Ga0068871_100052347 | 3300006358 | Bacteria | 3306 |
| 221 | Ga0068871_100055804 | 3300006358 | Bacteria | 3208 |
| 222 | Ga0068871_100230547 | 3300006358 | Bacteria | 1607 |
| 223 | Ga0075434_100040343 | 3300006871 | Bacteria | 4623 |
| 224 | Ga0068865_100037406 | 3300006881 | Unclassified | 3277 |
| 225 | Ga0068865_100042312 | 3300006881 | Bacteria | 3106 |
| 226 | Ga0068865_100055090 | 3300006881 | Bacteria | 2766 |
| 227 | Ga0075436_100208045 | 3300006914 | Unclassified | 1387 |
| 228 | Ga0097620_100008421 | 3300006931 | Bacteria | 10445 |
| 229 | Ga0097620_100015253 | 3300006931 | Bacteria | 7717 |
| 230 | Ga0075435_100175674 | 3300007076 | Bacteria | 1809 |
| 231 | Ga0075435_100212654 | 3300007076 | Bacteria | 1641 |
| 232 | Ga0075435_101521949 | 3300007076 | Unclassified | 587 |
| 233 | Ga0075435_101639253 | 3300007076 | Bacteria | 564 |
| 234 | Ga0099795_10079371 | 3300007788 | Bacteria | 1253 |
| 235 | Ga0105240_10041027 | 3300009093 | Bacteria | 5912 |
| 236 | Ga0105240_10118482 | 3300009093 | Bacteria | 3190 |
| 237 | Ga0105240_10173529 | 3300009093 | Bacteria | 2551 |
| 238 | Ga0105240_10192360 | 3300009093 | Unclassified | 2398 |
| 239 | Ga0105240_10228981 | 3300009093 | Bacteria | 2161 |
| 240 | Ga0105240_10485544 | 3300009093 | Unclassified | 1376 |
| 241 | Ga0105240_10560576 | 3300009093 | Unclassified | 1263 |
| 242 | Ga0105245_10178532 | 3300009098 | Bacteria | 2027 |
| 243 | Ga0105245_10658879 | 3300009098 | Unclassified | 1077 |
| 244 | Ga0105245_10748058 | 3300009098 | Unclassified | 1013 |
| 245 | Ga0105247_10061643 | 3300009101 | Unclassified | 2326 |
| 246 | Ga0105247_10096097 | 3300009101 | Unclassified | 1888 |
| 247 | Ga0105247_10295200 | 3300009101 | Bacteria | 1122 |
| 248 | Ga0105247_10347377 | 3300009101 | Bacteria | 1042 |
| 249 | Ga0105243_10621312 | 3300009148 | Bacteria | 1043 |
| 250 | Ga0105241_10004558 | 3300009174 | Bacteria | 10250 |
| 251 | Ga0105241_10008879 | 3300009174 | Bacteria | 7394 |
| 252 | Ga0105241_10014156 | 3300009174 | Bacteria | 5844 |
| 253 | Ga0105241_10041998 | 3300009174 | Bacteria | 3458 |
| 254 | Ga0105241_10283768 | 3300009174 | Bacteria | 1415 |
| 255 | Ga0105241_10311687 | 3300009174 | Unclassified | 1354 |
| 256 | Ga0105241_10413206 | 3300009174 | Unclassified | 1186 |
| 257 | Ga0105241_11110069 | 3300009174 | Unclassified | 745 |
| 258 | Ga0105241_11614339 | 3300009174 | Bacteria | 628 |
| 259 | Ga0105242_10112040 | 3300009176 | Bacteria | 2327 |
| 260 | Ga0105242_10309510 | 3300009176 | Bacteria | 1445 |
| 261 | Ga0105242_10632175 | 3300009176 | Unclassified | 1038 |
| 262 | Ga0105242_10638292 | 3300009176 | Unclassified | 1034 |
| 263 | Ga0105248_10011433 | 3300009177 | Bacteria | 9783 |
| 264 | Ga0105248_10038196 | 3300009177 | Bacteria | 5373 |
| 265 | Ga0105248_10083865 | 3300009177 | Unclassified | 3585 |
| 266 | Ga0105248_11189077 | 3300009177 | Unclassified | 862 |
| 267 | Ga0105237_10013626 | 3300009545 | Bacteria | 8515 |
| 268 | Ga0105237_10019981 | 3300009545 | Bacteria | 6914 |
| 269 | Ga0105237_10129661 | 3300009545 | Unclassified | 2516 |
| 270 | Ga0105237_10179233 | 3300009545 | Bacteria | 2119 |
| 271 | Ga0105237_10392500 | 3300009545 | Unclassified | 1392 |
| 272 | Ga0105237_10403347 | 3300009545 | Unclassified | 1372 |
| 273 | Ga0105237_10469160 | 3300009545 | Bacteria | 1265 |
| 274 | Ga0105237_11172531 | 3300009545 | Unclassified | 775 |
| 275 | Ga0105237_12512891 | 3300009545 | Unclassified | 525 |
| 276 | Ga0105238_10000214 | 3300009551 | Bacteria | 64373 |
| 277 | Ga0105238_10058700 | 3300009551 | Bacteria | 3856 |
| 278 | Ga0105238_11284079 | 3300009551 | Unclassified | 758 |
| 279 | Ga0105238_11306186 | 3300009551 | Unclassified | 751 |
| 280 | Ga0105249_10128144 | 3300009553 | Unclassified | 2419 |
| 281 | Ga0099796_10070296 | 3300010159 | Bacteria | 1262 |
| 282 | Ga0099796_10154955 | 3300010159 | Unclassified | 904 |
| 283 | Ga0099796_10400096 | 3300010159 | Unclassified | 602 |
| 284 | Ga0105239_10418471 | 3300010375 | Bacteria | 1518 |
| 285 | Ga0105239_10747253 | 3300010375 | Unclassified | 1119 |
| 286 | Ga0105246_10031095 | 3300011119 | Bacteria | 3530 |
| 287 | Ga0105246_10073637 | 3300011119 | Bacteria | 2412 |
| 288 | Ga0157373_10002307 | 3300013100 | Bacteria | 14477 |
| 289 | Ga0157373_10050500 | 3300013100 | Unclassified | 2961 |
| 290 | Ga0157373_10341583 | 3300013100 | Bacteria | 1067 |
| 291 | Ga0157371_10145618 | 3300013102 | Bacteria | 1688 |
| 292 | Ga0157371_10320680 | 3300013102 | Bacteria | 1124 |
| 293 | Ga0157371_10522301 | 3300013102 | Bacteria | 878 |
| 294 | Ga0157370_10042321 | 3300013104 | Unclassified | 4390 |
| 295 | Ga0157370_10062571 | 3300013104 | Unclassified | 3528 |
| 296 | Ga0157370_10823399 | 3300013104 | Unclassified | 844 |
| 297 | Ga0157370_11581347 | 3300013104 | Unclassified | 589 |
| 298 | Ga0157369_10017191 | 3300013105 | Bacteria | 8127 |
| 299 | Ga0157369_10024898 | 3300013105 | Bacteria | 6650 |
| 300 | Ga0157369_10030146 | 3300013105 | Bacteria | 5984 |
| 301 | Ga0157369_10030474 | 3300013105 | Bacteria | 5949 |
| 302 | Ga0157369_10055341 | 3300013105 | Bacteria | 4283 |
| 303 | Ga0157369_10169254 | 3300013105 | Bacteria | 2303 |
| 304 | Ga0157374_10002353 | 3300013296 | Bacteria | 15957 |
| 305 | Ga0157374_10007704 | 3300013296 | Bacteria | 9195 |
| 306 | Ga0157374_10020082 | 3300013296 | Bacteria | 5924 |
| 307 | Ga0157374_10020608 | 3300013296 | Bacteria | 5854 |
| 308 | Ga0157374_10112592 | 3300013296 | Unclassified | 2618 |
| 309 | Ga0157374_10136470 | 3300013296 | Bacteria | 2378 |
| 310 | Ga0157374_10493097 | 3300013296 | Unclassified | 1229 |
| 311 | Ga0157374_10533244 | 3300013296 | Unclassified | 1181 |
| 312 | Ga0157374_11508064 | 3300013296 | Bacteria | 696 |
| 313 | Ga0157378_10000349 | 3300013297 | Bacteria | 45351 |
| 314 | Ga0157378_10012660 | 3300013297 | Bacteria | 7380 |
| 315 | Ga0157378_10019523 | 3300013297 | Bacteria | 5958 |
| 316 | Ga0157378_10110608 | 3300013297 | Bacteria | 2518 |
| 317 | Ga0157378_10223860 | 3300013297 | Unclassified | 1789 |
| 318 | Ga0157378_10284258 | 3300013297 | Unclassified | 1596 |
| 319 | Ga0157378_10578669 | 3300013297 | Unclassified | 1132 |
| 320 | Ga0163162_10001352 | 3300013306 | Bacteria | 22820 |
| 321 | Ga0163162_10076008 | 3300013306 | Bacteria | 3420 |
| 322 | Ga0157372_10009551 | 3300013307 | Bacteria | 10312 |
| 323 | Ga0157372_10016466 | 3300013307 | Bacteria | 7935 |
| 324 | Ga0157372_10021505 | 3300013307 | Bacteria | 6970 |
| 325 | Ga0157372_10198126 | 3300013307 | Bacteria | 2326 |
| 326 | Ga0157372_10340856 | 3300013307 | Bacteria | 1746 |
| 327 | Ga0157372_10449539 | 3300013307 | Unclassified | 1502 |
| 328 | Ga0157372_12244693 | 3300013307 | Unclassified | 627 |
| 329 | Ga0157375_10073391 | 3300013308 | Bacteria | 3441 |
| 330 | Ga0163163_10137406 | 3300014325 | Unclassified | 2485 |
| 331 | Ga0163163_10308668 | 3300014325 | Bacteria | 1635 |
| 332 | Ga0163163_10744433 | 3300014325 | Unclassified | 1043 |
| 333 | Ga0182008_10166695 | 3300014497 | Unclassified | 1111 |
| 334 | Ga0157377_10230735 | 3300014745 | Bacteria | 1190 |
| 335 | Ga0157379_10014470 | 3300014968 | Bacteria | 6924 |
| 336 | Ga0157376_10004658 | 3300014969 | Bacteria | 9559 |
| 337 | Ga0157376_10029979 | 3300014969 | Bacteria | 4337 |
| 338 | Ga0157376_10129620 | 3300014969 | Unclassified | 2248 |
| 339 | Ga0157376_10156827 | 3300014969 | Bacteria | 2059 |
| 340 | Ga0157376_10606817 | 3300014969 | Unclassified | 1090 |
| 341 | Ga0157376_10917595 | 3300014969 | Unclassified | 895 |
| 342 | Ga0163161_10454448 | 3300017792 | Bacteria | 1036 |
| 343 | Ga0206350_10799557 | 3300020080 | Bacteria | 572 |
| 344 | Ga0224569_100417 | 3300022732 | Bacteria | 3629 |
| 345 | Ga0224569_101519 | 3300022732 | Bacteria | 1944 |
| 346 | Ga0224572_1043589 | 3300024225 | Bacteria | 842 |
| 347 | Ga0228598_1000610 | 3300024227 | Bacteria | 7498 |
| 348 | Ga0228598_1017198 | 3300024227 | Bacteria | 1426 |
| 349 | Ga0207656_10591974 | 3300025321 | Unclassified | 566 |
| 350 | Ga0207692_10038564 | 3300025898 | Bacteria | 2344 |
| 351 | Ga0207692_10051885 | 3300025898 | Bacteria | 2081 |
| 352 | Ga0207692_10075763 | 3300025898 | Bacteria | 1786 |
| 353 | Ga0207692_10232322 | 3300025898 | Bacteria | 1098 |
| 354 | Ga0207692_10287795 | 3300025898 | Unclassified | 996 |
| 355 | Ga0207692_10553051 | 3300025898 | Unclassified | 735 |
| 356 | Ga0207692_10808708 | 3300025898 | Bacteria | 613 |
| 357 | Ga0207642_10251058 | 3300025899 | Unclassified | 1004 |
| 358 | Ga0207642_10353709 | 3300025899 | Unclassified | 867 |
| 359 | Ga0207710_10127567 | 3300025900 | Bacteria | 1220 |
| 360 | Ga0207647_10056919 | 3300025904 | Bacteria | 2398 |
| 361 | Ga0207685_10010487 | 3300025905 | Bacteria | 2739 |
| 362 | Ga0207685_10121840 | 3300025905 | Unclassified | 1146 |
| 363 | Ga0207685_10143577 | 3300025905 | Bacteria | 1073 |
| 364 | Ga0207685_10265566 | 3300025905 | Unclassified | 836 |
| 365 | Ga0207685_10362993 | 3300025905 | Bacteria | 733 |
| 366 | Ga0207699_10005690 | 3300025906 | Bacteria | 5990 |
| 367 | Ga0207699_10061308 | 3300025906 | Bacteria | 2262 |
| 368 | Ga0207699_10139396 | 3300025906 | Unclassified | 1592 |
| 369 | Ga0207699_10289543 | 3300025906 | Bacteria | 1141 |
| 370 | Ga0207699_10347228 | 3300025906 | Bacteria | 1047 |
| 371 | Ga0207699_10491028 | 3300025906 | Bacteria | 885 |
| 372 | Ga0207645_10011239 | 3300025907 | Bacteria | 6123 |
| 373 | Ga0207684_10005360 | 3300025910 | Bacteria | 11848 |
| 374 | Ga0207684_10211737 | 3300025910 | Bacteria | 1672 |
| 375 | Ga0207654_10003381 | 3300025911 | Bacteria | 8076 |
| 376 | Ga0207654_10005928 | 3300025911 | Bacteria | 6151 |
| 377 | Ga0207654_10072931 | 3300025911 | Bacteria | 2045 |
| 378 | Ga0207654_10108992 | 3300025911 | Bacteria | 1719 |
| 379 | Ga0207654_10217127 | 3300025911 | Unclassified | 1266 |
| 380 | Ga0207654_10246731 | 3300025911 | Unclassified | 1195 |
| 381 | Ga0207654_10386426 | 3300025911 | Unclassified | 970 |
| 382 | Ga0207654_10839063 | 3300025911 | Bacteria | 665 |
| 383 | Ga0207707_10004272 | 3300025912 | Bacteria | 12644 |
| 384 | Ga0207707_10014133 | 3300025912 | Bacteria | 6956 |
| 385 | Ga0207707_10104125 | 3300025912 | Bacteria | 2480 |
| 386 | Ga0207707_10512052 | 3300025912 | Bacteria | 1022 |
| 387 | Ga0207707_10873381 | 3300025912 | Unclassified | 745 |
| 388 | Ga0207695_10006382 | 3300025913 | Bacteria | 15343 |
| 389 | Ga0207695_10039220 | 3300025913 | Bacteria | 5092 |
| 390 | Ga0207695_10059977 | 3300025913 | Bacteria | 3942 |
| 391 | Ga0207695_10220128 | 3300025913 | Unclassified | 1806 |
| 392 | Ga0207695_10259566 | 3300025913 | Bacteria | 1635 |
| 393 | Ga0207671_10011713 | 3300025914 | Bacteria | 7106 |
| 394 | Ga0207671_10138997 | 3300025914 | Bacteria | 1870 |
| 395 | Ga0207671_10299163 | 3300025914 | Bacteria | 1271 |
| 396 | Ga0207693_10000524 | 3300025915 | Bacteria | 34688 |
| 397 | Ga0207693_10001919 | 3300025915 | Bacteria | 18194 |
| 398 | Ga0207693_10008223 | 3300025915 | Bacteria | 8543 |
| 399 | Ga0207693_10013982 | 3300025915 | Bacteria | 6463 |
| 400 | Ga0207693_10025087 | 3300025915 | Bacteria | 4729 |
| 401 | Ga0207693_10058181 | 3300025915 | Bacteria | 3028 |
| 402 | Ga0207663_10002678 | 3300025916 | Bacteria | 8589 |
| 403 | Ga0207663_10034834 | 3300025916 | Bacteria | 3015 |
| 404 | Ga0207663_10072437 | 3300025916 | Unclassified | 2227 |
| 405 | Ga0207663_10172934 | 3300025916 | Unclassified | 1536 |
| 406 | Ga0207663_10300115 | 3300025916 | Unclassified | 1200 |
| 407 | Ga0207663_10474092 | 3300025916 | Bacteria | 969 |
| 408 | Ga0207663_10779602 | 3300025916 | Bacteria | 761 |
| 409 | Ga0207660_10164830 | 3300025917 | Bacteria | 1712 |
| 410 | Ga0207660_10647908 | 3300025917 | Bacteria | 861 |
| 411 | Ga0207660_11006774 | 3300025917 | Unclassified | 680 |
| 412 | Ga0207662_10068932 | 3300025918 | Bacteria | 2137 |
| 413 | Ga0207657_10004544 | 3300025919 | Bacteria | 14660 |
| 414 | Ga0207657_10511540 | 3300025919 | Unclassified | 940 |
| 415 | Ga0207649_10112564 | 3300025920 | Bacteria | 1821 |
| 416 | Ga0207649_10494298 | 3300025920 | Unclassified | 929 |
| 417 | Ga0207649_10735469 | 3300025920 | Bacteria | 767 |
| 418 | Ga0207652_10008758 | 3300025921 | Bacteria | 8144 |
| 419 | Ga0207652_10039789 | 3300025921 | Bacteria | 3991 |
| 420 | Ga0207652_10236677 | 3300025921 | Bacteria | 1646 |
| 421 | Ga0207652_10601787 | 3300025921 | Bacteria | 986 |
| 422 | Ga0207652_11199600 | 3300025921 | Unclassified | 661 |
| 423 | Ga0207646_10071842 | 3300025922 | Bacteria | 3091 |
| 424 | Ga0207646_10338275 | 3300025922 | Unclassified | 1360 |
| 425 | Ga0207646_10382507 | 3300025922 | Bacteria | 1271 |
| 426 | Ga0207681_10806896 | 3300025923 | Bacteria | 784 |
| 427 | Ga0207694_10002173 | 3300025924 | Bacteria | 16132 |
| 428 | Ga0207694_10015779 | 3300025924 | Bacteria | 5700 |
| 429 | Ga0207694_10612603 | 3300025924 | Unclassified | 916 |
| 430 | Ga0207659_11260092 | 3300025926 | Unclassified | 635 |
| 431 | Ga0207687_10145120 | 3300025927 | Bacteria | 1805 |
| 432 | Ga0207687_10739627 | 3300025927 | Unclassified | 837 |
| 433 | Ga0207700_10001374 | 3300025928 | Bacteria | 13798 |
| 434 | Ga0207700_10003931 | 3300025928 | Bacteria | 8684 |
| 435 | Ga0207700_10040604 | 3300025928 | Unclassified | 3397 |
| 436 | Ga0207700_10053055 | 3300025928 | Bacteria | 3035 |
| 437 | Ga0207700_10076042 | 3300025928 | Bacteria | 2604 |
| 438 | Ga0207700_10103133 | 3300025928 | Bacteria | 2280 |
| 439 | Ga0207700_10416726 | 3300025928 | Bacteria | 1179 |
| 440 | Ga0207700_10622073 | 3300025928 | Unclassified | 962 |
| 441 | Ga0207700_10908109 | 3300025928 | Unclassified | 788 |
| 442 | Ga0207700_11491342 | 3300025928 | Unclassified | 600 |
| 443 | Ga0207664_10222907 | 3300025929 | Bacteria | 1636 |
| 444 | Ga0207664_10233707 | 3300025929 | Bacteria | 1599 |
| 445 | Ga0207664_10465584 | 3300025929 | Bacteria | 1129 |
| 446 | Ga0207644_10078525 | 3300025931 | Bacteria | 2433 |
| 447 | Ga0207644_10549978 | 3300025931 | Unclassified | 955 |
| 448 | Ga0207690_10025625 | 3300025932 | Bacteria | 3705 |
| 449 | Ga0207690_10114342 | 3300025932 | Bacteria | 1949 |
| 450 | Ga0207706_10003412 | 3300025933 | Bacteria | 15181 |
| 451 | Ga0207686_10042114 | 3300025934 | Bacteria | 2789 |
| 452 | Ga0207686_10095160 | 3300025934 | Bacteria | 1976 |
| 453 | Ga0207686_10807037 | 3300025934 | Unclassified | 752 |
| 454 | Ga0207670_10297659 | 3300025936 | Unclassified | 1262 |
| 455 | Ga0207669_10233361 | 3300025937 | Bacteria | 1359 |
| 456 | Ga0207704_10024083 | 3300025938 | Unclassified | 3294 |
| 457 | Ga0207704_10038752 | 3300025938 | Bacteria | 2768 |
| 458 | Ga0207704_10468247 | 3300025938 | Bacteria | 1009 |
| 459 | Ga0207665_10000107 | 3300025939 | Bacteria | 54377 |
| 460 | Ga0207665_10002111 | 3300025939 | Bacteria | 13441 |
| 461 | Ga0207665_10011949 | 3300025939 | Bacteria | 5703 |
| 462 | Ga0207665_10073929 | 3300025939 | Bacteria | 2332 |
| 463 | Ga0207665_10104733 | 3300025939 | Bacteria | 1980 |
| 464 | Ga0207665_10116511 | 3300025939 | Bacteria | 1883 |
| 465 | Ga0207665_10366422 | 3300025939 | Unclassified | 1091 |
| 466 | Ga0207665_10439160 | 3300025939 | Bacteria | 1000 |
| 467 | Ga0207665_10935426 | 3300025939 | Unclassified | 688 |
| 468 | Ga0207665_11251009 | 3300025939 | Unclassified | 592 |
| 469 | Ga0207691_10632240 | 3300025940 | Unclassified | 905 |
| 470 | Ga0207711_10054490 | 3300025941 | Bacteria | 3432 |
| 471 | Ga0207711_10105119 | 3300025941 | Bacteria | 2503 |
| 472 | Ga0207711_10283757 | 3300025941 | Bacteria | 1525 |
| 473 | Ga0207711_10648271 | 3300025941 | Unclassified | 985 |
| 474 | Ga0207689_10020706 | 3300025942 | Bacteria | 5530 |
| 475 | Ga0207689_10363656 | 3300025942 | Unclassified | 1203 |
| 476 | Ga0207661_10241521 | 3300025944 | Unclassified | 1603 |
| 477 | Ga0207661_10382239 | 3300025944 | Bacteria | 1274 |
| 478 | Ga0207661_10408868 | 3300025944 | Unclassified | 1231 |
| 479 | Ga0207661_10614299 | 3300025944 | Unclassified | 998 |
| 480 | Ga0207679_10022824 | 3300025945 | Unclassified | 4267 |
| 481 | Ga0207679_10065896 | 3300025945 | Unclassified | 2712 |
| 482 | Ga0207667_10002400 | 3300025949 | Bacteria | 23462 |
| 483 | Ga0207667_10016948 | 3300025949 | Bacteria | 8219 |
| 484 | Ga0207667_10019010 | 3300025949 | Bacteria | 7682 |
| 485 | Ga0207667_10029499 | 3300025949 | Bacteria | 5949 |
| 486 | Ga0207667_10090526 | 3300025949 | Unclassified | 3162 |
| 487 | Ga0207712_10030782 | 3300025961 | Bacteria | 3610 |
| 488 | Ga0207668_10014196 | 3300025972 | Bacteria | 4928 |
| 489 | Ga0207640_10000843 | 3300025981 | Bacteria | 17434 |
| 490 | Ga0207640_10166240 | 3300025981 | Unclassified | 1638 |
| 491 | Ga0207640_10191715 | 3300025981 | Bacteria | 1541 |
| 492 | Ga0207640_10438113 | 3300025981 | Unclassified | 1074 |
| 493 | Ga0207640_10653993 | 3300025981 | Bacteria | 896 |
| 494 | Ga0207658_10013917 | 3300025986 | Bacteria | 5506 |
| 495 | Ga0207677_10001146 | 3300026023 | Bacteria | 14471 |
| 496 | Ga0207677_10035986 | 3300026023 | Bacteria | 3221 |
| 497 | Ga0207677_10225514 | 3300026023 | Bacteria | 1506 |
| 498 | Ga0207677_10397501 | 3300026023 | Unclassified | 1168 |
| 499 | Ga0207703_10004390 | 3300026035 | Bacteria | 11593 |
| 500 | Ga0207703_10036228 | 3300026035 | Bacteria | 3926 |
| 501 | Ga0207703_10105947 | 3300026035 | Bacteria | 2391 |
| 502 | Ga0207639_10072810 | 3300026041 | Bacteria | 2692 |
| 503 | Ga0207639_10098468 | 3300026041 | Unclassified | 2357 |
| 504 | Ga0207639_10223605 | 3300026041 | Bacteria | 1627 |
| 505 | Ga0207639_10607341 | 3300026041 | Unclassified | 1009 |
| 506 | Ga0207639_10760155 | 3300026041 | Bacteria | 901 |
| 507 | Ga0207678_10001295 | 3300026067 | Bacteria | 23151 |
| 508 | Ga0207702_10001116 | 3300026078 | Bacteria | 27436 |
| 509 | Ga0207702_10010710 | 3300026078 | Bacteria | 7659 |
| 510 | Ga0207702_10033937 | 3300026078 | Bacteria | 4264 |
| 511 | Ga0207702_10054228 | 3300026078 | Bacteria | 3396 |
| 512 | Ga0207702_10070660 | 3300026078 | Bacteria | 3003 |
| 513 | Ga0207702_10138022 | 3300026078 | Bacteria | 2202 |
| 514 | Ga0207702_10187958 | 3300026078 | Bacteria | 1906 |
| 515 | Ga0207702_10758828 | 3300026078 | Unclassified | 958 |
| 516 | Ga0207641_10078848 | 3300026088 | Unclassified | 2854 |
| 517 | Ga0207641_10080284 | 3300026088 | Bacteria | 2829 |
| 518 | Ga0207641_10186602 | 3300026088 | Bacteria | 1903 |
| 519 | Ga0207641_10636859 | 3300026088 | Unclassified | 1046 |
| 520 | Ga0207648_10014004 | 3300026089 | Bacteria | 7430 |
| 521 | Ga0207648_10034800 | 3300026089 | Bacteria | 4440 |
| 522 | Ga0207676_10009475 | 3300026095 | Bacteria | 6932 |
| 523 | Ga0207676_10276247 | 3300026095 | Bacteria | 1523 |
| 524 | Ga0207676_11394991 | 3300026095 | Unclassified | 696 |
| 525 | Ga0207674_10000269 | 3300026116 | Bacteria | 65505 |
| 526 | Ga0207674_10184164 | 3300026116 | Bacteria | 2039 |
| 527 | Ga0207674_10213170 | 3300026116 | Bacteria | 1880 |
| 528 | Ga0207674_11363048 | 3300026116 | Bacteria | 679 |
| 529 | Ga0207675_100106135 | 3300026118 | Bacteria | 2648 |
| 530 | Ga0207683_10195001 | 3300026121 | Bacteria | 1840 |
| 531 | Ga0207698_10280822 | 3300026142 | Bacteria | 1540 |
| 532 | Ga0207698_11481623 | 3300026142 | Bacteria | 694 |
| 533 | Ga0207698_11712564 | 3300026142 | Unclassified | 644 |
| 534 | Ga0265356_1007564 | 3300028017 | Bacteria | 1251 |
| 535 | Ga0268266_10249239 | 3300028379 | Bacteria | 1642 |
| 536 | Ga0268266_10389584 | 3300028379 | Bacteria | 1316 |
| 537 | Ga0268265_10270770 | 3300028380 | Bacteria | 1515 |
| 538 | Ga0268265_10557891 | 3300028380 | Unclassified | 1088 |
| 539 | Ga0268264_10142842 | 3300028381 | Bacteria | 2137 |
| 540 | Ga0265338_10350962 | 3300028800 | Bacteria | 1061 |
| 541 | Ga0265762_1000946 | 3300030760 | Bacteria | 5205 |
| 542 | Ga0265762_1009970 | 3300030760 | Bacteria | 1696 |
| 543 | Ga0265762_1011930 | 3300030760 | Unclassified | 1555 |
| 544 | Ga0265760_10001451 | 3300031090 | Bacteria | 6976 |
| 545 | Ga0265760_10049819 | 3300031090 | Unclassified | 1259 |
| 546 | Ga0265760_10066660 | 3300031090 | Bacteria | 1100 |
| 547 | Ga0265760_10191260 | 3300031090 | Bacteria | 688 |
| 548 | Ga0265330_10004603 | 3300031235 | Bacteria | 6976 |
| 549 | Ga0265325_10081869 | 3300031241 | Bacteria | 1603 |
| 550 | Ga0265340_10038300 | 3300031247 | Bacteria | 2372 |
| 551 | Ga0265339_10137655 | 3300031249 | Bacteria | 1244 |
| 552 | Ga0265316_10005636 | 3300031344 | Bacteria | 12119 |
| 553 | Ga0265316_10069349 | 3300031344 | Unclassified | 2721 |
| 554 | Ga0265314_10000348 | 3300031711 | Bacteria | 64175 |
| 555 | Ga0265314_10080770 | 3300031711 | Bacteria | 2145 |
| 556 | Ga0265342_10105979 | 3300031712 | Bacteria | 1596 |
| 557 | Ga0316212_1010514 | 3300033547 | Unclassified | 1327 |
| 558 | Ga0373930_0002850 | 3300034816 | Bacteria | 2712 |
| 559 | Ga0373959_0066820 | 3300034820 | Bacteria | 806 |
| 560 | Ga0373926_0120020 | 3300035083 | Unclassified | 991 |
| 561 | Ga0373926_0150539 | 3300035083 | Unclassified | 886 |
| 562 | Ga0373926_0277610 | 3300035083 | Unclassified | 652 |
| 563 | Ga0373928_0177448 | 3300035084 | Unclassified | 604 |
| 564 | Ga0373929_0101812 | 3300035085 | Unclassified | 725 |
| 565 | Ga0373929_0195494 | 3300035085 | Bacteria | 564 |
| 566 | Ga0373934_0031541 | 3300035086 | Unclassified | 2075 |
| 567 | Ga0373940_0012610 | 3300035088 | Bacteria | 2028 |
| 568 | Ga0373952_0061248 | 3300035092 | Bacteria | 921 |
| 569 | Ga0373923_0687016 | 3300035111 | Unclassified | 508 |
| 570 | Ga0373932_0031152 | 3300035112 | Bacteria | 1484 |
| 571 | Ga0373932_0336590 | 3300035112 | Unclassified | 571 |
| 572 | Ga0373941_0075026 | 3300035115 | Unclassified | 1131 |
| 573 | Ga0373943_0153197 | 3300035170 | Bacteria | 1250 |
| 574 | Ga0373943_0458486 | 3300035170 | Bacteria | 741 |
| 575 | Ga0373955_0105875 | 3300035172 | Bacteria | 1621 |
| 576 | Ga0373942_0095494 | 3300035207 | Unclassified | 902 |
| 577 | Ga0373942_0287944 | 3300035207 | Unclassified | 567 |
| 578 | Ga0373961_0290109 | 3300035241 | Bacteria | 602 |
| 579 | Ga0373924_0055565 | 3300035410 | Unclassified | 1648 |
| 580 | Ga0373931_0070609 | 3300035691 | Bacteria | 1906 |
| 581 | Ga0373931_0165397 | 3300035691 | Bacteria | 1299 |
| 582 | Ga0373931_0191059 | 3300035691 | Bacteria | 1218 |
| 583 | Ga0373931_0359094 | 3300035691 | Unclassified | 914 |
| 584 | Ga0373935_0087992 | 3300035692 | Bacteria | 2029 |
| 585 | Ga0373927_0034111 | 3300035695 | Bacteria | 3312 |
| 586 | Ga0373933_0210717 | 3300035724 | Unclassified | 1245 |
| 587 | Ga0373947_0312167 | 3300035725 | Unclassified | 1050 |
| 588 | Ga0373947_0957930 | 3300035725 | Unclassified | 584 |
| 589 | Ga0373937_0049001 | 3300036401 | Bacteria | 3868 |
| 590 | Ga0373937_0163202 | 3300036401 | Bacteria | 2089 |
| 591 | Ga0373937_0462315 | 3300036401 | Bacteria | 1205 |
| 592 | Ga0373925_0005643 | 3300037068 | Bacteria | 9311 |
| 593 | Ga0373925_0024897 | 3300037068 | Bacteria | 4372 |
| 594 | Ga0373925_0576270 | 3300037068 | Bacteria | 926 |
| 595 | Ga0373925_0596540 | 3300037068 | Unclassified | 910 |
| 596 | Ga0436364_0514138 | 3300037853 | Unclassified | 4866 |
| 597 | Ga0436364_0801393 | 3300037853 | Bacteria | 825 |
| 598 | Ga0242420_008913 | 3300038996 | Bacteria | 1637 |
| 599 | Ga0436360_0070604 | 3300039438 | Bacteria | 1111 |
| 600 | Ga0436360_0755550 | 3300039438 | Bacteria | 1210 |
| 601 | Ga0436363_0207954 | 3300039450 | Bacteria | 1892 |
| 602 | Ga0436363_1196749 | 3300039450 | Bacteria | 3919 |
| 603 | Ga0436362_0725186 | 3300039453 | Unclassified | 3605 |
| 604 | Ga0451839_0440554 | 3300041496 | Unclassified | 915 |
| 605 | Ga0466966_0576756 | 3300044684 | Unclassified | 677 |
| 606 | Ga0466961_0303856 | 3300044693 | Unclassified | 974 |
| 607 | Ga0466963_0013420 | 3300044694 | Bacteria | 5031 |
| 608 | Ga0466963_0069414 | 3300044694 | Bacteria | 2368 |
| 609 | Ga0466964_0040768 | 3300044706 | Bacteria | 1876 |
| 610 | Ga0466971_0026254 | 3300044719 | Bacteria | 2602 |
| 611 | Ga0466968_0659183 | 3300044735 | Unclassified | 532 |
| 612 | Ga0466957_0340163 | 3300044842 | Unclassified | 1016 |
| 613 | Ga0466959_0353015 | 3300045049 | Unclassified | 1002 |
| 614 | Ga0451576_0725525 | 3300045051 | Unclassified | 1044 |
| 615 | Ga0451576_1026087 | 3300045051 | Unclassified | 864 |
| 616 | Ga0466958_0081695 | 3300045836 | Bacteria | 1989 |
| 617 | Ga0466967_0008226 | 3300045976 | Bacteria | 7620 |
| 618 | Ga0466967_0103166 | 3300045976 | Bacteria | 2610 |
| 619 | Ga0466967_0907308 | 3300045976 | Unclassified | 876 |
| 620 | Ga0495651_0148262 | 3300046462 | Bacteria | 1694 |
| 621 | Ga0495580_0000750 | 3300046472 | Bacteria | 27781 |
| 622 | Ga0495580_0018203 | 3300046472 | Bacteria | 5233 |
| 623 | Ga0495580_0079331 | 3300046472 | Bacteria | 2289 |
| 624 | Ga0495580_0090086 | 3300046472 | Unclassified | 2135 |
| 625 | Ga0495580_0112389 | 3300046472 | Bacteria | 1892 |
| 626 | Ga0495580_0136133 | 3300046472 | Bacteria | 1703 |
| 627 | Ga0495580_0189941 | 3300046472 | Bacteria | 1417 |
| 628 | Ga0495580_0641467 | 3300046472 | Unclassified | 699 |
| 629 | Ga0495582_0100397 | 3300046473 | Bacteria | 1620 |
| 630 | Ga0495639_0044109 | 3300046475 | Bacteria | 2016 |
| 631 | Ga0495630_0107809 | 3300046517 | Bacteria | 2110 |
| 632 | Ga0495645_0748140 | 3300046543 | Unclassified | 590 |
| 633 | Ga0495667_0264468 | 3300046559 | Bacteria | 1094 |
| 634 | Ga0495635_0028063 | 3300046663 | Bacteria | 3913 |
| 635 | Ga0495657_0462504 | 3300046675 | Bacteria | 742 |
| 636 | Ga0495624_0534024 | 3300046690 | Bacteria | 701 |
| 637 | Ga0495604_0287285 | 3300047317 | Bacteria | 1109 |
| 638 | Ga0495604_0313049 | 3300047317 | Unclassified | 1051 |
| 639 | Ga0495674_0205679 | 3300047319 | Bacteria | 1632 |
| 640 | Ga0495675_0083980 | 3300047444 | Unclassified | 2004 |
| 641 | Ga0495684_0735118 | 3300047471 | Bacteria | 651 |
| 642 | Ga0495602_0338877 | 3300048088 | Bacteria | 1088 |
| 643 | Ga0495602_0377638 | 3300048088 | Unclassified | 1016 |
| 644 | Ga0495602_0976022 | 3300048088 | Unclassified | 560 |
| 645 | Ga0496100_0003992 | 3300048903 | Bacteria | 7756 |
| 646 | Ga0496101_0060213 | 3300048904 | Bacteria | 2754 |
| 647 | Ga0496101_0069315 | 3300048904 | Bacteria | 2580 |
| 648 | Ga0496101_0420861 | 3300048904 | Unclassified | 1053 |
| 649 | Ga0496102_0020175 | 3300048905 | Bacteria | 5885 |
| 650 | Ga0496102_0052591 | 3300048905 | Bacteria | 3712 |
| 651 | Ga0496102_0080446 | 3300048905 | Bacteria | 3002 |
| 652 | Ga0496102_0385556 | 3300048905 | Bacteria | 1319 |
| 653 | Ga0496102_0437698 | 3300048905 | Bacteria | 1227 |
| 654 | Ga0496103_0001274 | 3300048906 | Bacteria | 17183 |
| 655 | Ga0496103_0038125 | 3300048906 | Bacteria | 2947 |
| 656 | Ga0496104_0029097 | 3300048907 | Bacteria | 5123 |
| 657 | Ga0496104_0030365 | 3300048907 | Bacteria | 5022 |
| 658 | Ga0496104_0038796 | 3300048907 | Bacteria | 4458 |
| 659 | Ga0496104_0159649 | 3300048907 | Bacteria | 2163 |
| 660 | Ga0496104_0182359 | 3300048907 | Bacteria | 2010 |
| 661 | Ga0496104_0192756 | 3300048907 | Bacteria | 1950 |
| 662 | Ga0496104_0197752 | 3300048907 | Bacteria | 1922 |
| 663 | Ga0496105_0071892 | 3300048908 | Bacteria | 2859 |
| 664 | Ga0496106_0097367 | 3300048909 | Bacteria | 2278 |
| 665 | Ga0496107_0066810 | 3300048910 | Unclassified | 2607 |
| 666 | Ga0496107_0068683 | 3300048910 | Bacteria | 2572 |
| 667 | Ga0496107_0589129 | 3300048910 | Unclassified | 822 |
| 668 | Ga0496108_0126818 | 3300048911 | Bacteria | 2192 |
| 669 | Ga0496108_0144691 | 3300048911 | Unclassified | 2049 |
| 670 | Ga0496109_0067656 | 3300048912 | Bacteria | 3273 |
| 671 | Ga0496109_0349249 | 3300048912 | Bacteria | 1397 |
| 672 | Ga0496109_0453759 | 3300048912 | Bacteria | 1211 |
| 673 | Ga0496110_0344415 | 3300048913 | Bacteria | 1358 |
| 674 | Ga0496110_0494233 | 3300048913 | Unclassified | 1114 |
| 675 | Ga0496110_1126468 | 3300048913 | Unclassified | 693 |
| 676 | Ga0496112_0012633 | 3300048915 | Bacteria | 7764 |
| 677 | Ga0496112_0021290 | 3300048915 | Bacteria | 6164 |
| 678 | Ga0496112_0039769 | 3300048915 | Bacteria | 4597 |
| 679 | Ga0496112_0064923 | 3300048915 | Unclassified | 3603 |
| 680 | Ga0496112_0070705 | 3300048915 | Unclassified | 3449 |
| 681 | Ga0496112_0147705 | 3300048915 | Bacteria | 2319 |
| 682 | Ga0496112_0217167 | 3300048915 | Bacteria | 1868 |
| 683 | Ga0496112_0645843 | 3300048915 | Bacteria | 988 |
| 684 | Ga0496112_0772289 | 3300048915 | Bacteria | 886 |
| 685 | Ga0496113_0354379 | 3300048916 | Unclassified | 1177 |
| 686 | Ga0496114_0032743 | 3300048917 | Bacteria | 4281 |
| 687 | Ga0496115_0013421 | 3300048918 | Bacteria | 6197 |
| 688 | Ga0496115_0619743 | 3300048918 | Unclassified | 858 |
| 689 | Ga0496115_0865740 | 3300048918 | Unclassified | 699 |
| 690 | Ga0496115_1322355 | 3300048918 | Unclassified | 536 |
| 691 | nmdc:mga0n895_56265_c1 | 3300050512 | Unclassified | 3874 |
| 692 | nmdc:mga0rr50_310740_c1 | 3300050513 | Bacteria | 1320 |
| 693 | nmdc:mga0rr50_755312_c1 | 3300050513 | Bacteria | 830 |
| 694 | nmdc:mga08x19_186986_c1 | 3300050514 | Bacteria | 1416 |
| 695 | Ga0495612_0375883 | 3300053078 | Unclassified | 644 |
| 696 | Ga0495619_0171316 | 3300053085 | Unclassified | 1501 |
| 697 | Ga0501084_0415304 | 3300054114 | Bacteria | 1137 |
| 698 | Ga0466962_0215535 | 3300061719 | Unclassified | 939 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006163 | Ga0070715_10272486 | Ga0070715_102724862 | 127 |
| 2 | 3300035086 | Ga0373934_0031541 | Ga0373934_0031541_250_636 | 127 |
| 3 | 3300035724 | Ga0373933_0210717 | Ga0373933_0210717_404_790 | 127 |
| 4 | 3300036401 | Ga0373937_0049001 | Ga0373937_0049001_1358_1744 | 127 |
| 5 | 3300046462 | Ga0495651_0148262 | Ga0495651_0148262_890_1276 | 127 |
| 6 | 3300046543 | Ga0495645_0748140 | Ga0495645_0748140_168_554 | 127 |
| 7 | 3300046559 | Ga0495667_0264468 | Ga0495667_0264468_71_457 | 127 |
| 8 | 3300047317 | Ga0495604_0287285 | Ga0495604_0287285_349_735 | 127 |
| 9 | 3300047319 | Ga0495674_0205679 | Ga0495674_0205679_655_1041 | 127 |
| 10 | 3300047444 | Ga0495675_0083980 | Ga0495675_0083980_445_831 | 127 |
| 11 | 3300005329 | Ga0070683_100055107 | Ga0070683_1000551074 | 128 |
| 12 | 3300005329 | Ga0070683_100421325 | Ga0070683_1004213251 | 128 |
| 13 | 3300005330 | Ga0070690_100096733 | Ga0070690_1000967332 | 128 |
| 14 | 3300005336 | Ga0070680_100114432 | Ga0070680_1001144322 | 128 |
| 15 | 3300005336 | Ga0070680_101307334 | Ga0070680_1013073341 | 128 |
| 16 | 3300005337 | Ga0070682_100304981 | Ga0070682_1003049811 | 128 |
| 17 | 3300005338 | Ga0068868_100153053 | Ga0068868_1001530532 | 128 |
| 18 | 3300005338 | Ga0068868_100253272 | Ga0068868_1002532721 | 128 |
| 19 | 3300005344 | Ga0070661_100126962 | Ga0070661_1001269621 | 128 |
| 20 | 3300005355 | Ga0070671_100082778 | Ga0070671_1000827782 | 128 |
| 21 | 3300005436 | Ga0070713_101363270 | Ga0070713_1013632701 | 128 |
| 22 | 3300005436 | Ga0070713_101764982 | Ga0070713_1017649821 | 128 |
| 23 | 3300005458 | Ga0070681_10000516 | Ga0070681_1000051624 | 128 |
| 24 | 3300005458 | Ga0070681_11092446 | Ga0070681_110924461 | 128 |
| 25 | 3300005530 | Ga0070679_100179887 | Ga0070679_1001798873 | 128 |
| 26 | 3300005530 | Ga0070679_101384700 | Ga0070679_1013847001 | 128 |
| 27 | 3300005535 | Ga0070684_100250601 | Ga0070684_1002506011 | 128 |
| 28 | 3300005535 | Ga0070684_100268514 | Ga0070684_1002685141 | 128 |
| 29 | 3300005539 | Ga0068853_100215969 | Ga0068853_1002159692 | 128 |
| 30 | 3300005546 | Ga0070696_101653486 | Ga0070696_1016534862 | 128 |
| 31 | 3300005547 | Ga0070693_100137784 | Ga0070693_1001377843 | 128 |
| 32 | 3300005547 | Ga0070693_101138563 | Ga0070693_1011385631 | 128 |
| 33 | 3300005563 | Ga0068855_100035605 | Ga0068855_1000356051 | 128 |
| 34 | 3300005563 | Ga0068855_100035798 | Ga0068855_1000357981 | 128 |
| 35 | 3300005564 | Ga0070664_100318401 | Ga0070664_1003184011 | 128 |
| 36 | 3300005577 | Ga0068857_100019182 | Ga0068857_1000191825 | 128 |
| 37 | 3300005577 | Ga0068857_101917281 | Ga0068857_1019172811 | 128 |
| 38 | 3300005578 | Ga0068854_100020761 | Ga0068854_1000207613 | 128 |
| 39 | 3300005614 | Ga0068856_100024175 | Ga0068856_1000241755 | 128 |
| 40 | 3300005614 | Ga0068856_100081676 | Ga0068856_1000816761 | 128 |
| 41 | 3300005616 | Ga0068852_100062259 | Ga0068852_1000622591 | 128 |
| 42 | 3300005616 | Ga0068852_100099595 | Ga0068852_1000995951 | 128 |
| 43 | 3300005618 | Ga0068864_100204214 | Ga0068864_1002042142 | 128 |
| 44 | 3300005718 | Ga0068866_10317213 | Ga0068866_103172131 | 128 |
| 45 | 3300005841 | Ga0068863_100011279 | Ga0068863_1000112792 | 128 |
| 46 | 3300005842 | Ga0068858_100022305 | Ga0068858_1000223055 | 128 |
| 47 | 3300005842 | Ga0068858_100103720 | Ga0068858_1001037201 | 128 |
| 48 | 3300006175 | Ga0070712_100988416 | Ga0070712_1009884162 | 128 |
| 49 | 3300006237 | Ga0097621_100014867 | Ga0097621_1000148675 | 128 |
| 50 | 3300006237 | Ga0097621_100035312 | Ga0097621_1000353125 | 128 |
| 51 | 3300006358 | Ga0068871_100052347 | Ga0068871_1000523471 | 128 |
| 52 | 3300006358 | Ga0068871_100055804 | Ga0068871_1000558045 | 128 |
| 53 | 3300006881 | Ga0068865_100037406 | Ga0068865_1000374063 | 128 |
| 54 | 3300009093 | Ga0105240_10041027 | Ga0105240_100410271 | 128 |
| 55 | 3300009093 | Ga0105240_10118482 | Ga0105240_101184822 | 128 |
| 56 | 3300009098 | Ga0105245_10748058 | Ga0105245_107480582 | 128 |
| 57 | 3300009174 | Ga0105241_10283768 | Ga0105241_102837681 | 128 |
| 58 | 3300009176 | Ga0105242_10638292 | Ga0105242_106382922 | 128 |
| 59 | 3300009177 | Ga0105248_11189077 | Ga0105248_111890772 | 128 |
| 60 | 3300009545 | Ga0105237_11172531 | Ga0105237_111725312 | 128 |
| 61 | 3300009551 | Ga0105238_10000214 | Ga0105238_100002147 | 128 |
| 62 | 3300010375 | Ga0105239_10418471 | Ga0105239_104184712 | 128 |
| 63 | 3300013102 | Ga0157371_10145618 | Ga0157371_101456181 | 128 |
| 64 | 3300013105 | Ga0157369_10030146 | Ga0157369_100301465 | 128 |
| 65 | 3300013105 | Ga0157369_10169254 | Ga0157369_101692541 | 128 |
| 66 | 3300013296 | Ga0157374_10020082 | Ga0157374_100200825 | 128 |
| 67 | 3300013296 | Ga0157374_10533244 | Ga0157374_105332442 | 128 |
| 68 | 3300013297 | Ga0157378_10019523 | Ga0157378_100195235 | 128 |
| 69 | 3300013297 | Ga0157378_10110608 | Ga0157378_101106084 | 128 |
| 70 | 3300013307 | Ga0157372_10198126 | Ga0157372_101981264 | 128 |
| 71 | 3300013307 | Ga0157372_12244693 | Ga0157372_122446931 | 128 |
| 72 | 3300014325 | Ga0163163_10744433 | Ga0163163_107444332 | 128 |
| 73 | 3300014969 | Ga0157376_10004658 | Ga0157376_100046585 | 128 |
| 74 | 3300014969 | Ga0157376_10606817 | Ga0157376_106068171 | 128 |
| 75 | 3300025321 | Ga0207656_10591974 | Ga0207656_105919741 | 128 |
| 76 | 3300025899 | Ga0207642_10251058 | Ga0207642_102510581 | 128 |
| 77 | 3300025905 | Ga0207685_10362993 | Ga0207685_103629932 | 128 |
| 78 | 3300025911 | Ga0207654_10108992 | Ga0207654_101089921 | 128 |
| 79 | 3300025912 | Ga0207707_10004272 | Ga0207707_100042729 | 128 |
| 80 | 3300025912 | Ga0207707_10873381 | Ga0207707_108733812 | 128 |
| 81 | 3300025913 | Ga0207695_10220128 | Ga0207695_102201283 | 128 |
| 82 | 3300025917 | Ga0207660_10164830 | Ga0207660_101648303 | 128 |
| 83 | 3300025917 | Ga0207660_11006774 | Ga0207660_110067741 | 128 |
| 84 | 3300025920 | Ga0207649_10112564 | Ga0207649_101125643 | 128 |
| 85 | 3300025921 | Ga0207652_10008758 | Ga0207652_100087586 | 128 |
| 86 | 3300025921 | Ga0207652_11199600 | Ga0207652_111996002 | 128 |
| 87 | 3300025924 | Ga0207694_10002173 | Ga0207694_100021731 | 128 |
| 88 | 3300025924 | Ga0207694_10612603 | Ga0207694_106126031 | 128 |
| 89 | 3300025928 | Ga0207700_10103133 | Ga0207700_101031332 | 128 |
| 90 | 3300025931 | Ga0207644_10078525 | Ga0207644_100785251 | 128 |
| 91 | 3300025934 | Ga0207686_10807037 | Ga0207686_108070371 | 128 |
| 92 | 3300025938 | Ga0207704_10024083 | Ga0207704_100240833 | 128 |
| 93 | 3300025940 | Ga0207691_10632240 | Ga0207691_106322401 | 128 |
| 94 | 3300025941 | Ga0207711_10105119 | Ga0207711_101051193 | 128 |
| 95 | 3300025944 | Ga0207661_10382239 | Ga0207661_103822391 | 128 |
| 96 | 3300025944 | Ga0207661_10408868 | Ga0207661_104088681 | 128 |
| 97 | 3300025949 | Ga0207667_10002400 | Ga0207667_100024005 | 128 |
| 98 | 3300025949 | Ga0207667_10029499 | Ga0207667_100294991 | 128 |
| 99 | 3300025981 | Ga0207640_10438113 | Ga0207640_104381132 | 128 |
| 100 | 3300026023 | Ga0207677_10225514 | Ga0207677_102255143 | 128 |
| 101 | 3300026023 | Ga0207677_10397501 | Ga0207677_103975011 | 128 |
| 102 | 3300026035 | Ga0207703_10036228 | Ga0207703_100362281 | 128 |
| 103 | 3300026035 | Ga0207703_10105947 | Ga0207703_101059473 | 128 |
| 104 | 3300026041 | Ga0207639_10223605 | Ga0207639_102236052 | 128 |
| 105 | 3300026078 | Ga0207702_10138022 | Ga0207702_101380221 | 128 |
| 106 | 3300026078 | Ga0207702_10187958 | Ga0207702_101879581 | 128 |
| 107 | 3300026088 | Ga0207641_10080284 | Ga0207641_100802843 | 128 |
| 108 | 3300026095 | Ga0207676_10276247 | Ga0207676_102762471 | 128 |
| 109 | 3300026116 | Ga0207674_10184164 | Ga0207674_101841643 | 128 |
| 110 | 3300026142 | Ga0207698_11712564 | Ga0207698_117125641 | 128 |
| 111 | 3300039438 | Ga0436360_0070604 | Ga0436360_0070604_218_610 | 128 |
| 112 | 3300044694 | Ga0466963_0069414 | Ga0466963_0069414_359_751 | 128 |
| 113 | 3300048904 | Ga0496101_0420861 | Ga0496101_0420861_189_590 | 128 |
| 114 | 3300048905 | Ga0496102_0052591 | Ga0496102_0052591_974_1375 | 128 |
| 115 | 3300048907 | Ga0496104_0030365 | Ga0496104_0030365_3400_3801 | 128 |
| 116 | 3300048910 | Ga0496107_0589129 | Ga0496107_0589129_385_786 | 128 |
| 117 | 3300048911 | Ga0496108_0144691 | Ga0496108_0144691_1611_2012 | 128 |
| 118 | 3300048913 | Ga0496110_1126468 | Ga0496110_1126468_19_420 | 128 |
| 119 | 3300048915 | Ga0496112_0021290 | Ga0496112_0021290_5373_5774 | 128 |
| 120 | 3300048915 | Ga0496112_0217167 | Ga0496112_0217167_1278_1679 | 128 |
| 121 | 3300048918 | Ga0496115_0619743 | Ga0496115_0619743_153_554 | 128 |
| 122 | 3300005328 | Ga0070676_10342775 | Ga0070676_103427752 | 129 |
| 123 | 3300005329 | Ga0070683_100166343 | Ga0070683_1001663432 | 129 |
| 124 | 3300005330 | Ga0070690_100089419 | Ga0070690_1000894193 | 129 |
| 125 | 3300005331 | Ga0070670_100274203 | Ga0070670_1002742032 | 129 |
| 126 | 3300005334 | Ga0068869_100013081 | Ga0068869_1000130816 | 129 |
| 127 | 3300005338 | Ga0068868_100002034 | Ga0068868_1000020344 | 129 |
| 128 | 3300005339 | Ga0070660_101060126 | Ga0070660_1010601261 | 129 |
| 129 | 3300005343 | Ga0070687_100051207 | Ga0070687_1000512073 | 129 |
| 130 | 3300005366 | Ga0070659_100384395 | Ga0070659_1003843952 | 129 |
| 131 | 3300005434 | Ga0070709_10689149 | Ga0070709_106891492 | 129 |
| 132 | 3300005436 | Ga0070713_100013356 | Ga0070713_1000133565 | 129 |
| 133 | 3300005436 | Ga0070713_100028081 | Ga0070713_1000280815 | 129 |
| 134 | 3300005436 | Ga0070713_100387847 | Ga0070713_1003878471 | 129 |
| 135 | 3300005436 | Ga0070713_101059829 | Ga0070713_1010598291 | 129 |
| 136 | 3300005439 | Ga0070711_100301176 | Ga0070711_1003011762 | 129 |
| 137 | 3300005458 | Ga0070681_10129495 | Ga0070681_101294952 | 129 |
| 138 | 3300005530 | Ga0070679_100177179 | Ga0070679_1001771793 | 129 |
| 139 | 3300005539 | Ga0068853_100233762 | Ga0068853_1002337623 | 129 |
| 140 | 3300005539 | Ga0068853_100509544 | Ga0068853_1005095442 | 129 |
| 141 | 3300005539 | Ga0068853_100892483 | Ga0068853_1008924832 | 129 |
| 142 | 3300005563 | Ga0068855_100027325 | Ga0068855_1000273252 | 129 |
| 143 | 3300005563 | Ga0068855_100047460 | Ga0068855_1000474604 | 129 |
| 144 | 3300005563 | Ga0068855_100087385 | Ga0068855_1000873855 | 129 |
| 145 | 3300005564 | Ga0070664_100000972 | Ga0070664_10000097211 | 129 |
| 146 | 3300005577 | Ga0068857_100000335 | Ga0068857_10000033521 | 129 |
| 147 | 3300005578 | Ga0068854_100003073 | Ga0068854_1000030731 | 129 |
| 148 | 3300005614 | Ga0068856_100002426 | Ga0068856_1000024268 | 129 |
| 149 | 3300005614 | Ga0068856_100044883 | Ga0068856_1000448836 | 129 |
| 150 | 3300005614 | Ga0068856_100160862 | Ga0068856_1001608623 | 129 |
| 151 | 3300005617 | Ga0068859_100008421 | Ga0068859_1000084215 | 129 |
| 152 | 3300005618 | Ga0068864_100003998 | Ga0068864_1000039989 | 129 |
| 153 | 3300005841 | Ga0068863_100802871 | Ga0068863_1008028711 | 129 |
| 154 | 3300005842 | Ga0068858_100000404 | Ga0068858_1000004046 | 129 |
| 155 | 3300005844 | Ga0068862_100609478 | Ga0068862_1006094782 | 129 |
| 156 | 3300006028 | Ga0070717_10227267 | Ga0070717_102272673 | 129 |
| 157 | 3300006028 | Ga0070717_10237682 | Ga0070717_102376822 | 129 |
| 158 | 3300006175 | Ga0070712_100754853 | Ga0070712_1007548532 | 129 |
| 159 | 3300006175 | Ga0070712_101262539 | Ga0070712_1012625391 | 129 |
| 160 | 3300006237 | Ga0097621_100058450 | Ga0097621_1000584501 | 129 |
| 161 | 3300006881 | Ga0068865_100055090 | Ga0068865_1000550901 | 129 |
| 162 | 3300006931 | Ga0097620_100008421 | Ga0097620_1000084217 | 129 |
| 163 | 3300009093 | Ga0105240_10485544 | Ga0105240_104855441 | 129 |
| 164 | 3300009093 | Ga0105240_10560576 | Ga0105240_105605762 | 129 |
| 165 | 3300009174 | Ga0105241_10311687 | Ga0105241_103116872 | 129 |
| 166 | 3300009174 | Ga0105241_10413206 | Ga0105241_104132062 | 129 |
| 167 | 3300009174 | Ga0105241_11110069 | Ga0105241_111100692 | 129 |
| 168 | 3300009176 | Ga0105242_10112040 | Ga0105242_101120404 | 129 |
| 169 | 3300009177 | Ga0105248_10038196 | Ga0105248_100381965 | 129 |
| 170 | 3300009545 | Ga0105237_10019981 | Ga0105237_100199812 | 129 |
| 171 | 3300009545 | Ga0105237_12512891 | Ga0105237_125128911 | 129 |
| 172 | 3300009551 | Ga0105238_11306186 | Ga0105238_113061862 | 129 |
| 173 | 3300013100 | Ga0157373_10050500 | Ga0157373_100505004 | 129 |
| 174 | 3300013102 | Ga0157371_10320680 | Ga0157371_103206802 | 129 |
| 175 | 3300013104 | Ga0157370_10042321 | Ga0157370_100423213 | 129 |
| 176 | 3300013104 | Ga0157370_11581347 | Ga0157370_115813471 | 129 |
| 177 | 3300013105 | Ga0157369_10024898 | Ga0157369_100248985 | 129 |
| 178 | 3300013105 | Ga0157369_10055341 | Ga0157369_100553414 | 129 |
| 179 | 3300013296 | Ga0157374_10020608 | Ga0157374_100206082 | 129 |
| 180 | 3300013297 | Ga0157378_10000349 | Ga0157378_100003491 | 129 |
| 181 | 3300013307 | Ga0157372_10016466 | Ga0157372_100164666 | 129 |
| 182 | 3300013307 | Ga0157372_10340856 | Ga0157372_103408561 | 129 |
| 183 | 3300025898 | Ga0207692_10553051 | Ga0207692_105530512 | 129 |
| 184 | 3300025911 | Ga0207654_10217127 | Ga0207654_102171273 | 129 |
| 185 | 3300025911 | Ga0207654_10246731 | Ga0207654_102467311 | 129 |
| 186 | 3300025911 | Ga0207654_10386426 | Ga0207654_103864262 | 129 |
| 187 | 3300025912 | Ga0207707_10104125 | Ga0207707_101041252 | 129 |
| 188 | 3300025913 | Ga0207695_10039220 | Ga0207695_100392206 | 129 |
| 189 | 3300025916 | Ga0207663_10300115 | Ga0207663_103001151 | 129 |
| 190 | 3300025918 | Ga0207662_10068932 | Ga0207662_100689322 | 129 |
| 191 | 3300025919 | Ga0207657_10511540 | Ga0207657_105115401 | 129 |
| 192 | 3300025928 | Ga0207700_10001374 | Ga0207700_100013744 | 129 |
| 193 | 3300025928 | Ga0207700_10040604 | Ga0207700_100406041 | 129 |
| 194 | 3300025928 | Ga0207700_10908109 | Ga0207700_109081091 | 129 |
| 195 | 3300025928 | Ga0207700_11491342 | Ga0207700_114913421 | 129 |
| 196 | 3300025931 | Ga0207644_10549978 | Ga0207644_105499781 | 129 |
| 197 | 3300025932 | Ga0207690_10114342 | Ga0207690_101143422 | 129 |
| 198 | 3300025934 | Ga0207686_10095160 | Ga0207686_100951602 | 129 |
| 199 | 3300025937 | Ga0207669_10233361 | Ga0207669_102333612 | 129 |
| 200 | 3300025938 | Ga0207704_10038752 | Ga0207704_100387523 | 129 |
| 201 | 3300025941 | Ga0207711_10648271 | Ga0207711_106482711 | 129 |
| 202 | 3300025942 | Ga0207689_10020706 | Ga0207689_100207062 | 129 |
| 203 | 3300025944 | Ga0207661_10241521 | Ga0207661_102415212 | 129 |
| 204 | 3300025945 | Ga0207679_10022824 | Ga0207679_100228244 | 129 |
| 205 | 3300025949 | Ga0207667_10019010 | Ga0207667_100190107 | 129 |
| 206 | 3300025949 | Ga0207667_10090526 | Ga0207667_100905263 | 129 |
| 207 | 3300025981 | Ga0207640_10000843 | Ga0207640_1000084314 | 129 |
| 208 | 3300026023 | Ga0207677_10001146 | Ga0207677_1000114613 | 129 |
| 209 | 3300026035 | Ga0207703_10004390 | Ga0207703_100043909 | 129 |
| 210 | 3300026041 | Ga0207639_10072810 | Ga0207639_100728103 | 129 |
| 211 | 3300026041 | Ga0207639_10098468 | Ga0207639_100984683 | 129 |
| 212 | 3300026078 | Ga0207702_10001116 | Ga0207702_100011169 | 129 |
| 213 | 3300026078 | Ga0207702_10054228 | Ga0207702_100542282 | 129 |
| 214 | 3300026088 | Ga0207641_10636859 | Ga0207641_106368591 | 129 |
| 215 | 3300026089 | Ga0207648_10014004 | Ga0207648_100140046 | 129 |
| 216 | 3300026095 | Ga0207676_10009475 | Ga0207676_100094756 | 129 |
| 217 | 3300026116 | Ga0207674_10000269 | Ga0207674_1000026912 | 129 |
| 218 | 3300028380 | Ga0268265_10270770 | Ga0268265_102707702 | 129 |
| 219 | 3300035112 | Ga0373932_0336590 | Ga0373932_0336590_38_442 | 129 |
| 220 | 3300044684 | Ga0466966_0576756 | Ga0466966_0576756_258_650 | 129 |
| 221 | 3300044693 | Ga0466961_0303856 | Ga0466961_0303856_183_575 | 129 |
| 222 | 3300044694 | Ga0466963_0013420 | Ga0466963_0013420_3716_4108 | 129 |
| 223 | 3300044706 | Ga0466964_0040768 | Ga0466964_0040768_1414_1806 | 129 |
| 224 | 3300044719 | Ga0466971_0026254 | Ga0466971_0026254_2131_2523 | 129 |
| 225 | 3300044842 | Ga0466957_0340163 | Ga0466957_0340163_76_468 | 129 |
| 226 | 3300045049 | Ga0466959_0353015 | Ga0466959_0353015_234_626 | 129 |
| 227 | 3300045051 | Ga0451576_0725525 | Ga0451576_0725525_238_642 | 129 |
| 228 | 3300045836 | Ga0466958_0081695 | Ga0466958_0081695_107_499 | 129 |
| 229 | 3300045976 | Ga0466967_0907308 | Ga0466967_0907308_141_533 | 129 |
| 230 | 3300048912 | Ga0496109_0453759 | Ga0496109_0453759_266_670 | 129 |
| 231 | 3300048915 | Ga0496112_0012633 | Ga0496112_0012633_7180_7584 | 129 |
| 232 | 3300054114 | Ga0501084_0415304 | Ga0501084_0415304_566_1009 | 129 |
| 233 | 3300061719 | Ga0466962_0215535 | Ga0466962_0215535_520_912 | 129 |
| 234 | 3300005468 | Ga0070707_100029873 | Ga0070707_1000298736 | 130 |
| 235 | 3300014969 | Ga0157376_10129620 | Ga0157376_101296202 | 130 |
| 236 | 3300014969 | Ga0157376_10917595 | Ga0157376_109175952 | 130 |
| 237 | 3300025922 | Ga0207646_10382507 | Ga0207646_103825072 | 130 |
| 238 | 3300044735 | Ga0466968_0659183 | Ga0466968_0659183_53_463 | 130 |
| 239 | 3300004803 | Ga0058862_10022584 | Ga0058862_100225841 | 131 |
| 240 | 3300005293 | Ga0065715_10944818 | Ga0065715_109448181 | 131 |
| 241 | 3300005329 | Ga0070683_100041890 | Ga0070683_1000418902 | 131 |
| 242 | 3300005329 | Ga0070683_101134526 | Ga0070683_1011345261 | 131 |
| 243 | 3300005333 | Ga0070677_10197649 | Ga0070677_101976492 | 131 |
| 244 | 3300005334 | Ga0068869_100303751 | Ga0068869_1003037512 | 131 |
| 245 | 3300005336 | Ga0070680_100123833 | Ga0070680_1001238331 | 131 |
| 246 | 3300005338 | Ga0068868_100002728 | Ga0068868_1000027283 | 131 |
| 247 | 3300005340 | Ga0070689_100061212 | Ga0070689_1000612122 | 131 |
| 248 | 3300005341 | Ga0070691_10389028 | Ga0070691_103890281 | 131 |
| 249 | 3300005344 | Ga0070661_100048115 | Ga0070661_1000481152 | 131 |
| 250 | 3300005344 | Ga0070661_100171795 | Ga0070661_1001717951 | 131 |
| 251 | 3300005345 | Ga0070692_10802856 | Ga0070692_108028561 | 131 |
| 252 | 3300005347 | Ga0070668_100032039 | Ga0070668_1000320394 | 131 |
| 253 | 3300005353 | Ga0070669_101733371 | Ga0070669_1017333711 | 131 |
| 254 | 3300005354 | Ga0070675_101438080 | Ga0070675_1014380801 | 131 |
| 255 | 3300005356 | Ga0070674_100142743 | Ga0070674_1001427432 | 131 |
| 256 | 3300005356 | Ga0070674_100563342 | Ga0070674_1005633422 | 131 |
| 257 | 3300005365 | Ga0070688_100136020 | Ga0070688_1001360202 | 131 |
| 258 | 3300005366 | Ga0070659_100017759 | Ga0070659_1000177593 | 131 |
| 259 | 3300005367 | Ga0070667_100027674 | Ga0070667_1000276745 | 131 |
| 260 | 3300005434 | Ga0070709_10098978 | Ga0070709_100989782 | 131 |
| 261 | 3300005434 | Ga0070709_10123350 | Ga0070709_101233503 | 131 |
| 262 | 3300005434 | Ga0070709_10157464 | Ga0070709_101574642 | 131 |
| 263 | 3300005435 | Ga0070714_100112760 | Ga0070714_1001127603 | 131 |
| 264 | 3300005435 | Ga0070714_100272936 | Ga0070714_1002729362 | 131 |
| 265 | 3300005436 | Ga0070713_100097782 | Ga0070713_1000977822 | 131 |
| 266 | 3300005436 | Ga0070713_100155762 | Ga0070713_1001557622 | 131 |
| 267 | 3300005437 | Ga0070710_10025421 | Ga0070710_100254212 | 131 |
| 268 | 3300005437 | Ga0070710_10063430 | Ga0070710_100634302 | 131 |
| 269 | 3300005437 | Ga0070710_10288755 | Ga0070710_102887552 | 131 |
| 270 | 3300005437 | Ga0070710_10805971 | Ga0070710_108059711 | 131 |
| 271 | 3300005439 | Ga0070711_100001830 | Ga0070711_1000018309 | 131 |
| 272 | 3300005439 | Ga0070711_100096368 | Ga0070711_1000963683 | 131 |
| 273 | 3300005439 | Ga0070711_100566650 | Ga0070711_1005666502 | 131 |
| 274 | 3300005444 | Ga0070694_100897163 | Ga0070694_1008971631 | 131 |
| 275 | 3300005445 | Ga0070708_100076072 | Ga0070708_1000760722 | 131 |
| 276 | 3300005456 | Ga0070678_100858172 | Ga0070678_1008581721 | 131 |
| 277 | 3300005458 | Ga0070681_10303830 | Ga0070681_103038302 | 131 |
| 278 | 3300005459 | Ga0068867_100112974 | Ga0068867_1001129741 | 131 |
| 279 | 3300005466 | Ga0070685_10374665 | Ga0070685_103746652 | 131 |
| 280 | 3300005467 | Ga0070706_100001385 | Ga0070706_10000138518 | 131 |
| 281 | 3300005467 | Ga0070706_100588610 | Ga0070706_1005886102 | 131 |
| 282 | 3300005468 | Ga0070707_101924214 | Ga0070707_1019242141 | 131 |
| 283 | 3300005518 | Ga0070699_100070662 | Ga0070699_1000706623 | 131 |
| 284 | 3300005530 | Ga0070679_100077835 | Ga0070679_1000778353 | 131 |
| 285 | 3300005530 | Ga0070679_100456689 | Ga0070679_1004566892 | 131 |
| 286 | 3300005530 | Ga0070679_100937948 | Ga0070679_1009379481 | 131 |
| 287 | 3300005535 | Ga0070684_100023799 | Ga0070684_1000237993 | 131 |
| 288 | 3300005536 | Ga0070697_100000280 | Ga0070697_1000002802 | 131 |
| 289 | 3300005539 | Ga0068853_100508081 | Ga0068853_1005080812 | 131 |
| 290 | 3300005539 | Ga0068853_101122270 | Ga0068853_1011222702 | 131 |
| 291 | 3300005544 | Ga0070686_100015760 | Ga0070686_1000157605 | 131 |
| 292 | 3300005545 | Ga0070695_100118313 | Ga0070695_1001183132 | 131 |
| 293 | 3300005546 | Ga0070696_100088832 | Ga0070696_1000888323 | 131 |
| 294 | 3300005546 | Ga0070696_100509548 | Ga0070696_1005095481 | 131 |
| 295 | 3300005547 | Ga0070693_100044144 | Ga0070693_1000441442 | 131 |
| 296 | 3300005548 | Ga0070665_100014347 | Ga0070665_1000143475 | 131 |
| 297 | 3300005549 | Ga0070704_100718116 | Ga0070704_1007181161 | 131 |
| 298 | 3300005564 | Ga0070664_100013788 | Ga0070664_1000137883 | 131 |
| 299 | 3300005564 | Ga0070664_100182628 | Ga0070664_1001826281 | 131 |
| 300 | 3300005577 | Ga0068857_100788941 | Ga0068857_1007889412 | 131 |
| 301 | 3300005577 | Ga0068857_101329688 | Ga0068857_1013296881 | 131 |
| 302 | 3300005578 | Ga0068854_100010276 | Ga0068854_1000102765 | 131 |
| 303 | 3300005578 | Ga0068854_100165129 | Ga0068854_1001651291 | 131 |
| 304 | 3300005614 | Ga0068856_100005963 | Ga0068856_1000059638 | 131 |
| 305 | 3300005614 | Ga0068856_100066238 | Ga0068856_1000662382 | 131 |
| 306 | 3300005614 | Ga0068856_100744112 | Ga0068856_1007441122 | 131 |
| 307 | 3300005615 | Ga0070702_101777403 | Ga0070702_1017774031 | 131 |
| 308 | 3300005616 | Ga0068852_100042898 | Ga0068852_1000428982 | 131 |
| 309 | 3300005616 | Ga0068852_102051425 | Ga0068852_1020514251 | 131 |
| 310 | 3300005617 | Ga0068859_100015248 | Ga0068859_1000152488 | 131 |
| 311 | 3300005618 | Ga0068864_100549922 | Ga0068864_1005499223 | 131 |
| 312 | 3300005718 | Ga0068866_10028210 | Ga0068866_100282103 | 131 |
| 313 | 3300005719 | Ga0068861_100342375 | Ga0068861_1003423752 | 131 |
| 314 | 3300005834 | Ga0068851_10038848 | Ga0068851_100388483 | 131 |
| 315 | 3300005841 | Ga0068863_101163399 | Ga0068863_1011633991 | 131 |
| 316 | 3300005842 | Ga0068858_100022664 | Ga0068858_1000226646 | 131 |
| 317 | 3300005843 | Ga0068860_100192651 | Ga0068860_1001926514 | 131 |
| 318 | 3300005843 | Ga0068860_101315204 | Ga0068860_1013152041 | 131 |
| 319 | 3300005844 | Ga0068862_100013092 | Ga0068862_1000130926 | 131 |
| 320 | 3300006028 | Ga0070717_10437062 | Ga0070717_104370622 | 131 |
| 321 | 3300006163 | Ga0070715_10036685 | Ga0070715_100366853 | 131 |
| 322 | 3300006163 | Ga0070715_10065909 | Ga0070715_100659092 | 131 |
| 323 | 3300006163 | Ga0070715_10195657 | Ga0070715_101956572 | 131 |
| 324 | 3300006173 | Ga0070716_100174921 | Ga0070716_1001749212 | 131 |
| 325 | 3300006175 | Ga0070712_100000188 | Ga0070712_10000018828 | 131 |
| 326 | 3300006175 | Ga0070712_100032463 | Ga0070712_1000324633 | 131 |
| 327 | 3300006175 | Ga0070712_101271065 | Ga0070712_1012710651 | 131 |
| 328 | 3300006237 | Ga0097621_100050913 | Ga0097621_1000509134 | 131 |
| 329 | 3300006237 | Ga0097621_100098010 | Ga0097621_1000980103 | 131 |
| 330 | 3300006237 | Ga0097621_100581949 | Ga0097621_1005819492 | 131 |
| 331 | 3300006358 | Ga0068871_100026130 | Ga0068871_1000261301 | 131 |
| 332 | 3300006358 | Ga0068871_100230547 | Ga0068871_1002305473 | 131 |
| 333 | 3300006871 | Ga0075434_100040343 | Ga0075434_1000403433 | 131 |
| 334 | 3300006881 | Ga0068865_100042312 | Ga0068865_1000423122 | 131 |
| 335 | 3300006914 | Ga0075436_100208045 | Ga0075436_1002080453 | 131 |
| 336 | 3300006931 | Ga0097620_100015253 | Ga0097620_1000152538 | 131 |
| 337 | 3300007076 | Ga0075435_100175674 | Ga0075435_1001756743 | 131 |
| 338 | 3300007076 | Ga0075435_100212654 | Ga0075435_1002126543 | 131 |
| 339 | 3300007788 | Ga0099795_10079371 | Ga0099795_100793711 | 131 |
| 340 | 3300009093 | Ga0105240_10173529 | Ga0105240_101735291 | 131 |
| 341 | 3300009093 | Ga0105240_10192360 | Ga0105240_101923602 | 131 |
| 342 | 3300009098 | Ga0105245_10178532 | Ga0105245_101785322 | 131 |
| 343 | 3300009098 | Ga0105245_10658879 | Ga0105245_106588791 | 131 |
| 344 | 3300009101 | Ga0105247_10061643 | Ga0105247_100616432 | 131 |
| 345 | 3300009101 | Ga0105247_10096097 | Ga0105247_100960972 | 131 |
| 346 | 3300009101 | Ga0105247_10347377 | Ga0105247_103473772 | 131 |
| 347 | 3300009148 | Ga0105243_10621312 | Ga0105243_106213122 | 131 |
| 348 | 3300009174 | Ga0105241_10004558 | Ga0105241_100045585 | 131 |
| 349 | 3300009174 | Ga0105241_10008879 | Ga0105241_100088794 | 131 |
| 350 | 3300009174 | Ga0105241_10014156 | Ga0105241_100141562 | 131 |
| 351 | 3300009174 | Ga0105241_10041998 | Ga0105241_100419984 | 131 |
| 352 | 3300009176 | Ga0105242_10309510 | Ga0105242_103095103 | 131 |
| 353 | 3300009176 | Ga0105242_10632175 | Ga0105242_106321752 | 131 |
| 354 | 3300009177 | Ga0105248_10011433 | Ga0105248_100114334 | 131 |
| 355 | 3300009177 | Ga0105248_10083865 | Ga0105248_100838653 | 131 |
| 356 | 3300009545 | Ga0105237_10013626 | Ga0105237_100136266 | 131 |
| 357 | 3300009545 | Ga0105237_10129661 | Ga0105237_101296612 | 131 |
| 358 | 3300009545 | Ga0105237_10179233 | Ga0105237_101792332 | 131 |
| 359 | 3300009545 | Ga0105237_10392500 | Ga0105237_103925002 | 131 |
| 360 | 3300009551 | Ga0105238_10058700 | Ga0105238_100587004 | 131 |
| 361 | 3300009551 | Ga0105238_11284079 | Ga0105238_112840791 | 131 |
| 362 | 3300009553 | Ga0105249_10128144 | Ga0105249_101281442 | 131 |
| 363 | 3300010375 | Ga0105239_10747253 | Ga0105239_107472532 | 131 |
| 364 | 3300011119 | Ga0105246_10031095 | Ga0105246_100310953 | 131 |
| 365 | 3300011119 | Ga0105246_10073637 | Ga0105246_100736372 | 131 |
| 366 | 3300013100 | Ga0157373_10002307 | Ga0157373_100023073 | 131 |
| 367 | 3300013102 | Ga0157371_10522301 | Ga0157371_105223011 | 131 |
| 368 | 3300013104 | Ga0157370_10062571 | Ga0157370_100625713 | 131 |
| 369 | 3300013104 | Ga0157370_10823399 | Ga0157370_108233992 | 131 |
| 370 | 3300013105 | Ga0157369_10017191 | Ga0157369_100171913 | 131 |
| 371 | 3300013105 | Ga0157369_10030474 | Ga0157369_100304746 | 131 |
| 372 | 3300013296 | Ga0157374_10002353 | Ga0157374_100023532 | 131 |
| 373 | 3300013296 | Ga0157374_10007704 | Ga0157374_100077047 | 131 |
| 374 | 3300013296 | Ga0157374_10136470 | Ga0157374_101364702 | 131 |
| 375 | 3300013296 | Ga0157374_10493097 | Ga0157374_104930971 | 131 |
| 376 | 3300013296 | Ga0157374_11508064 | Ga0157374_115080641 | 131 |
| 377 | 3300013297 | Ga0157378_10012660 | Ga0157378_100126604 | 131 |
| 378 | 3300013297 | Ga0157378_10223860 | Ga0157378_102238602 | 131 |
| 379 | 3300013297 | Ga0157378_10284258 | Ga0157378_102842582 | 131 |
| 380 | 3300013297 | Ga0157378_10578669 | Ga0157378_105786692 | 131 |
| 381 | 3300013306 | Ga0163162_10001352 | Ga0163162_100013523 | 131 |
| 382 | 3300013306 | Ga0163162_10076008 | Ga0163162_100760083 | 131 |
| 383 | 3300013307 | Ga0157372_10021505 | Ga0157372_100215055 | 131 |
| 384 | 3300013308 | Ga0157375_10073391 | Ga0157375_100733914 | 131 |
| 385 | 3300014325 | Ga0163163_10137406 | Ga0163163_101374062 | 131 |
| 386 | 3300014325 | Ga0163163_10308668 | Ga0163163_103086682 | 131 |
| 387 | 3300014497 | Ga0182008_10166695 | Ga0182008_101666952 | 131 |
| 388 | 3300014745 | Ga0157377_10230735 | Ga0157377_102307351 | 131 |
| 389 | 3300014968 | Ga0157379_10014470 | Ga0157379_100144702 | 131 |
| 390 | 3300014969 | Ga0157376_10029979 | Ga0157376_100299792 | 131 |
| 391 | 3300014969 | Ga0157376_10156827 | Ga0157376_101568272 | 131 |
| 392 | 3300017792 | Ga0163161_10454448 | Ga0163161_104544482 | 131 |
| 393 | 3300020080 | Ga0206350_10799557 | Ga0206350_107995571 | 131 |
| 394 | 3300025898 | Ga0207692_10038564 | Ga0207692_100385643 | 131 |
| 395 | 3300025898 | Ga0207692_10232322 | Ga0207692_102323221 | 131 |
| 396 | 3300025898 | Ga0207692_10287795 | Ga0207692_102877951 | 131 |
| 397 | 3300025898 | Ga0207692_10808708 | Ga0207692_108087081 | 131 |
| 398 | 3300025899 | Ga0207642_10353709 | Ga0207642_103537091 | 131 |
| 399 | 3300025900 | Ga0207710_10127567 | Ga0207710_101275671 | 131 |
| 400 | 3300025904 | Ga0207647_10056919 | Ga0207647_100569192 | 131 |
| 401 | 3300025905 | Ga0207685_10121840 | Ga0207685_101218401 | 131 |
| 402 | 3300025905 | Ga0207685_10143577 | Ga0207685_101435772 | 131 |
| 403 | 3300025905 | Ga0207685_10265566 | Ga0207685_102655661 | 131 |
| 404 | 3300025906 | Ga0207699_10061308 | Ga0207699_100613081 | 131 |
| 405 | 3300025906 | Ga0207699_10347228 | Ga0207699_103472282 | 131 |
| 406 | 3300025906 | Ga0207699_10491028 | Ga0207699_104910281 | 131 |
| 407 | 3300025907 | Ga0207645_10011239 | Ga0207645_100112396 | 131 |
| 408 | 3300025910 | Ga0207684_10005360 | Ga0207684_100053604 | 131 |
| 409 | 3300025911 | Ga0207654_10003381 | Ga0207654_100033816 | 131 |
| 410 | 3300025911 | Ga0207654_10005928 | Ga0207654_100059285 | 131 |
| 411 | 3300025911 | Ga0207654_10072931 | Ga0207654_100729312 | 131 |
| 412 | 3300025911 | Ga0207654_10839063 | Ga0207654_108390631 | 131 |
| 413 | 3300025912 | Ga0207707_10014133 | Ga0207707_100141331 | 131 |
| 414 | 3300025912 | Ga0207707_10512052 | Ga0207707_105120522 | 131 |
| 415 | 3300025913 | Ga0207695_10006382 | Ga0207695_1000638210 | 131 |
| 416 | 3300025913 | Ga0207695_10259566 | Ga0207695_102595662 | 131 |
| 417 | 3300025914 | Ga0207671_10011713 | Ga0207671_100117131 | 131 |
| 418 | 3300025914 | Ga0207671_10299163 | Ga0207671_102991632 | 131 |
| 419 | 3300025915 | Ga0207693_10000524 | Ga0207693_1000052412 | 131 |
| 420 | 3300025915 | Ga0207693_10008223 | Ga0207693_100082235 | 131 |
| 421 | 3300025916 | Ga0207663_10002678 | Ga0207663_100026788 | 131 |
| 422 | 3300025916 | Ga0207663_10172934 | Ga0207663_101729342 | 131 |
| 423 | 3300025916 | Ga0207663_10474092 | Ga0207663_104740922 | 131 |
| 424 | 3300025916 | Ga0207663_10779602 | Ga0207663_107796022 | 131 |
| 425 | 3300025917 | Ga0207660_10647908 | Ga0207660_106479081 | 131 |
| 426 | 3300025919 | Ga0207657_10004544 | Ga0207657_1000454412 | 131 |
| 427 | 3300025920 | Ga0207649_10494298 | Ga0207649_104942982 | 131 |
| 428 | 3300025920 | Ga0207649_10735469 | Ga0207649_107354692 | 131 |
| 429 | 3300025921 | Ga0207652_10039789 | Ga0207652_100397894 | 131 |
| 430 | 3300025921 | Ga0207652_10601787 | Ga0207652_106017871 | 131 |
| 431 | 3300025923 | Ga0207681_10806896 | Ga0207681_108068962 | 131 |
| 432 | 3300025924 | Ga0207694_10015779 | Ga0207694_100157791 | 131 |
| 433 | 3300025926 | Ga0207659_11260092 | Ga0207659_112600921 | 131 |
| 434 | 3300025927 | Ga0207687_10145120 | Ga0207687_101451202 | 131 |
| 435 | 3300025927 | Ga0207687_10739627 | Ga0207687_107396271 | 131 |
| 436 | 3300025928 | Ga0207700_10076042 | Ga0207700_100760422 | 131 |
| 437 | 3300025928 | Ga0207700_10416726 | Ga0207700_104167262 | 131 |
| 438 | 3300025929 | Ga0207664_10233707 | Ga0207664_102337071 | 131 |
| 439 | 3300025929 | Ga0207664_10465584 | Ga0207664_104655842 | 131 |
| 440 | 3300025932 | Ga0207690_10025625 | Ga0207690_100256251 | 131 |
| 441 | 3300025933 | Ga0207706_10003412 | Ga0207706_1000341211 | 131 |
| 442 | 3300025934 | Ga0207686_10042114 | Ga0207686_100421143 | 131 |
| 443 | 3300025936 | Ga0207670_10297659 | Ga0207670_102976591 | 131 |
| 444 | 3300025938 | Ga0207704_10468247 | Ga0207704_104682471 | 131 |
| 445 | 3300025939 | Ga0207665_10011949 | Ga0207665_100119494 | 131 |
| 446 | 3300025939 | Ga0207665_10104733 | Ga0207665_101047332 | 131 |
| 447 | 3300025939 | Ga0207665_10366422 | Ga0207665_103664222 | 131 |
| 448 | 3300025939 | Ga0207665_11251009 | Ga0207665_112510091 | 131 |
| 449 | 3300025941 | Ga0207711_10054490 | Ga0207711_100544903 | 131 |
| 450 | 3300025941 | Ga0207711_10283757 | Ga0207711_102837572 | 131 |
| 451 | 3300025942 | Ga0207689_10363656 | Ga0207689_103636561 | 131 |
| 452 | 3300025944 | Ga0207661_10614299 | Ga0207661_106142991 | 131 |
| 453 | 3300025945 | Ga0207679_10065896 | Ga0207679_100658963 | 131 |
| 454 | 3300025949 | Ga0207667_10016948 | Ga0207667_100169484 | 131 |
| 455 | 3300025961 | Ga0207712_10030782 | Ga0207712_100307824 | 131 |
| 456 | 3300025972 | Ga0207668_10014196 | Ga0207668_100141963 | 131 |
| 457 | 3300025981 | Ga0207640_10166240 | Ga0207640_101662403 | 131 |
| 458 | 3300025981 | Ga0207640_10191715 | Ga0207640_101917152 | 131 |
| 459 | 3300025986 | Ga0207658_10013917 | Ga0207658_100139171 | 131 |
| 460 | 3300026023 | Ga0207677_10035986 | Ga0207677_100359862 | 131 |
| 461 | 3300026041 | Ga0207639_10607341 | Ga0207639_106073412 | 131 |
| 462 | 3300026041 | Ga0207639_10760155 | Ga0207639_107601551 | 131 |
| 463 | 3300026067 | Ga0207678_10001295 | Ga0207678_1000129512 | 131 |
| 464 | 3300026078 | Ga0207702_10010710 | Ga0207702_100107105 | 131 |
| 465 | 3300026078 | Ga0207702_10070660 | Ga0207702_100706603 | 131 |
| 466 | 3300026078 | Ga0207702_10758828 | Ga0207702_107588281 | 131 |
| 467 | 3300026088 | Ga0207641_10078848 | Ga0207641_100788482 | 131 |
| 468 | 3300026088 | Ga0207641_10186602 | Ga0207641_101866022 | 131 |
| 469 | 3300026089 | Ga0207648_10034800 | Ga0207648_100348004 | 131 |
| 470 | 3300026095 | Ga0207676_11394991 | Ga0207676_113949911 | 131 |
| 471 | 3300026116 | Ga0207674_10213170 | Ga0207674_102131703 | 131 |
| 472 | 3300026116 | Ga0207674_11363048 | Ga0207674_113630482 | 131 |
| 473 | 3300026118 | Ga0207675_100106135 | Ga0207675_1001061352 | 131 |
| 474 | 3300026121 | Ga0207683_10195001 | Ga0207683_101950013 | 131 |
| 475 | 3300026142 | Ga0207698_10280822 | Ga0207698_102808221 | 131 |
| 476 | 3300026142 | Ga0207698_11481623 | Ga0207698_114816231 | 131 |
| 477 | 3300028379 | Ga0268266_10249239 | Ga0268266_102492393 | 131 |
| 478 | 3300028379 | Ga0268266_10389584 | Ga0268266_103895842 | 131 |
| 479 | 3300028380 | Ga0268265_10557891 | Ga0268265_105578912 | 131 |
| 480 | 3300028381 | Ga0268264_10142842 | Ga0268264_101428423 | 131 |
| 481 | 3300031247 | Ga0265340_10038300 | Ga0265340_100383001 | 131 |
| 482 | 3300031249 | Ga0265339_10137655 | Ga0265339_101376551 | 131 |
| 483 | 3300031711 | Ga0265314_10080770 | Ga0265314_100807703 | 131 |
| 484 | 3300034816 | Ga0373930_0002850 | Ga0373930_0002850_1521_1919 | 131 |
| 485 | 3300034820 | Ga0373959_0066820 | Ga0373959_0066820_287_685 | 131 |
| 486 | 3300035083 | Ga0373926_0150539 | Ga0373926_0150539_68_466 | 131 |
| 487 | 3300035083 | Ga0373926_0277610 | Ga0373926_0277610_179_577 | 131 |
| 488 | 3300035084 | Ga0373928_0177448 | Ga0373928_0177448_170_568 | 131 |
| 489 | 3300035085 | Ga0373929_0101812 | Ga0373929_0101812_255_653 | 131 |
| 490 | 3300035085 | Ga0373929_0195494 | Ga0373929_0195494_114_512 | 131 |
| 491 | 3300035088 | Ga0373940_0012610 | Ga0373940_0012610_770_1168 | 131 |
| 492 | 3300035092 | Ga0373952_0061248 | Ga0373952_0061248_255_653 | 131 |
| 493 | 3300035112 | Ga0373932_0031152 | Ga0373932_0031152_212_610 | 131 |
| 494 | 3300035115 | Ga0373941_0075026 | Ga0373941_0075026_303_701 | 131 |
| 495 | 3300035170 | Ga0373943_0458486 | Ga0373943_0458486_25_423 | 131 |
| 496 | 3300035172 | Ga0373955_0105875 | Ga0373955_0105875_761_1159 | 131 |
| 497 | 3300035207 | Ga0373942_0095494 | Ga0373942_0095494_67_465 | 131 |
| 498 | 3300035241 | Ga0373961_0290109 | Ga0373961_0290109_129_527 | 131 |
| 499 | 3300035691 | Ga0373931_0070609 | Ga0373931_0070609_1112_1510 | 131 |
| 500 | 3300035691 | Ga0373931_0165397 | Ga0373931_0165397_267_665 | 131 |
| 501 | 3300035695 | Ga0373927_0034111 | Ga0373927_0034111_1089_1487 | 131 |
| 502 | 3300035725 | Ga0373947_0957930 | Ga0373947_0957930_171_569 | 131 |
| 503 | 3300036401 | Ga0373937_0163202 | Ga0373937_0163202_226_624 | 131 |
| 504 | 3300036401 | Ga0373937_0462315 | Ga0373937_0462315_368_766 | 131 |
| 505 | 3300037068 | Ga0373925_0005643 | Ga0373925_0005643_2111_2509 | 131 |
| 506 | 3300037068 | Ga0373925_0024897 | Ga0373925_0024897_3669_4067 | 131 |
| 507 | 3300038996 | Ga0242420_008913 | Ga0242420_008913_1189_1587 | 131 |
| 508 | 3300039453 | Ga0436362_0725186 | Ga0436362_0725186_1313_1711 | 131 |
| 509 | 3300045051 | Ga0451576_1026087 | Ga0451576_1026087_419_817 | 131 |
| 510 | 3300046472 | Ga0495580_0079331 | Ga0495580_0079331_1507_1905 | 131 |
| 511 | 3300046472 | Ga0495580_0090086 | Ga0495580_0090086_517_915 | 131 |
| 512 | 3300046472 | Ga0495580_0112389 | Ga0495580_0112389_679_1077 | 131 |
| 513 | 3300046517 | Ga0495630_0107809 | Ga0495630_0107809_924_1319 | 131 |
| 514 | 3300046663 | Ga0495635_0028063 | Ga0495635_0028063_3160_3558 | 131 |
| 515 | 3300047471 | Ga0495684_0735118 | Ga0495684_0735118_143_541 | 131 |
| 516 | 3300048088 | Ga0495602_0338877 | Ga0495602_0338877_82_480 | 131 |
| 517 | 3300048903 | Ga0496100_0003992 | Ga0496100_0003992_3385_3783 | 131 |
| 518 | 3300048904 | Ga0496101_0060213 | Ga0496101_0060213_2322_2720 | 131 |
| 519 | 3300048904 | Ga0496101_0069315 | Ga0496101_0069315_294_692 | 131 |
| 520 | 3300048905 | Ga0496102_0020175 | Ga0496102_0020175_139_537 | 131 |
| 521 | 3300048905 | Ga0496102_0080446 | Ga0496102_0080446_2350_2748 | 131 |
| 522 | 3300048905 | Ga0496102_0385556 | Ga0496102_0385556_462_860 | 131 |
| 523 | 3300048905 | Ga0496102_0437698 | Ga0496102_0437698_477_875 | 131 |
| 524 | 3300048906 | Ga0496103_0001274 | Ga0496103_0001274_15650_16048 | 131 |
| 525 | 3300048906 | Ga0496103_0038125 | Ga0496103_0038125_814_1212 | 131 |
| 526 | 3300048907 | Ga0496104_0029097 | Ga0496104_0029097_3405_3803 | 131 |
| 527 | 3300048907 | Ga0496104_0038796 | Ga0496104_0038796_1976_2374 | 131 |
| 528 | 3300048907 | Ga0496104_0159649 | Ga0496104_0159649_164_562 | 131 |
| 529 | 3300048907 | Ga0496104_0182359 | Ga0496104_0182359_1594_1992 | 131 |
| 530 | 3300048907 | Ga0496104_0192756 | Ga0496104_0192756_1327_1725 | 131 |
| 531 | 3300048907 | Ga0496104_0197752 | Ga0496104_0197752_294_692 | 131 |
| 532 | 3300048908 | Ga0496105_0071892 | Ga0496105_0071892_596_994 | 131 |
| 533 | 3300048909 | Ga0496106_0097367 | Ga0496106_0097367_1688_2086 | 131 |
| 534 | 3300048910 | Ga0496107_0066810 | Ga0496107_0066810_371_769 | 131 |
| 535 | 3300048910 | Ga0496107_0068683 | Ga0496107_0068683_1127_1525 | 131 |
| 536 | 3300048911 | Ga0496108_0126818 | Ga0496108_0126818_1637_2035 | 131 |
| 537 | 3300048912 | Ga0496109_0067656 | Ga0496109_0067656_1975_2373 | 131 |
| 538 | 3300048912 | Ga0496109_0349249 | Ga0496109_0349249_917_1315 | 131 |
| 539 | 3300048913 | Ga0496110_0344415 | Ga0496110_0344415_452_850 | 131 |
| 540 | 3300048913 | Ga0496110_0494233 | Ga0496110_0494233_271_669 | 131 |
| 541 | 3300048915 | Ga0496112_0039769 | Ga0496112_0039769_2724_3122 | 131 |
| 542 | 3300048915 | Ga0496112_0064923 | Ga0496112_0064923_2964_3362 | 131 |
| 543 | 3300048915 | Ga0496112_0070705 | Ga0496112_0070705_1625_2020 | 131 |
| 544 | 3300048915 | Ga0496112_0772289 | Ga0496112_0772289_428_826 | 131 |
| 545 | 3300048916 | Ga0496113_0354379 | Ga0496113_0354379_730_1128 | 131 |
| 546 | 3300048917 | Ga0496114_0032743 | Ga0496114_0032743_1618_2016 | 131 |
| 547 | 3300048918 | Ga0496115_0013421 | Ga0496115_0013421_1656_2054 | 131 |
| 548 | 3300048918 | Ga0496115_0865740 | Ga0496115_0865740_260_658 | 131 |
| 549 | 3300048918 | Ga0496115_1322355 | Ga0496115_1322355_105_503 | 131 |
| 550 | 3300050512 | nmdc:mga0n895_56265_c1 | nmdc:mga0n895_56265_c1_1405_1803 | 131 |
| 551 | 3300050513 | nmdc:mga0rr50_310740_c1 | nmdc:mga0rr50_310740_c1_67_465 | 131 |
| 552 | 3300050513 | nmdc:mga0rr50_755312_c1 | nmdc:mga0rr50_755312_c1_34_432 | 131 |
| 553 | 3300050514 | nmdc:mga08x19_186986_c1 | nmdc:mga08x19_186986_c1_350_748 | 131 |
| 554 | 3300053078 | Ga0495612_0375883 | Ga0495612_0375883_208_627 | 131 |
| 555 | 3300053085 | Ga0495619_0171316 | Ga0495619_0171316_1079_1477 | 131 |
| 556 | 3300005436 | Ga0070713_100054800 | Ga0070713_1000548003 | 132 |
| 557 | 3300005437 | Ga0070710_10005330 | Ga0070710_100053303 | 132 |
| 558 | 3300005437 | Ga0070710_10181924 | Ga0070710_101819241 | 132 |
| 559 | 3300005445 | Ga0070708_100612428 | Ga0070708_1006124282 | 132 |
| 560 | 3300005468 | Ga0070707_100460253 | Ga0070707_1004602532 | 132 |
| 561 | 3300005468 | Ga0070707_101662294 | Ga0070707_1016622941 | 132 |
| 562 | 3300005468 | Ga0070707_101906178 | Ga0070707_1019061781 | 132 |
| 563 | 3300005471 | Ga0070698_100095532 | Ga0070698_1000955325 | 132 |
| 564 | 3300005536 | Ga0070697_100077445 | Ga0070697_1000774454 | 132 |
| 565 | 3300005564 | Ga0070664_100137058 | Ga0070664_1001370582 | 132 |
| 566 | 3300006028 | Ga0070717_10020255 | Ga0070717_100202556 | 132 |
| 567 | 3300006028 | Ga0070717_11162393 | Ga0070717_111623932 | 132 |
| 568 | 3300006163 | Ga0070715_10019936 | Ga0070715_100199362 | 132 |
| 569 | 3300006173 | Ga0070716_100000719 | Ga0070716_10000071914 | 132 |
| 570 | 3300006173 | Ga0070716_100764457 | Ga0070716_1007644571 | 132 |
| 571 | 3300006175 | Ga0070712_100002110 | Ga0070712_1000021107 | 132 |
| 572 | 3300006358 | Ga0068871_100048947 | Ga0068871_1000489473 | 132 |
| 573 | 3300007076 | Ga0075435_101521949 | Ga0075435_1015219491 | 132 |
| 574 | 3300009093 | Ga0105240_10228981 | Ga0105240_102289812 | 132 |
| 575 | 3300009101 | Ga0105247_10295200 | Ga0105247_102952001 | 132 |
| 576 | 3300009545 | Ga0105237_10403347 | Ga0105237_104033471 | 132 |
| 577 | 3300009545 | Ga0105237_10469160 | Ga0105237_104691601 | 132 |
| 578 | 3300010159 | Ga0099796_10070296 | Ga0099796_100702962 | 132 |
| 579 | 3300013100 | Ga0157373_10341583 | Ga0157373_103415831 | 132 |
| 580 | 3300013296 | Ga0157374_10112592 | Ga0157374_101125924 | 132 |
| 581 | 3300013307 | Ga0157372_10009551 | Ga0157372_100095512 | 132 |
| 582 | 3300013307 | Ga0157372_10449539 | Ga0157372_104495393 | 132 |
| 583 | 3300025898 | Ga0207692_10051885 | Ga0207692_100518851 | 132 |
| 584 | 3300025905 | Ga0207685_10010487 | Ga0207685_100104872 | 132 |
| 585 | 3300025906 | Ga0207699_10005690 | Ga0207699_100056906 | 132 |
| 586 | 3300025910 | Ga0207684_10211737 | Ga0207684_102117373 | 132 |
| 587 | 3300025915 | Ga0207693_10001919 | Ga0207693_1000191910 | 132 |
| 588 | 3300025915 | Ga0207693_10025087 | Ga0207693_100250872 | 132 |
| 589 | 3300025915 | Ga0207693_10058181 | Ga0207693_100581812 | 132 |
| 590 | 3300025916 | Ga0207663_10034834 | Ga0207663_100348343 | 132 |
| 591 | 3300025922 | Ga0207646_10071842 | Ga0207646_100718423 | 132 |
| 592 | 3300025922 | Ga0207646_10338275 | Ga0207646_103382751 | 132 |
| 593 | 3300025939 | Ga0207665_10000107 | Ga0207665_1000010732 | 132 |
| 594 | 3300025939 | Ga0207665_10073929 | Ga0207665_100739294 | 132 |
| 595 | 3300025939 | Ga0207665_10116511 | Ga0207665_101165114 | 132 |
| 596 | 3300025981 | Ga0207640_10653993 | Ga0207640_106539931 | 132 |
| 597 | 3300031090 | Ga0265760_10191260 | Ga0265760_101912601 | 132 |
| 598 | 3300031235 | Ga0265330_10004603 | Ga0265330_100046032 | 132 |
| 599 | 3300035111 | Ga0373923_0687016 | Ga0373923_0687016_71_472 | 132 |
| 600 | 3300035170 | Ga0373943_0153197 | Ga0373943_0153197_66_464 | 132 |
| 601 | 3300035207 | Ga0373942_0287944 | Ga0373942_0287944_52_453 | 132 |
| 602 | 3300035410 | Ga0373924_0055565 | Ga0373924_0055565_729_1127 | 132 |
| 603 | 3300035691 | Ga0373931_0191059 | Ga0373931_0191059_415_816 | 132 |
| 604 | 3300035691 | Ga0373931_0359094 | Ga0373931_0359094_296_703 | 132 |
| 605 | 3300035692 | Ga0373935_0087992 | Ga0373935_0087992_1262_1660 | 132 |
| 606 | 3300035725 | Ga0373947_0312167 | Ga0373947_0312167_498_896 | 132 |
| 607 | 3300037853 | Ga0436364_0514138 | Ga0436364_0514138_400_801 | 132 |
| 608 | 3300037853 | Ga0436364_0801393 | Ga0436364_0801393_301_702 | 132 |
| 609 | 3300039438 | Ga0436360_0755550 | Ga0436360_0755550_52_453 | 132 |
| 610 | 3300039450 | Ga0436363_0207954 | Ga0436363_0207954_667_1068 | 132 |
| 611 | 3300039450 | Ga0436363_1196749 | Ga0436363_1196749_1919_2320 | 132 |
| 612 | 3300041496 | Ga0451839_0440554 | Ga0451839_0440554_86_484 | 132 |
| 613 | 3300045976 | Ga0466967_0008226 | Ga0466967_0008226_148_549 | 132 |
| 614 | 3300045976 | Ga0466967_0103166 | Ga0466967_0103166_960_1361 | 132 |
| 615 | 3300046472 | Ga0495580_0000750 | Ga0495580_0000750_23850_24251 | 132 |
| 616 | 3300046472 | Ga0495580_0136133 | Ga0495580_0136133_961_1362 | 132 |
| 617 | 3300046472 | Ga0495580_0189941 | Ga0495580_0189941_471_869 | 132 |
| 618 | 3300046675 | Ga0495657_0462504 | Ga0495657_0462504_12_410 | 132 |
| 619 | 3300048088 | Ga0495602_0976022 | Ga0495602_0976022_98_496 | 132 |
| 620 | 3300048915 | Ga0496112_0147705 | Ga0496112_0147705_830_1237 | 132 |
| 621 | 3300048915 | Ga0496112_0645843 | Ga0496112_0645843_557_955 | 132 |
| 622 | 3300005434 | Ga0070709_10032620 | Ga0070709_100326203 | 133 |
| 623 | 3300005436 | Ga0070713_100149313 | Ga0070713_1001493132 | 133 |
| 624 | 3300005436 | Ga0070713_100902106 | Ga0070713_1009021061 | 133 |
| 625 | 3300006173 | Ga0070716_100337527 | Ga0070716_1003375272 | 133 |
| 626 | 3300006175 | Ga0070712_100100205 | Ga0070712_1001002052 | 133 |
| 627 | 3300007076 | Ga0075435_101639253 | Ga0075435_1016392531 | 133 |
| 628 | 3300010159 | Ga0099796_10400096 | Ga0099796_104000961 | 133 |
| 629 | 3300025906 | Ga0207699_10289543 | Ga0207699_102895431 | 133 |
| 630 | 3300025915 | Ga0207693_10013982 | Ga0207693_100139825 | 133 |
| 631 | 3300025928 | Ga0207700_10003931 | Ga0207700_100039315 | 133 |
| 632 | 3300025928 | Ga0207700_10053055 | Ga0207700_100530552 | 133 |
| 633 | 3300025929 | Ga0207664_10222907 | Ga0207664_102229072 | 133 |
| 634 | 3300025939 | Ga0207665_10439160 | Ga0207665_104391601 | 133 |
| 635 | 3300028800 | Ga0265338_10350962 | Ga0265338_103509622 | 133 |
| 636 | 3300031090 | Ga0265760_10049819 | Ga0265760_100498191 | 133 |
| 637 | 3300031344 | Ga0265316_10005636 | Ga0265316_100056364 | 133 |
| 638 | 3300031344 | Ga0265316_10069349 | Ga0265316_100693491 | 133 |
| 639 | 3300031711 | Ga0265314_10000348 | Ga0265314_1000034859 | 133 |
| 640 | 3300000546 | LJNas_1000091 | LJNas_10000912 | 134 |
| 641 | 3300005334 | Ga0068869_101598788 | Ga0068869_1015987881 | 134 |
| 642 | 3300005338 | Ga0068868_100502822 | Ga0068868_1005028221 | 134 |
| 643 | 3300005434 | Ga0070709_10021013 | Ga0070709_100210135 | 134 |
| 644 | 3300005434 | Ga0070709_11436913 | Ga0070709_114369131 | 134 |
| 645 | 3300005435 | Ga0070714_101037114 | Ga0070714_1010371141 | 134 |
| 646 | 3300005435 | Ga0070714_101072905 | Ga0070714_1010729051 | 134 |
| 647 | 3300005436 | Ga0070713_100701449 | Ga0070713_1007014491 | 134 |
| 648 | 3300005437 | Ga0070710_10146232 | Ga0070710_101462322 | 134 |
| 649 | 3300005445 | Ga0070708_100134356 | Ga0070708_1001343562 | 134 |
| 650 | 3300005458 | Ga0070681_10177382 | Ga0070681_101773822 | 134 |
| 651 | 3300005467 | Ga0070706_100493890 | Ga0070706_1004938902 | 134 |
| 652 | 3300005468 | Ga0070707_101167353 | Ga0070707_1011673532 | 134 |
| 653 | 3300005518 | Ga0070699_100020676 | Ga0070699_1000206766 | 134 |
| 654 | 3300005530 | Ga0070679_100251909 | Ga0070679_1002519092 | 134 |
| 655 | 3300005578 | Ga0068854_100527621 | Ga0068854_1005276211 | 134 |
| 656 | 3300005614 | Ga0068856_100807791 | Ga0068856_1008077912 | 134 |
| 657 | 3300006028 | Ga0070717_10102757 | Ga0070717_101027575 | 134 |
| 658 | 3300006028 | Ga0070717_10283545 | Ga0070717_102835452 | 134 |
| 659 | 3300006028 | Ga0070717_10309452 | Ga0070717_103094521 | 134 |
| 660 | 3300006173 | Ga0070716_101321018 | Ga0070716_1013210181 | 134 |
| 661 | 3300006175 | Ga0070712_100638822 | Ga0070712_1006388221 | 134 |
| 662 | 3300006175 | Ga0070712_100728309 | Ga0070712_1007283091 | 134 |
| 663 | 3300009174 | Ga0105241_11614339 | Ga0105241_116143391 | 134 |
| 664 | 3300010159 | Ga0099796_10154955 | Ga0099796_101549551 | 134 |
| 665 | 3300022732 | Ga0224569_100417 | Ga0224569_1004171 | 134 |
| 666 | 3300022732 | Ga0224569_101519 | Ga0224569_1015192 | 134 |
| 667 | 3300024225 | Ga0224572_1043589 | Ga0224572_10435892 | 134 |
| 668 | 3300024227 | Ga0228598_1000610 | Ga0228598_10006102 | 134 |
| 669 | 3300024227 | Ga0228598_1017198 | Ga0228598_10171982 | 134 |
| 670 | 3300025898 | Ga0207692_10075763 | Ga0207692_100757632 | 134 |
| 671 | 3300025906 | Ga0207699_10139396 | Ga0207699_101393961 | 134 |
| 672 | 3300025913 | Ga0207695_10059977 | Ga0207695_100599772 | 134 |
| 673 | 3300025914 | Ga0207671_10138997 | Ga0207671_101389973 | 134 |
| 674 | 3300025916 | Ga0207663_10072437 | Ga0207663_100724372 | 134 |
| 675 | 3300025921 | Ga0207652_10236677 | Ga0207652_102366772 | 134 |
| 676 | 3300025928 | Ga0207700_10622073 | Ga0207700_106220731 | 134 |
| 677 | 3300025939 | Ga0207665_10002111 | Ga0207665_100021117 | 134 |
| 678 | 3300025939 | Ga0207665_10935426 | Ga0207665_109354261 | 134 |
| 679 | 3300026078 | Ga0207702_10033937 | Ga0207702_100339375 | 134 |
| 680 | 3300028017 | Ga0265356_1007564 | Ga0265356_10075642 | 134 |
| 681 | 3300030760 | Ga0265762_1000946 | Ga0265762_10009464 | 134 |
| 682 | 3300030760 | Ga0265762_1009970 | Ga0265762_10099701 | 134 |
| 683 | 3300030760 | Ga0265762_1011930 | Ga0265762_10119302 | 134 |
| 684 | 3300031090 | Ga0265760_10001451 | Ga0265760_100014512 | 134 |
| 685 | 3300031090 | Ga0265760_10066660 | Ga0265760_100666601 | 134 |
| 686 | 3300031241 | Ga0265325_10081869 | Ga0265325_100818692 | 134 |
| 687 | 3300031712 | Ga0265342_10105979 | Ga0265342_101059792 | 134 |
| 688 | 3300033547 | Ga0316212_1010514 | Ga0316212_10105142 | 134 |
| 689 | 3300035083 | Ga0373926_0120020 | Ga0373926_0120020_89_493 | 134 |
| 690 | 3300037068 | Ga0373925_0576270 | Ga0373925_0576270_504_908 | 134 |
| 691 | 3300037068 | Ga0373925_0596540 | Ga0373925_0596540_53_457 | 134 |
| 692 | 3300046472 | Ga0495580_0018203 | Ga0495580_0018203_1147_1551 | 134 |
| 693 | 3300046472 | Ga0495580_0641467 | Ga0495580_0641467_257_661 | 134 |
| 694 | 3300046473 | Ga0495582_0100397 | Ga0495582_0100397_968_1372 | 134 |
| 695 | 3300046475 | Ga0495639_0044109 | Ga0495639_0044109_931_1335 | 134 |
| 696 | 3300046690 | Ga0495624_0534024 | Ga0495624_0534024_65_469 | 134 |
| 697 | 3300047317 | Ga0495604_0313049 | Ga0495604_0313049_438_842 | 134 |
| 698 | 3300048088 | Ga0495602_0377638 | Ga0495602_0377638_492_896 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i41-assembly1.cif.gz_B | structure of the apo raca dna binding domain | 0.9086 | 23 | 86 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.9036 | 21 | 92 |
| 4r4e-assembly1.cif.gz_B | structure of glnr-dna complex | 0.8958 | 21 | 95 |
| 5c8d-assembly2.cif.gz_F | crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) | 0.8719 | 23 | 94 |
| 5c8d-assembly2.cif.gz_E | crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) | 0.8604 | 21 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i41B00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9086 | 23 | 86 | 1.10.1660.10 |
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8981 | 23 | 90 | 1.10.1660.10 |
| af_P9WME7_10_96_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8871 | 24 | 93 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8859 | 21 | 93 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8641 | 21 | 93 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2ZJ98-F1-model_v4 | MerR family transcriptional regulator | 0.9766 | 18 | 90 |
GO:0003677
GO:0003700 |
| AF-A0A7C6E2P5-F1-model_v4 | MerR family transcriptional regulator | 0.971 | 15 | 95 |
GO:0003677
GO:0003700 |
| AF-A0A521Z2B7-F1-model_v4 | MerR family transcriptional regulator | 0.9696 | 17 | 94 |
GO:0003677
GO:0003700 |
| AF-A0A3N5J0M3-F1-model_v4 | MerR family transcriptional regulator | 0.9669 | 14 | 92 |
GO:0003677
GO:0006355 |
| AF-A0A6N2CYE6-F1-model_v4 | MerR family transcriptional regulator | 0.9667 | 16 | 98 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar