F475951
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 262 | 1394 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_11365856|Ga0105240_113658561 |
| Length | 161 |
| Sequence | MNRWFDPLKQLKEKIMTLVKFNPEKRNSSLMPGFNDVFDSIFNDTFFNDRMVTRVPAVNISETENNYHVELAAPGLKKEDFKLNLERNNLTISVEQSSNHEDHQKRYSKREYSYSSFVRTFTLPESADDSQIAASYTDGILRIDIAKREEAKTVRRQIEIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 181 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 197 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 200 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 241 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 245 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 248 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 251 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 252 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 253 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 254 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 255 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 256 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 257 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 258 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 259 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 260 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 261 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 262 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.83 |
| Metatranscriptomes | 5.87 |
| Isolates | 2.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.45 |
| Nodule | 0 |
| Rhizoplane | 1.29 |
| Rhizosphere | 88.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_11365856 | 3300009093 | Bacteria | 746 |
| 2 | SwRhRL2b_contig_1006355 | 2162886007 | Bacteria | 1720 |
| 3 | SwRhRL2b_contig_1556754 | 2162886007 | Bacteria | 16121 |
| 4 | JGI24740J21852_10027978 | 3300001979 | Bacteria | 1868 |
| 5 | JGI24740J21852_10035398 | 3300001979 | Bacteria | 1562 |
| 6 | JGI24739J22299_10164898 | 3300001989 | Bacteria | 653 |
| 7 | JGI24737J22298_10002474 | 3300001990 | Bacteria | 6582 |
| 8 | JGI24737J22298_10003569 | 3300001990 | Bacteria | 5487 |
| 9 | JGI24737J22298_10015977 | 3300001990 | Bacteria | 2424 |
| 10 | JGI24737J22298_10021212 | 3300001990 | Bacteria | 2072 |
| 11 | JGI24735J21928_10000010 | 3300002067 | Bacteria | 237152 |
| 12 | JGI24735J21928_10000012 | 3300002067 | Bacteria | 208921 |
| 13 | JGI24735J21928_10045946 | 3300002067 | Bacteria | 1267 |
| 14 | JGI24735J21928_10167723 | 3300002067 | Unclassified | 635 |
| 15 | JGI24744J21845_10002117 | 3300002077 | Bacteria | 4027 |
| 16 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 17 | JGI25162J39368_1000650 | 3300002737 | Bacteria | 24576 |
| 18 | JGI25164J39214_1002804 | 3300002772 | Bacteria | 2457 |
| 19 | JGI25152J39213_1000135 | 3300002773 | Bacteria | 50172 |
| 20 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 21 | JGI25151J46595_10000005 | 3300003187 | Bacteria | 431598 |
| 22 | JGI25165J46597_1001427 | 3300003214 | Bacteria | 12848 |
| 23 | JGI25153J46596_10000018 | 3300003215 | Bacteria | 269774 |
| 24 | rootH1_10011835 | 3300003316 | Bacteria | 41523 |
| 25 | rootH1_10011835 | 3300003323 | Bacteria | 10028 |
| 26 | rootH1_10014013 | 3300003316 | Bacteria | 23740 |
| 27 | rootH1_10168250 | 3300003316 | Bacteria | 2472 |
| 28 | rootH1_10168250 | 3300003323 | Bacteria | 1556 |
| 29 | rootH2_10001530 | 3300003320 | Bacteria | 103971 |
| 30 | rootH2_10012129 | 3300003320 | Bacteria | 47530 |
| 31 | rootH2_10256500 | 3300003320 | Bacteria | 1548 |
| 32 | rootL2_10042747 | 3300003322 | Bacteria | 7766 |
| 33 | rootH1_10053839 | 3300003323 | Bacteria | 2148 |
| 34 | rootH1_10169284 | 3300003323 | Bacteria | 1517 |
| 35 | rootH1_10281210 | 3300003323 | Bacteria | 1870 |
| 36 | Ga0055529_1008634 | 3300003763 | Bacteria | 1352 |
| 37 | Ga0055536_1000012 | 3300003781 | Bacteria | 263217 |
| 38 | Ga0055536_1000073 | 3300003781 | Bacteria | 87924 |
| 39 | Ga0055530_10005870 | 3300003791 | Bacteria | 5674 |
| 40 | Ga0055530_10011938 | 3300003791 | Bacteria | 3068 |
| 41 | Ga0058863_11026128 | 3300004799 | Bacteria | 812 |
| 42 | Ga0065714_10002426 | 3300005288 | Bacteria | 21686 |
| 43 | Ga0065714_10002529 | 3300005288 | Bacteria | 16048 |
| 44 | Ga0065714_10017757 | 3300005288 | Bacteria | 2079 |
| 45 | Ga0065714_10068253 | 3300005288 | Bacteria | 4859 |
| 46 | Ga0065714_10125691 | 3300005288 | Bacteria | 1298 |
| 47 | Ga0065704_10070217 | 3300005289 | Bacteria | 69033 |
| 48 | Ga0065704_10084034 | 3300005289 | Bacteria | 3386 |
| 49 | Ga0065704_10106669 | 3300005289 | Bacteria | 2077 |
| 50 | Ga0065704_10193739 | 3300005289 | Bacteria | 1177 |
| 51 | Ga0070658_10000236 | 3300005327 | Bacteria | 48963 |
| 52 | Ga0070658_10019676 | 3300005327 | Bacteria | 5406 |
| 53 | Ga0070658_10311041 | 3300005327 | Bacteria | 1344 |
| 54 | Ga0070658_10443299 | 3300005327 | Bacteria | 1118 |
| 55 | Ga0070676_10001139 | 3300005328 | Bacteria | 13274 |
| 56 | Ga0070676_10002506 | 3300005328 | Bacteria | 9423 |
| 57 | Ga0070683_100007556 | 3300005329 | Bacteria | 9188 |
| 58 | Ga0070690_100311263 | 3300005330 | Bacteria | 1132 |
| 59 | Ga0068869_100006090 | 3300005334 | Bacteria | 7627 |
| 60 | Ga0068869_100095602 | 3300005334 | Bacteria | 2242 |
| 61 | Ga0068869_101084425 | 3300005334 | Bacteria | 700 |
| 62 | Ga0068868_100007253 | 3300005338 | Bacteria | 7884 |
| 63 | Ga0068868_100031645 | 3300005338 | Bacteria | 4066 |
| 64 | Ga0068868_100097478 | 3300005338 | Bacteria | 2376 |
| 65 | Ga0068868_100451876 | 3300005338 | Bacteria | 1118 |
| 66 | Ga0068868_100557116 | 3300005338 | Unclassified | 1011 |
| 67 | Ga0070660_100008100 | 3300005339 | Bacteria | 7344 |
| 68 | Ga0070660_100127271 | 3300005339 | Bacteria | 2036 |
| 69 | Ga0070689_100021088 | 3300005340 | Unclassified | 4844 |
| 70 | Ga0070689_100115135 | 3300005340 | Unclassified | 2143 |
| 71 | Ga0070661_100025240 | 3300005344 | Unclassified | 4271 |
| 72 | Ga0070692_10257084 | 3300005345 | Bacteria | 1048 |
| 73 | Ga0070669_100374492 | 3300005353 | Bacteria | 1160 |
| 74 | Ga0070675_100014741 | 3300005354 | Bacteria | 6167 |
| 75 | Ga0070675_100277618 | 3300005354 | Bacteria | 1472 |
| 76 | Ga0070671_100050360 | 3300005355 | Unclassified | 3464 |
| 77 | Ga0070671_100130319 | 3300005355 | Bacteria | 2118 |
| 78 | Ga0070671_100837532 | 3300005355 | Bacteria | 802 |
| 79 | Ga0070674_100208196 | 3300005356 | Bacteria | 1514 |
| 80 | Ga0070673_100002531 | 3300005364 | Bacteria | 11161 |
| 81 | Ga0070673_100047846 | 3300005364 | Unclassified | 3330 |
| 82 | Ga0070673_100197363 | 3300005364 | Bacteria | 1732 |
| 83 | Ga0070673_101072121 | 3300005364 | Unclassified | 752 |
| 84 | Ga0070688_100114517 | 3300005365 | Bacteria | 1798 |
| 85 | Ga0070659_100003119 | 3300005366 | Bacteria | 11796 |
| 86 | Ga0070659_100137141 | 3300005366 | Bacteria | 1990 |
| 87 | Ga0070659_100567360 | 3300005366 | Bacteria | 973 |
| 88 | Ga0070659_101056772 | 3300005366 | Unclassified | 714 |
| 89 | Ga0070659_101181976 | 3300005366 | Unclassified | 676 |
| 90 | Ga0070667_100128420 | 3300005367 | Unclassified | 2211 |
| 91 | Ga0070667_101015467 | 3300005367 | Bacteria | 774 |
| 92 | Ga0070663_100008275 | 3300005455 | Bacteria | 6389 |
| 93 | Ga0070663_100115703 | 3300005455 | Bacteria | 2020 |
| 94 | Ga0070663_100458463 | 3300005455 | Bacteria | 1052 |
| 95 | Ga0070662_100000246 | 3300005457 | Bacteria | 31970 |
| 96 | Ga0070662_100001095 | 3300005457 | Bacteria | 16503 |
| 97 | Ga0070662_100037600 | 3300005457 | Bacteria | 3433 |
| 98 | Ga0070662_100168796 | 3300005457 | Bacteria | 1717 |
| 99 | Ga0070662_100260355 | 3300005457 | Bacteria | 1397 |
| 100 | Ga0070681_10007244 | 3300005458 | Bacteria | 10824 |
| 101 | Ga0068867_100013459 | 3300005459 | Bacteria | 5795 |
| 102 | Ga0068867_101063338 | 3300005459 | Bacteria | 737 |
| 103 | Ga0070685_10821069 | 3300005466 | Unclassified | 687 |
| 104 | Ga0070679_100006032 | 3300005530 | Bacteria | 11275 |
| 105 | Ga0070684_100021852 | 3300005535 | Bacteria | 5330 |
| 106 | Ga0070684_100096293 | 3300005535 | Bacteria | 2638 |
| 107 | Ga0070684_100431938 | 3300005535 | Unclassified | 1216 |
| 108 | Ga0068853_100002363 | 3300005539 | Bacteria | 14114 |
| 109 | Ga0068853_100062664 | 3300005539 | Bacteria | 3219 |
| 110 | Ga0068853_100295731 | 3300005539 | Bacteria | 1495 |
| 111 | Ga0068853_100669167 | 3300005539 | Bacteria | 989 |
| 112 | Ga0068853_100986914 | 3300005539 | Bacteria | 810 |
| 113 | Ga0068853_101802855 | 3300005539 | Unclassified | 593 |
| 114 | Ga0070672_100489928 | 3300005543 | Unclassified | 1062 |
| 115 | Ga0070672_100967604 | 3300005543 | Bacteria | 753 |
| 116 | Ga0070686_100065068 | 3300005544 | Unclassified | 2367 |
| 117 | Ga0070665_100000205 | 3300005548 | Bacteria | 103515 |
| 118 | Ga0070665_100388617 | 3300005548 | Bacteria | 1403 |
| 119 | Ga0070665_100615720 | 3300005548 | Unclassified | 1099 |
| 120 | Ga0068855_100000035 | 3300005563 | Bacteria | 165487 |
| 121 | Ga0068855_100000093 | 3300005563 | Bacteria | 106968 |
| 122 | Ga0068855_100012727 | 3300005563 | Bacteria | 10147 |
| 123 | Ga0068855_100014899 | 3300005563 | Bacteria | 9365 |
| 124 | Ga0068855_100016576 | 3300005563 | Bacteria | 8861 |
| 125 | Ga0068855_100040882 | 3300005563 | Bacteria | 5499 |
| 126 | Ga0068855_100191192 | 3300005563 | Bacteria | 2309 |
| 127 | Ga0068855_100290106 | 3300005563 | Unclassified | 1814 |
| 128 | Ga0068855_100364720 | 3300005563 | Bacteria | 1589 |
| 129 | Ga0068855_100689234 | 3300005563 | Unclassified | 1094 |
| 130 | Ga0068855_100707114 | 3300005563 | Bacteria | 1078 |
| 131 | Ga0068855_100824363 | 3300005563 | Bacteria | 984 |
| 132 | Ga0070664_100151971 | 3300005564 | Bacteria | 2044 |
| 133 | Ga0070664_100826976 | 3300005564 | Bacteria | 867 |
| 134 | Ga0068857_100022854 | 3300005577 | Bacteria | 5501 |
| 135 | Ga0068857_100057970 | 3300005577 | Unclassified | 3438 |
| 136 | Ga0068857_100330718 | 3300005577 | Bacteria | 1408 |
| 137 | Ga0068857_100551105 | 3300005577 | Bacteria | 1086 |
| 138 | Ga0068854_100027212 | 3300005578 | Bacteria | 3939 |
| 139 | Ga0068854_100401573 | 3300005578 | Bacteria | 1134 |
| 140 | Ga0068856_100005796 | 3300005614 | Bacteria | 12175 |
| 141 | Ga0068856_100030077 | 3300005614 | Bacteria | 5308 |
| 142 | Ga0068856_100041415 | 3300005614 | Bacteria | 4527 |
| 143 | Ga0068856_100045088 | 3300005614 | Bacteria | 4340 |
| 144 | Ga0068856_100431243 | 3300005614 | Bacteria | 1338 |
| 145 | Ga0068852_100006455 | 3300005616 | Bacteria | 8472 |
| 146 | Ga0068852_100025960 | 3300005616 | Unclassified | 4755 |
| 147 | Ga0068852_100770274 | 3300005616 | Bacteria | 975 |
| 148 | Ga0068852_101569114 | 3300005616 | Bacteria | 681 |
| 149 | Ga0068859_100030336 | 3300005617 | Bacteria | 5425 |
| 150 | Ga0068859_100153454 | 3300005617 | Unclassified | 2379 |
| 151 | Ga0068864_100042621 | 3300005618 | Unclassified | 3884 |
| 152 | Ga0068864_100097211 | 3300005618 | Bacteria | 2607 |
| 153 | Ga0068866_10039836 | 3300005718 | Unclassified | 2322 |
| 154 | Ga0068866_11086797 | 3300005718 | Bacteria | 572 |
| 155 | Ga0068861_101591696 | 3300005719 | Bacteria | 643 |
| 156 | Ga0068851_10734154 | 3300005834 | Unclassified | 610 |
| 157 | Ga0068870_10057011 | 3300005840 | Bacteria | 2087 |
| 158 | Ga0068863_100346125 | 3300005841 | Unclassified | 1447 |
| 159 | Ga0068858_100034400 | 3300005842 | Unclassified | 4700 |
| 160 | Ga0068858_100068684 | 3300005842 | Bacteria | 3284 |
| 161 | Ga0068858_100329724 | 3300005842 | Bacteria | 1460 |
| 162 | Ga0068858_100358715 | 3300005842 | Bacteria | 1397 |
| 163 | Ga0068858_100514735 | 3300005842 | Bacteria | 1157 |
| 164 | Ga0068860_100110870 | 3300005843 | Bacteria | 2623 |
| 165 | Ga0068860_101212527 | 3300005843 | Bacteria | 775 |
| 166 | Ga0068862_100953143 | 3300005844 | Unclassified | 846 |
| 167 | Ga0075366_10001424 | 3300006195 | Bacteria | 11927 |
| 168 | Ga0075366_10002297 | 3300006195 | Bacteria | 9763 |
| 169 | Ga0075366_10003631 | 3300006195 | Bacteria | 8176 |
| 170 | Ga0075366_10070230 | 3300006195 | Bacteria | 2085 |
| 171 | Ga0097621_100000365 | 3300006237 | Bacteria | 31399 |
| 172 | Ga0097621_100031804 | 3300006237 | Unclassified | 4189 |
| 173 | Ga0075370_10413346 | 3300006353 | Bacteria | 810 |
| 174 | Ga0068871_100000248 | 3300006358 | Bacteria | 37581 |
| 175 | Ga0068871_100737074 | 3300006358 | Bacteria | 905 |
| 176 | Ga0068865_100000211 | 3300006881 | Bacteria | 32506 |
| 177 | Ga0068865_100490294 | 3300006881 | Bacteria | 1023 |
| 178 | Ga0097620_100030336 | 3300006931 | Bacteria | 5425 |
| 179 | Ga0097620_100153458 | 3300006931 | Unclassified | 2379 |
| 180 | Ga0105251_10229796 | 3300009011 | Unclassified | 835 |
| 181 | Ga0105240_10000075 | 3300009093 | Bacteria | 199596 |
| 182 | Ga0105240_10007027 | 3300009093 | Bacteria | 16425 |
| 183 | Ga0105240_10027595 | 3300009093 | Bacteria | 7432 |
| 184 | Ga0105240_10081591 | 3300009093 | Bacteria | 3974 |
| 185 | Ga0105240_10094930 | 3300009093 | Bacteria | 3637 |
| 186 | Ga0105240_10125849 | 3300009093 | Bacteria | 3080 |
| 187 | Ga0105240_10144957 | 3300009093 | Bacteria | 2835 |
| 188 | Ga0105240_10231782 | 3300009093 | Bacteria | 2145 |
| 189 | Ga0105240_10346827 | 3300009093 | Bacteria | 1685 |
| 190 | Ga0105240_10410179 | 3300009093 | Bacteria | 1524 |
| 191 | Ga0105240_10525228 | 3300009093 | Bacteria | 1313 |
| 192 | Ga0105240_10846809 | 3300009093 | Bacteria | 987 |
| 193 | Ga0105240_11144130 | 3300009093 | Bacteria | 826 |
| 194 | Ga0105240_11291299 | 3300009093 | Bacteria | 770 |
| 195 | Ga0105245_10114104 | 3300009098 | Bacteria | 2516 |
| 196 | Ga0105247_10165534 | 3300009101 | Bacteria | 1467 |
| 197 | Ga0105247_10259020 | 3300009101 | Unclassified | 1192 |
| 198 | Ga0105247_10763778 | 3300009101 | Unclassified | 734 |
| 199 | Ga0105243_10065502 | 3300009148 | Bacteria | 2919 |
| 200 | Ga0105243_10884452 | 3300009148 | Bacteria | 887 |
| 201 | Ga0105241_10001503 | 3300009174 | Bacteria | 17890 |
| 202 | Ga0105241_10001741 | 3300009174 | Bacteria | 16523 |
| 203 | Ga0105241_10001827 | 3300009174 | Bacteria | 16146 |
| 204 | Ga0105241_10085780 | 3300009174 | Bacteria | 2475 |
| 205 | Ga0105241_10312705 | 3300009174 | Bacteria | 1352 |
| 206 | Ga0105241_10487394 | 3300009174 | Bacteria | 1097 |
| 207 | Ga0105242_10103609 | 3300009176 | Bacteria | 2414 |
| 208 | Ga0105242_10152899 | 3300009176 | Bacteria | 2014 |
| 209 | Ga0105242_10219816 | 3300009176 | Bacteria | 1697 |
| 210 | Ga0105248_10112067 | 3300009177 | Unclassified | 3077 |
| 211 | Ga0105237_10000146 | 3300009545 | Bacteria | 99601 |
| 212 | Ga0105237_10000176 | 3300009545 | Bacteria | 90175 |
| 213 | Ga0105237_10002107 | 3300009545 | Bacteria | 25126 |
| 214 | Ga0105237_10003053 | 3300009545 | Bacteria | 20197 |
| 215 | Ga0105237_10008559 | 3300009545 | Bacteria | 11063 |
| 216 | Ga0105237_10080181 | 3300009545 | Bacteria | 3254 |
| 217 | Ga0105237_10129586 | 3300009545 | Bacteria | 2517 |
| 218 | Ga0105237_10272069 | 3300009545 | Bacteria | 1697 |
| 219 | Ga0105237_10463104 | 3300009545 | Unclassified | 1274 |
| 220 | Ga0105237_10760193 | 3300009545 | Bacteria | 976 |
| 221 | Ga0105237_10876609 | 3300009545 | Bacteria | 904 |
| 222 | Ga0105237_11076556 | 3300009545 | Bacteria | 811 |
| 223 | Ga0105238_10045727 | 3300009551 | Bacteria | 4422 |
| 224 | Ga0105238_10837095 | 3300009551 | Unclassified | 937 |
| 225 | Ga0105249_10321396 | 3300009553 | Unclassified | 1559 |
| 226 | Ga0105239_10000053 | 3300010375 | Bacteria | 163705 |
| 227 | Ga0105239_10000055 | 3300010375 | Bacteria | 158211 |
| 228 | Ga0105239_10000068 | 3300010375 | Bacteria | 144666 |
| 229 | Ga0105239_10000807 | 3300010375 | Bacteria | 44370 |
| 230 | Ga0105239_10022919 | 3300010375 | Bacteria | 6884 |
| 231 | Ga0105239_10097301 | 3300010375 | Bacteria | 3253 |
| 232 | Ga0105239_10229365 | 3300010375 | Bacteria | 2083 |
| 233 | Ga0105239_10309368 | 3300010375 | Bacteria | 1781 |
| 234 | Ga0105239_10345600 | 3300010375 | Bacteria | 1679 |
| 235 | Ga0105239_10728166 | 3300010375 | Bacteria | 1135 |
| 236 | Ga0105239_10930852 | 3300010375 | Bacteria | 998 |
| 237 | Ga0105239_13223206 | 3300010375 | Unclassified | 531 |
| 238 | Ga0105246_10050889 | 3300011119 | Bacteria | 2843 |
| 239 | Ga0105246_10066973 | 3300011119 | Bacteria | 2515 |
| 240 | Ga0157373_10000072 | 3300013100 | Bacteria | 88770 |
| 241 | Ga0157373_10000440 | 3300013100 | Bacteria | 32951 |
| 242 | Ga0157373_10000509 | 3300013100 | Bacteria | 30602 |
| 243 | Ga0157373_10001021 | 3300013100 | Bacteria | 21657 |
| 244 | Ga0157373_10012866 | 3300013100 | Bacteria | 6145 |
| 245 | Ga0157373_10025741 | 3300013100 | Bacteria | 4253 |
| 246 | Ga0157371_10000297 | 3300013102 | Bacteria | 65919 |
| 247 | Ga0157371_10000476 | 3300013102 | Bacteria | 49123 |
| 248 | Ga0157371_10002650 | 3300013102 | Bacteria | 16949 |
| 249 | Ga0157371_10005885 | 3300013102 | Bacteria | 10243 |
| 250 | Ga0157371_10009632 | 3300013102 | Bacteria | 7597 |
| 251 | Ga0157371_10017247 | 3300013102 | Bacteria | 5369 |
| 252 | Ga0157371_10021733 | 3300013102 | Bacteria | 4708 |
| 253 | Ga0157371_10028078 | 3300013102 | Bacteria | 4077 |
| 254 | Ga0157371_10164771 | 3300013102 | Bacteria | 1583 |
| 255 | Ga0157370_10000392 | 3300013104 | Bacteria | 55046 |
| 256 | Ga0157370_10000808 | 3300013104 | Bacteria | 39533 |
| 257 | Ga0157370_10012983 | 3300013104 | Bacteria | 8608 |
| 258 | Ga0157370_10013312 | 3300013104 | Bacteria | 8472 |
| 259 | Ga0157370_10014075 | 3300013104 | Bacteria | 8207 |
| 260 | Ga0157370_10026054 | 3300013104 | Bacteria | 5778 |
| 261 | Ga0157370_10046455 | 3300013104 | Bacteria | 4163 |
| 262 | Ga0157370_10050036 | 3300013104 | Bacteria | 3996 |
| 263 | Ga0157370_10102886 | 3300013104 | Bacteria | 2674 |
| 264 | Ga0157370_10198997 | 3300013104 | Bacteria | 1859 |
| 265 | Ga0157370_10291004 | 3300013104 | Bacteria | 1508 |
| 266 | Ga0157370_11900328 | 3300013104 | Bacteria | 534 |
| 267 | Ga0157370_12135742 | 3300013104 | Bacteria | 502 |
| 268 | Ga0157369_10008196 | 3300013105 | Bacteria | 11984 |
| 269 | Ga0157369_10066661 | 3300013105 | Bacteria | 3872 |
| 270 | Ga0157369_10076842 | 3300013105 | Bacteria | 3579 |
| 271 | Ga0157369_10174349 | 3300013105 | Bacteria | 2264 |
| 272 | Ga0157369_10292904 | 3300013105 | Bacteria | 1694 |
| 273 | Ga0157369_10429875 | 3300013105 | Bacteria | 1369 |
| 274 | Ga0157369_10753856 | 3300013105 | Unclassified | 1001 |
| 275 | Ga0157369_11498199 | 3300013105 | Bacteria | 686 |
| 276 | Ga0157374_10000892 | 3300013296 | Bacteria | 26061 |
| 277 | Ga0157374_10001869 | 3300013296 | Bacteria | 17716 |
| 278 | Ga0157374_10002138 | 3300013296 | Bacteria | 16656 |
| 279 | Ga0157374_10005402 | 3300013296 | Bacteria | 10735 |
| 280 | Ga0157374_10015783 | 3300013296 | Bacteria | 6634 |
| 281 | Ga0157374_10107528 | 3300013296 | Unclassified | 2681 |
| 282 | Ga0157374_10149710 | 3300013296 | Bacteria | 2268 |
| 283 | Ga0157374_10248486 | 3300013296 | Unclassified | 1750 |
| 284 | Ga0157374_10426654 | 3300013296 | Bacteria | 1325 |
| 285 | Ga0157378_10001635 | 3300013297 | Bacteria | 20269 |
| 286 | Ga0157378_10024130 | 3300013297 | Bacteria | 5350 |
| 287 | Ga0157378_10062163 | 3300013297 | Unclassified | 3334 |
| 288 | Ga0157378_10120761 | 3300013297 | Bacteria | 2415 |
| 289 | Ga0163162_10002205 | 3300013306 | Bacteria | 18295 |
| 290 | Ga0163162_10003610 | 3300013306 | Bacteria | 14822 |
| 291 | Ga0163162_10020777 | 3300013306 | Bacteria | 6456 |
| 292 | Ga0163162_10024846 | 3300013306 | Bacteria | 5918 |
| 293 | Ga0163162_10059313 | 3300013306 | Bacteria | 3858 |
| 294 | Ga0163162_10066005 | 3300013306 | Bacteria | 3667 |
| 295 | Ga0163162_10174952 | 3300013306 | Bacteria | 2272 |
| 296 | Ga0163162_10494069 | 3300013306 | Unclassified | 1354 |
| 297 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 298 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 299 | Ga0157372_10000285 | 3300013307 | Bacteria | 56173 |
| 300 | Ga0157372_10000398 | 3300013307 | Bacteria | 47920 |
| 301 | Ga0157372_10001410 | 3300013307 | Bacteria | 25944 |
| 302 | Ga0157372_10002663 | 3300013307 | Bacteria | 19348 |
| 303 | Ga0157372_10005240 | 3300013307 | Bacteria | 13774 |
| 304 | Ga0157372_10012648 | 3300013307 | Bacteria | 8990 |
| 305 | Ga0157372_10043903 | 3300013307 | Bacteria | 4952 |
| 306 | Ga0157372_10163638 | 3300013307 | Bacteria | 2572 |
| 307 | Ga0157372_10412129 | 3300013307 | Bacteria | 1575 |
| 308 | Ga0157372_11268274 | 3300013307 | Bacteria | 851 |
| 309 | Ga0157375_10000510 | 3300013308 | Bacteria | 34914 |
| 310 | Ga0157375_10006815 | 3300013308 | Bacteria | 9948 |
| 311 | Ga0157375_10077478 | 3300013308 | Unclassified | 3354 |
| 312 | Ga0157375_10117438 | 3300013308 | Bacteria | 2765 |
| 313 | Ga0157375_10125091 | 3300013308 | Bacteria | 2685 |
| 314 | Ga0157375_10528852 | 3300013308 | Bacteria | 1342 |
| 315 | Ga0157375_13117910 | 3300013308 | Bacteria | 553 |
| 316 | Ga0163163_10006370 | 3300014325 | Bacteria | 10304 |
| 317 | Ga0163163_10612863 | 3300014325 | Unclassified | 1152 |
| 318 | Ga0157380_11955020 | 3300014326 | Bacteria | 648 |
| 319 | Ga0182008_10000049 | 3300014497 | Bacteria | 105068 |
| 320 | Ga0182008_10179788 | 3300014497 | Bacteria | 1070 |
| 321 | Ga0157377_10029619 | 3300014745 | Bacteria | 2957 |
| 322 | Ga0157377_10055455 | 3300014745 | Bacteria | 2247 |
| 323 | Ga0157377_10440521 | 3300014745 | Unclassified | 897 |
| 324 | Ga0157379_10052504 | 3300014968 | Unclassified | 3642 |
| 325 | Ga0157379_10519677 | 3300014968 | Bacteria | 1105 |
| 326 | Ga0157376_10145156 | 3300014969 | Bacteria | 2133 |
| 327 | Ga0157376_10526493 | 3300014969 | Bacteria | 1166 |
| 328 | Ga0182006_1001021 | 3300015261 | Bacteria | 18288 |
| 329 | Ga0182006_1002334 | 3300015261 | Bacteria | 10426 |
| 330 | Ga0182007_10056804 | 3300015262 | Unclassified | 1285 |
| 331 | Ga0182007_10100020 | 3300015262 | Bacteria | 960 |
| 332 | Ga0163161_10009664 | 3300017792 | Bacteria | 6674 |
| 333 | Ga0163161_10419797 | 3300017792 | Bacteria | 1076 |
| 334 | Ga0163161_11029720 | 3300017792 | Bacteria | 704 |
| 335 | Ga0197907_10818403 | 3300020069 | Unclassified | 831 |
| 336 | Ga0197907_10843955 | 3300020069 | Bacteria | 506 |
| 337 | Ga0197907_11052318 | 3300020069 | Bacteria | 781 |
| 338 | Ga0206356_10240228 | 3300020070 | Unclassified | 599 |
| 339 | Ga0206349_1077327 | 3300020075 | Bacteria | 1276 |
| 340 | Ga0206349_1096684 | 3300020075 | Bacteria | 651 |
| 341 | Ga0206349_1210720 | 3300020075 | Bacteria | 524 |
| 342 | Ga0206349_1313684 | 3300020075 | Unclassified | 620 |
| 343 | Ga0206349_1424097 | 3300020075 | Bacteria | 551 |
| 344 | Ga0206349_1688161 | 3300020075 | Bacteria | 636 |
| 345 | Ga0206349_1720152 | 3300020075 | Bacteria | 632 |
| 346 | Ga0206349_1952962 | 3300020075 | Bacteria | 514 |
| 347 | Ga0206351_10566236 | 3300020077 | Bacteria | 1012 |
| 348 | Ga0206351_10611578 | 3300020077 | Bacteria | 641 |
| 349 | Ga0206351_10676490 | 3300020077 | Bacteria | 677 |
| 350 | Ga0206351_10687676 | 3300020077 | Bacteria | 613 |
| 351 | Ga0206351_10749691 | 3300020077 | Bacteria | 603 |
| 352 | Ga0206352_10362601 | 3300020078 | Bacteria | 1477 |
| 353 | Ga0206352_10607600 | 3300020078 | Bacteria | 507 |
| 354 | Ga0206350_10160009 | 3300020080 | Bacteria | 533 |
| 355 | Ga0206350_10837543 | 3300020080 | Bacteria | 513 |
| 356 | Ga0206350_10881467 | 3300020080 | Bacteria | 710 |
| 357 | Ga0206350_11142260 | 3300020080 | Bacteria | 799 |
| 358 | Ga0206354_10005453 | 3300020081 | Bacteria | 504 |
| 359 | Ga0206354_11556883 | 3300020081 | Bacteria | 524 |
| 360 | Ga0206353_10595393 | 3300020082 | Unclassified | 656 |
| 361 | Ga0206353_11382833 | 3300020082 | Bacteria | 517 |
| 362 | Ga0206353_11949261 | 3300020082 | Bacteria | 675 |
| 363 | Ga0206353_12036747 | 3300020082 | Bacteria | 594 |
| 364 | Ga0154015_1028243 | 3300020610 | Bacteria | 515 |
| 365 | Ga0154015_1331156 | 3300020610 | Unclassified | 507 |
| 366 | Ga0154015_1375746 | 3300020610 | Bacteria | 534 |
| 367 | Ga0154015_1596118 | 3300020610 | Bacteria | 1029 |
| 368 | Ga0154015_1688781 | 3300020610 | Bacteria | 1106 |
| 369 | Ga0224712_10054480 | 3300022467 | Bacteria | 1570 |
| 370 | Ga0224712_10121877 | 3300022467 | Bacteria | 1130 |
| 371 | Ga0224712_10174997 | 3300022467 | Bacteria | 964 |
| 372 | Ga0224712_10408725 | 3300022467 | Bacteria | 648 |
| 373 | Ga0224712_10531896 | 3300022467 | Bacteria | 570 |
| 374 | Ga0224712_10655505 | 3300022467 | Bacteria | 515 |
| 375 | Ga0209563_104145 | 3300025230 | Bacteria | 2824 |
| 376 | Ga0207427_100152 | 3300025231 | Bacteria | 78389 |
| 377 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 378 | Ga0209437_100164 | 3300025233 | Bacteria | 145317 |
| 379 | Ga0209258_122514 | 3300025242 | Bacteria | 643 |
| 380 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 381 | Ga0209026_1000745 | 3300025250 | Bacteria | 18591 |
| 382 | Ga0209026_1001228 | 3300025250 | Bacteria | 11766 |
| 383 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 384 | Ga0209129_1011588 | 3300025258 | Bacteria | 2094 |
| 385 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 386 | Ga0209233_1000787 | 3300025261 | Bacteria | 14266 |
| 387 | Ga0209455_1004925 | 3300025272 | Bacteria | 4244 |
| 388 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 389 | Ga0209676_1000042 | 3300025292 | Bacteria | 424130 |
| 390 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 391 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 392 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 393 | Ga0209050_1000035 | 3300025298 | Bacteria | 424005 |
| 394 | Ga0207697_10100216 | 3300025315 | Bacteria | 1234 |
| 395 | Ga0207656_10385006 | 3300025321 | Bacteria | 703 |
| 396 | Ga0207642_10150854 | 3300025899 | Bacteria | 1237 |
| 397 | Ga0207710_10178265 | 3300025900 | Unclassified | 1041 |
| 398 | Ga0207688_10609832 | 3300025901 | Bacteria | 688 |
| 399 | Ga0207680_10069162 | 3300025903 | Unclassified | 2181 |
| 400 | Ga0207647_10000116 | 3300025904 | Bacteria | 61857 |
| 401 | Ga0207647_10001267 | 3300025904 | Bacteria | 19442 |
| 402 | Ga0207647_10001525 | 3300025904 | Bacteria | 17818 |
| 403 | Ga0207647_10041375 | 3300025904 | Bacteria | 2897 |
| 404 | Ga0207647_10133933 | 3300025904 | Bacteria | 1455 |
| 405 | Ga0207647_10196374 | 3300025904 | Bacteria | 1168 |
| 406 | Ga0207647_10257327 | 3300025904 | Unclassified | 1000 |
| 407 | Ga0207647_10661864 | 3300025904 | Unclassified | 572 |
| 408 | Ga0207645_10000689 | 3300025907 | Bacteria | 28055 |
| 409 | Ga0207645_10001124 | 3300025907 | Bacteria | 22129 |
| 410 | Ga0207643_10613846 | 3300025908 | Bacteria | 700 |
| 411 | Ga0207705_10000111 | 3300025909 | Bacteria | 92842 |
| 412 | Ga0207705_10193237 | 3300025909 | Bacteria | 1540 |
| 413 | Ga0207705_10467219 | 3300025909 | Bacteria | 979 |
| 414 | Ga0207654_10116422 | 3300025911 | Bacteria | 1671 |
| 415 | Ga0207654_10203914 | 3300025911 | Bacteria | 1304 |
| 416 | Ga0207654_11050262 | 3300025911 | Bacteria | 593 |
| 417 | Ga0207695_10000055 | 3300025913 | Bacteria | 382776 |
| 418 | Ga0207695_10023073 | 3300025913 | Bacteria | 7043 |
| 419 | Ga0207695_10035073 | 3300025913 | Bacteria | 5445 |
| 420 | Ga0207695_10050942 | 3300025913 | Bacteria | 4351 |
| 421 | Ga0207695_10070669 | 3300025913 | Bacteria | 3567 |
| 422 | Ga0207695_10127745 | 3300025913 | Bacteria | 2502 |
| 423 | Ga0207695_10155687 | 3300025913 | Bacteria | 2220 |
| 424 | Ga0207695_10174090 | 3300025913 | Bacteria | 2075 |
| 425 | Ga0207695_10435332 | 3300025913 | Bacteria | 1195 |
| 426 | Ga0207695_10456903 | 3300025913 | Bacteria | 1160 |
| 427 | Ga0207695_10567521 | 3300025913 | Bacteria | 1016 |
| 428 | Ga0207695_10571863 | 3300025913 | Bacteria | 1011 |
| 429 | Ga0207695_10589082 | 3300025913 | Bacteria | 993 |
| 430 | Ga0207695_10845763 | 3300025913 | Bacteria | 795 |
| 431 | Ga0207695_11659058 | 3300025913 | Bacteria | 520 |
| 432 | Ga0207671_10000172 | 3300025914 | Bacteria | 99486 |
| 433 | Ga0207671_10000634 | 3300025914 | Bacteria | 46044 |
| 434 | Ga0207671_10003368 | 3300025914 | Bacteria | 16031 |
| 435 | Ga0207671_10015432 | 3300025914 | Bacteria | 5979 |
| 436 | Ga0207671_10047939 | 3300025914 | Bacteria | 3162 |
| 437 | Ga0207671_10048002 | 3300025914 | Bacteria | 3159 |
| 438 | Ga0207671_10612730 | 3300025914 | Bacteria | 867 |
| 439 | Ga0207671_10712370 | 3300025914 | Bacteria | 798 |
| 440 | Ga0207671_10781818 | 3300025914 | Bacteria | 757 |
| 441 | Ga0207660_11073784 | 3300025917 | Bacteria | 656 |
| 442 | Ga0207657_10033438 | 3300025919 | Bacteria | 4635 |
| 443 | Ga0207657_10532968 | 3300025919 | Bacteria | 919 |
| 444 | Ga0207657_10685107 | 3300025919 | Bacteria | 797 |
| 445 | Ga0207649_10031066 | 3300025920 | Bacteria | 3171 |
| 446 | Ga0207652_10030296 | 3300025921 | Bacteria | 4529 |
| 447 | Ga0207652_10619112 | 3300025921 | Bacteria | 970 |
| 448 | Ga0207652_11068991 | 3300025921 | Bacteria | 707 |
| 449 | Ga0207681_10759748 | 3300025923 | Bacteria | 808 |
| 450 | Ga0207659_10093010 | 3300025926 | Unclassified | 2256 |
| 451 | Ga0207659_10804328 | 3300025926 | Bacteria | 808 |
| 452 | Ga0207687_10127013 | 3300025927 | Bacteria | 1916 |
| 453 | Ga0207644_10179876 | 3300025931 | Bacteria | 1657 |
| 454 | Ga0207644_11286959 | 3300025931 | Bacteria | 614 |
| 455 | Ga0207690_10008615 | 3300025932 | Bacteria | 6049 |
| 456 | Ga0207690_10175474 | 3300025932 | Bacteria | 1609 |
| 457 | Ga0207690_10276611 | 3300025932 | Bacteria | 1306 |
| 458 | Ga0207690_10503563 | 3300025932 | Bacteria | 980 |
| 459 | Ga0207690_10972985 | 3300025932 | Bacteria | 705 |
| 460 | Ga0207706_10000007 | 3300025933 | Bacteria | 211081 |
| 461 | Ga0207706_10000858 | 3300025933 | Bacteria | 31307 |
| 462 | Ga0207706_10059521 | 3300025933 | Unclassified | 3363 |
| 463 | Ga0207706_10143640 | 3300025933 | Bacteria | 2100 |
| 464 | Ga0207686_10021496 | 3300025934 | Bacteria | 3704 |
| 465 | Ga0207686_10318651 | 3300025934 | Bacteria | 1161 |
| 466 | Ga0207709_10491094 | 3300025935 | Bacteria | 956 |
| 467 | Ga0207670_10045860 | 3300025936 | Bacteria | 2900 |
| 468 | Ga0207670_10697417 | 3300025936 | Unclassified | 840 |
| 469 | Ga0207669_11861060 | 3300025937 | Bacteria | 514 |
| 470 | Ga0207704_10000124 | 3300025938 | Bacteria | 41992 |
| 471 | Ga0207704_10445880 | 3300025938 | Bacteria | 1032 |
| 472 | Ga0207691_10074964 | 3300025940 | Bacteria | 3051 |
| 473 | Ga0207691_10195531 | 3300025940 | Unclassified | 1762 |
| 474 | Ga0207689_10003017 | 3300025942 | Bacteria | 15523 |
| 475 | Ga0207689_10004698 | 3300025942 | Bacteria | 12328 |
| 476 | Ga0207689_10837697 | 3300025942 | Bacteria | 776 |
| 477 | Ga0207661_10165297 | 3300025944 | Bacteria | 1922 |
| 478 | Ga0207679_10284107 | 3300025945 | Bacteria | 1420 |
| 479 | Ga0207679_10688283 | 3300025945 | Unclassified | 927 |
| 480 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 481 | Ga0207667_10000588 | 3300025949 | Bacteria | 47296 |
| 482 | Ga0207667_10030341 | 3300025949 | Bacteria | 5851 |
| 483 | Ga0207667_10065439 | 3300025949 | Bacteria | 3791 |
| 484 | Ga0207667_10068786 | 3300025949 | Bacteria | 3686 |
| 485 | Ga0207667_10202794 | 3300025949 | Bacteria | 2034 |
| 486 | Ga0207667_10306632 | 3300025949 | Bacteria | 1622 |
| 487 | Ga0207667_10440085 | 3300025949 | Unclassified | 1325 |
| 488 | Ga0207667_10516976 | 3300025949 | Bacteria | 1210 |
| 489 | Ga0207651_10002650 | 3300025960 | Bacteria | 8559 |
| 490 | Ga0207651_10318026 | 3300025960 | Bacteria | 1300 |
| 491 | Ga0207651_10484975 | 3300025960 | Bacteria | 1066 |
| 492 | Ga0207712_10225974 | 3300025961 | Unclassified | 1499 |
| 493 | Ga0207658_10115523 | 3300025986 | Unclassified | 2130 |
| 494 | Ga0207658_11389222 | 3300025986 | Bacteria | 642 |
| 495 | Ga0207677_10080077 | 3300026023 | Bacteria | 2339 |
| 496 | Ga0207677_10090552 | 3300026023 | Bacteria | 2223 |
| 497 | Ga0207677_10161661 | 3300026023 | Bacteria | 1741 |
| 498 | Ga0207677_10202234 | 3300026023 | Bacteria | 1580 |
| 499 | Ga0207703_10349064 | 3300026035 | Bacteria | 1362 |
| 500 | Ga0207703_10682028 | 3300026035 | Bacteria | 976 |
| 501 | Ga0207703_10848622 | 3300026035 | Bacteria | 873 |
| 502 | Ga0207639_10078596 | 3300026041 | Bacteria | 2605 |
| 503 | Ga0207639_10152921 | 3300026041 | Bacteria | 1935 |
| 504 | Ga0207639_10247848 | 3300026041 | Bacteria | 1552 |
| 505 | Ga0207639_10612733 | 3300026041 | Bacteria | 1005 |
| 506 | Ga0207639_10693922 | 3300026041 | Bacteria | 944 |
| 507 | Ga0207678_10016882 | 3300026067 | Bacteria | 6410 |
| 508 | Ga0207678_10064737 | 3300026067 | Bacteria | 3141 |
| 509 | Ga0207678_10144877 | 3300026067 | Bacteria | 2028 |
| 510 | Ga0207678_10237828 | 3300026067 | Bacteria | 1560 |
| 511 | Ga0207708_10201195 | 3300026075 | Bacteria | 1589 |
| 512 | Ga0207702_10000402 | 3300026078 | Bacteria | 49308 |
| 513 | Ga0207702_10096207 | 3300026078 | Bacteria | 2603 |
| 514 | Ga0207702_10374951 | 3300026078 | Bacteria | 1367 |
| 515 | Ga0207702_11849669 | 3300026078 | Bacteria | 595 |
| 516 | Ga0207648_10004497 | 3300026089 | Bacteria | 14295 |
| 517 | Ga0207648_10290939 | 3300026089 | Unclassified | 1463 |
| 518 | Ga0207676_10005510 | 3300026095 | Bacteria | 8957 |
| 519 | Ga0207676_10049834 | 3300026095 | Unclassified | 3261 |
| 520 | Ga0207674_10032109 | 3300026116 | Bacteria | 5508 |
| 521 | Ga0207674_10135554 | 3300026116 | Bacteria | 2424 |
| 522 | Ga0207674_10174641 | 3300026116 | Bacteria | 2101 |
| 523 | Ga0207674_10182386 | 3300026116 | Bacteria | 2050 |
| 524 | Ga0207674_10183813 | 3300026116 | Unclassified | 2041 |
| 525 | Ga0207683_10007450 | 3300026121 | Bacteria | 9384 |
| 526 | Ga0207698_10099107 | 3300026142 | Bacteria | 2410 |
| 527 | Ga0207698_10126959 | 3300026142 | Bacteria | 2171 |
| 528 | Ga0207698_10256979 | 3300026142 | Bacteria | 1602 |
| 529 | Ga0207698_10322212 | 3300026142 | Unclassified | 1448 |
| 530 | Ga0268266_10001358 | 3300028379 | Bacteria | 29523 |
| 531 | Ga0268266_11002636 | 3300028379 | Bacteria | 808 |
| 532 | Ga0268264_10222479 | 3300028381 | Bacteria | 1738 |
| 533 | Ga0268264_10667123 | 3300028381 | Bacteria | 1030 |
| 534 | Ga0307515_10000114 | 3300028794 | Bacteria | 194024 |
| 535 | Ga0307515_10000299 | 3300028794 | Bacteria | 122087 |
| 536 | Ga0307515_10001092 | 3300028794 | Bacteria | 62178 |
| 537 | Ga0265338_10201202 | 3300028800 | Bacteria | 1502 |
| 538 | Ga0316180_1032084 | 3300030736 | Bacteria | 850 |
| 539 | Ga0316181_1030879 | 3300030744 | Bacteria | 693 |
| 540 | Ga0265327_10058782 | 3300031251 | Bacteria | 1972 |
| 541 | Ga0307509_10119184 | 3300031507 | Bacteria | 2621 |
| 542 | Ga0307508_10367349 | 3300031616 | Bacteria | 1030 |
| 543 | Ga0307405_10968796 | 3300031731 | Bacteria | 724 |
| 544 | Ga0307412_10000049 | 3300031911 | Bacteria | 151588 |
| 545 | Ga0307412_10003083 | 3300031911 | Bacteria | 9243 |
| 546 | Ga0307412_10040116 | 3300031911 | Bacteria | 3028 |
| 547 | Ga0307412_10583356 | 3300031911 | Bacteria | 944 |
| 548 | Ga0307414_10000142 | 3300032004 | Bacteria | 48979 |
| 549 | Ga0307414_10015762 | 3300032004 | Bacteria | 4573 |
| 550 | Ga0307414_11906681 | 3300032004 | Bacteria | 555 |
| 551 | Ga0307411_11004631 | 3300032005 | Bacteria | 747 |
| 552 | Ga0307507_10000152 | 3300033179 | Bacteria | 122095 |
| 553 | Ga0373941_0004177 | 3300035115 | Bacteria | 3316 |
| 554 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 555 | Ga0395899_0021426 | 3300037312 | Bacteria | 4902 |
| 556 | Ga0395900_0009820 | 3300037418 | Bacteria | 9803 |
| 557 | Ga0395900_0016084 | 3300037418 | Bacteria | 7623 |
| 558 | Ga0395898_0163347 | 3300037466 | Bacteria | 2130 |
| 559 | Ga0395898_0794109 | 3300037466 | Bacteria | 887 |
| 560 | Ga0395898_1354737 | 3300037466 | Bacteria | 640 |
| 561 | Ga0395905_0000169 | 3300037471 | Bacteria | 106579 |
| 562 | Ga0395905_0022680 | 3300037471 | Bacteria | 5934 |
| 563 | Ga0395905_0318050 | 3300037471 | Bacteria | 1446 |
| 564 | Ga0395901_0016616 | 3300038443 | Bacteria | 7498 |
| 565 | Ga0395901_0415196 | 3300038443 | Bacteria | 1381 |
| 566 | Ga0395901_0823880 | 3300038443 | Bacteria | 915 |
| 567 | Ga0436361_0925331 | 3300039447 | Bacteria | 3544 |
| 568 | Ga0451793_1162039 | 3300041452 | Bacteria | 525 |
| 569 | Ga0451802_0032271 | 3300041460 | Bacteria | 1350 |
| 570 | Ga0451841_1119084 | 3300041498 | Bacteria | 682 |
| 571 | Ga0466969_0008979 | 3300044656 | Bacteria | 5298 |
| 572 | Ga0466966_0003333 | 3300044684 | Bacteria | 10586 |
| 573 | Ga0466961_0039266 | 3300044693 | Bacteria | 3035 |
| 574 | Ga0466958_0093849 | 3300045836 | Bacteria | 1859 |
| 575 | Ga0495651_0082300 | 3300046462 | Bacteria | 2429 |
| 576 | Ga0495650_0000013 | 3300046471 | Bacteria | 611135 |
| 577 | Ga0495650_0000036 | 3300046471 | Bacteria | 400633 |
| 578 | Ga0495650_0000349 | 3300046471 | Bacteria | 81735 |
| 579 | Ga0495650_0048910 | 3300046471 | Bacteria | 1759 |
| 580 | Ga0495650_0058939 | 3300046471 | Bacteria | 1548 |
| 581 | Ga0495585_0000651 | 3300046492 | Bacteria | 31896 |
| 582 | Ga0495585_0046328 | 3300046492 | Bacteria | 2425 |
| 583 | Ga0495583_0194366 | 3300046506 | Bacteria | 826 |
| 584 | Ga0495606_0000225 | 3300046507 | Bacteria | 100291 |
| 585 | Ga0495606_0000815 | 3300046507 | Bacteria | 47426 |
| 586 | Ga0495606_0002935 | 3300046507 | Bacteria | 18826 |
| 587 | Ga0495606_0006198 | 3300046507 | Bacteria | 11127 |
| 588 | Ga0495606_0016078 | 3300046507 | Bacteria | 5727 |
| 589 | Ga0495606_0019988 | 3300046507 | Bacteria | 4956 |
| 590 | Ga0495606_0024884 | 3300046507 | Bacteria | 4301 |
| 591 | Ga0495606_0029510 | 3300046507 | Bacteria | 3849 |
| 592 | Ga0495606_0098737 | 3300046507 | Bacteria | 1781 |
| 593 | Ga0495606_0315256 | 3300046507 | Bacteria | 842 |
| 594 | Ga0495606_0425559 | 3300046507 | Bacteria | 685 |
| 595 | Ga0495606_0479666 | 3300046507 | Bacteria | 632 |
| 596 | Ga0495610_0000614 | 3300046512 | Bacteria | 35222 |
| 597 | Ga0495610_0003064 | 3300046512 | Bacteria | 13358 |
| 598 | Ga0495610_0004283 | 3300046512 | Bacteria | 10616 |
| 599 | Ga0495610_0072861 | 3300046512 | Bacteria | 1598 |
| 600 | Ga0495610_0172001 | 3300046512 | Bacteria | 908 |
| 601 | Ga0495616_0002468 | 3300046513 | Bacteria | 12258 |
| 602 | Ga0495616_0003158 | 3300046513 | Bacteria | 10638 |
| 603 | Ga0495616_0008469 | 3300046513 | Bacteria | 6091 |
| 604 | Ga0495616_0259367 | 3300046513 | Bacteria | 744 |
| 605 | Ga0495620_0130838 | 3300046515 | Bacteria | 985 |
| 606 | Ga0495628_1149160 | 3300046516 | Bacteria | 529 |
| 607 | Ga0495632_0193697 | 3300046519 | Bacteria | 928 |
| 608 | Ga0495632_0216606 | 3300046519 | Bacteria | 867 |
| 609 | Ga0495637_0012297 | 3300046520 | Bacteria | 4099 |
| 610 | Ga0495644_0022950 | 3300046523 | Bacteria | 2377 |
| 611 | Ga0495648_0293727 | 3300046524 | Bacteria | 764 |
| 612 | Ga0495652_0175867 | 3300046529 | Bacteria | 1648 |
| 613 | Ga0495609_0035512 | 3300046538 | Bacteria | 2256 |
| 614 | Ga0495609_0058028 | 3300046538 | Bacteria | 1712 |
| 615 | Ga0495609_0068558 | 3300046538 | Bacteria | 1561 |
| 616 | Ga0495622_0078820 | 3300046557 | Bacteria | 1517 |
| 617 | Ga0495633_0000167 | 3300046558 | Bacteria | 86373 |
| 618 | Ga0495633_0000518 | 3300046558 | Bacteria | 38686 |
| 619 | Ga0495633_0010739 | 3300046558 | Bacteria | 4981 |
| 620 | Ga0495668_0000576 | 3300046616 | Bacteria | 44790 |
| 621 | Ga0495668_0109513 | 3300046616 | Bacteria | 1511 |
| 622 | Ga0495668_0159206 | 3300046616 | Bacteria | 1237 |
| 623 | Ga0495668_0388909 | 3300046616 | Bacteria | 766 |
| 624 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 625 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 626 | Ga0495625_0000030 | 3300046660 | Bacteria | 241164 |
| 627 | Ga0495625_0000923 | 3300046660 | Bacteria | 39492 |
| 628 | Ga0495625_0002259 | 3300046660 | Bacteria | 21183 |
| 629 | Ga0495625_0004491 | 3300046660 | Bacteria | 13166 |
| 630 | Ga0495661_0001028 | 3300046665 | Bacteria | 24780 |
| 631 | Ga0495661_0001060 | 3300046665 | Bacteria | 24319 |
| 632 | Ga0495661_0001126 | 3300046665 | Bacteria | 23374 |
| 633 | Ga0495661_0002399 | 3300046665 | Bacteria | 14465 |
| 634 | Ga0495661_0007531 | 3300046665 | Bacteria | 7590 |
| 635 | Ga0495661_0452382 | 3300046665 | Bacteria | 618 |
| 636 | Ga0495669_0643202 | 3300046684 | Bacteria | 516 |
| 637 | Ga0495670_0250414 | 3300046691 | Bacteria | 944 |
| 638 | Ga0495671_0034527 | 3300046692 | Bacteria | 2571 |
| 639 | Ga0495671_0154511 | 3300046692 | Bacteria | 1117 |
| 640 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 641 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 642 | Ga0495649_0000041 | 3300046694 | Bacteria | 125049 |
| 643 | Ga0495649_0045915 | 3300046694 | Bacteria | 2380 |
| 644 | Ga0495649_0174960 | 3300046694 | Bacteria | 1122 |
| 645 | Ga0495600_0208167 | 3300046809 | Bacteria | 1254 |
| 646 | Ga0495660_0001248 | 3300046810 | Bacteria | 17718 |
| 647 | Ga0495660_0004941 | 3300046810 | Bacteria | 8033 |
| 648 | Ga0495660_0027648 | 3300046810 | Bacteria | 3208 |
| 649 | Ga0495683_0016345 | 3300047323 | Bacteria | 3855 |
| 650 | Ga0495683_0274811 | 3300047323 | Bacteria | 731 |
| 651 | Ga0495687_004839 | 3300047443 | Bacteria | 8859 |
| 652 | Ga0495687_007565 | 3300047443 | Bacteria | 6374 |
| 653 | Ga0495687_023060 | 3300047443 | Bacteria | 2979 |
| 654 | Ga0495687_025818 | 3300047443 | Bacteria | 2770 |
| 655 | Ga0495677_0309107 | 3300047445 | Bacteria | 622 |
| 656 | Ga0495686_0000274 | 3300047472 | Bacteria | 91650 |
| 657 | Ga0495686_0000607 | 3300047472 | Bacteria | 49581 |
| 658 | Ga0495686_0044871 | 3300047472 | Bacteria | 2798 |
| 659 | Ga0495686_0064378 | 3300047472 | Bacteria | 2269 |
| 660 | Ga0495686_0116275 | 3300047472 | Bacteria | 1598 |
| 661 | Ga0495686_0137973 | 3300047472 | Bacteria | 1441 |
| 662 | Ga0495686_0191559 | 3300047472 | Bacteria | 1178 |
| 663 | Ga0495614_0139542 | 3300048089 | Bacteria | 1076 |
| 664 | Ga0496109_0497568 | 3300048912 | Bacteria | 1151 |
| 665 | Ga0496110_0150140 | 3300048913 | Bacteria | 2110 |
| 666 | Ga0496111_0161689 | 3300048914 | Bacteria | 1663 |
| 667 | Ga0496112_0285843 | 3300048915 | Unclassified | 1596 |
| 668 | Ga0496113_0734574 | 3300048916 | Unclassified | 787 |
| 669 | Ga0496122_0002725 | 3300048925 | Bacteria | 24489 |
| 670 | Ga0496123_0004160 | 3300048926 | Bacteria | 15474 |
| 671 | Ga0496125_0205778 | 3300048928 | Bacteria | 1283 |
| 672 | Ga0496126_0778202 | 3300048929 | Bacteria | 736 |
| 673 | nmdc:mga0k408_14794_c1 | 3300050493 | Bacteria | 4305 |
| 674 | nmdc:mga0k408_166_c1 | 3300050493 | Bacteria | 34700 |
| 675 | nmdc:mga0k408_177_c3 | 3300050493 | Bacteria | 27094 |
| 676 | nmdc:mga0k408_93569_c1 | 3300050493 | Bacteria | 1767 |
| 677 | nmdc:mga07m45_363978_c1 | 3300050496 | Bacteria | 840 |
| 678 | nmdc:mga0n895_2082005_c1 | 3300050512 | Bacteria | 524 |
| 679 | Ga0500608_002462 | 3300053122 | Bacteria | 6737 |
| 680 | Ga0500614_117474 | 3300053123 | Bacteria | 781 |
| 681 | Ga0500568_0086713 | 3300053139 | Bacteria | 1184 |
| 682 | Ga0500622_0000199 | 3300053156 | Bacteria | 63518 |
| 683 | 2599477998 | 2599185184 | Bacteria | 6430550 |
| 684 | 2599481094 | 2599185184 | Bacteria | 6430550 |
| 685 | 2738757964 | 2738541283 | Bacteria | 7222293 |
| 686 | 2776616415 | 2775506987 | Bacteria | 5373360 |
| 687 | 2852625331 | 2852623160 | Bacteria | 4376875 |
| 688 | 2852630290 | 2852627209 | Bacteria | 5896285 |
| 689 | 2884934344 | 2884933994 | Bacteria | 4535041 |
| 690 | 2919189448 | 2919186247 | Bacteria | 6244071 |
| 691 | 2919438725 | 2919437846 | Bacteria | 6199444 |
| 692 | 2928079958 | 2928078545 | Bacteria | 6534839 |
| 693 | 2928083033 | 2928078545 | Bacteria | 6534839 |
| 694 | 2928147584 | 2928147474 | Bacteria | 6512076 |
| 695 | 2928150054 | 2928147474 | Bacteria | 6512076 |
| 696 | 2932083874 | 2932082852 | Bacteria | 6563563 |
| 697 | 2932086859 | 2932082852 | Bacteria | 6563563 |
| 698 | 2939667674 | 2939664404 | Bacteria | 6364494 |
| 699 | Ga0105240_11365856 | |||
| 700 | SwRhRL2b_contig_1006355 | |||
| 701 | SwRhRL2b_contig_1556754 | |||
| 702 | JGI24740J21852_10027978 | |||
| 703 | JGI24740J21852_10035398 | |||
| 704 | JGI24739J22299_10164898 | |||
| 705 | JGI24737J22298_10002474 | |||
| 706 | JGI24737J22298_10003569 | |||
| 707 | JGI24737J22298_10015977 | |||
| 708 | JGI24737J22298_10021212 | |||
| 709 | JGI24735J21928_10000010 | |||
| 710 | JGI24735J21928_10000012 | |||
| 711 | JGI24735J21928_10045946 | |||
| 712 | JGI24735J21928_10167723 | |||
| 713 | JGI24744J21845_10002117 | |||
| 714 | JGI25162J39368_1000008 | |||
| 715 | JGI25162J39368_1000650 | |||
| 716 | JGI25164J39214_1002804 | |||
| 717 | JGI25152J39213_1000135 | |||
| 718 | JGI25150J39212_1000001 | |||
| 719 | JGI25151J46595_10000005 | |||
| 720 | JGI25165J46597_1001427 | |||
| 721 | JGI25153J46596_10000018 | |||
| 722 | rootH1_10011835 | |||
| 723 | rootH1_10014013 | |||
| 724 | rootH1_10168250 | |||
| 725 | rootH2_10001530 | |||
| 726 | rootH2_10012129 | |||
| 727 | rootH2_10256500 | |||
| 728 | rootL2_10042747 | |||
| 729 | rootH1_10053839 | |||
| 730 | rootH1_10169284 | |||
| 731 | rootH1_10281210 | |||
| 732 | Ga0055529_1008634 | |||
| 733 | Ga0055536_1000012 | |||
| 734 | Ga0055536_1000073 | |||
| 735 | Ga0055530_10005870 | |||
| 736 | Ga0055530_10011938 | |||
| 737 | Ga0058863_11026128 | |||
| 738 | Ga0065714_10002426 | |||
| 739 | Ga0065714_10002529 | |||
| 740 | Ga0065714_10017757 | |||
| 741 | Ga0065714_10068253 | |||
| 742 | Ga0065714_10125691 | |||
| 743 | Ga0065704_10070217 | |||
| 744 | Ga0065704_10084034 | |||
| 745 | Ga0065704_10106669 | |||
| 746 | Ga0065704_10193739 | |||
| 747 | Ga0070658_10000236 | |||
| 748 | Ga0070658_10019676 | |||
| 749 | Ga0070658_10311041 | |||
| 750 | Ga0070658_10443299 | |||
| 751 | Ga0070676_10001139 | |||
| 752 | Ga0070676_10002506 | |||
| 753 | Ga0070683_100007556 | |||
| 754 | Ga0070690_100311263 | |||
| 755 | Ga0068869_100006090 | |||
| 756 | Ga0068869_100095602 | |||
| 757 | Ga0068869_101084425 | |||
| 758 | Ga0068868_100007253 | |||
| 759 | Ga0068868_100031645 | |||
| 760 | Ga0068868_100097478 | |||
| 761 | Ga0068868_100451876 | |||
| 762 | Ga0068868_100557116 | |||
| 763 | Ga0070660_100008100 | |||
| 764 | Ga0070660_100127271 | |||
| 765 | Ga0070689_100021088 | |||
| 766 | Ga0070689_100115135 | |||
| 767 | Ga0070661_100025240 | |||
| 768 | Ga0070692_10257084 | |||
| 769 | Ga0070669_100374492 | |||
| 770 | Ga0070675_100014741 | |||
| 771 | Ga0070675_100277618 | |||
| 772 | Ga0070671_100050360 | |||
| 773 | Ga0070671_100130319 | |||
| 774 | Ga0070671_100837532 | |||
| 775 | Ga0070674_100208196 | |||
| 776 | Ga0070673_100002531 | |||
| 777 | Ga0070673_100047846 | |||
| 778 | Ga0070673_100197363 | |||
| 779 | Ga0070673_101072121 | |||
| 780 | Ga0070688_100114517 | |||
| 781 | Ga0070659_100003119 | |||
| 782 | Ga0070659_100137141 | |||
| 783 | Ga0070659_100567360 | |||
| 784 | Ga0070659_101056772 | |||
| 785 | Ga0070659_101181976 | |||
| 786 | Ga0070667_100128420 | |||
| 787 | Ga0070667_101015467 | |||
| 788 | Ga0070663_100008275 | |||
| 789 | Ga0070663_100115703 | |||
| 790 | Ga0070663_100458463 | |||
| 791 | Ga0070662_100000246 | |||
| 792 | Ga0070662_100001095 | |||
| 793 | Ga0070662_100037600 | |||
| 794 | Ga0070662_100168796 | |||
| 795 | Ga0070662_100260355 | |||
| 796 | Ga0070681_10007244 | |||
| 797 | Ga0068867_100013459 | |||
| 798 | Ga0068867_101063338 | |||
| 799 | Ga0070685_10821069 | |||
| 800 | Ga0070679_100006032 | |||
| 801 | Ga0070684_100021852 | |||
| 802 | Ga0070684_100096293 | |||
| 803 | Ga0070684_100431938 | |||
| 804 | Ga0068853_100002363 | |||
| 805 | Ga0068853_100062664 | |||
| 806 | Ga0068853_100295731 | |||
| 807 | Ga0068853_100669167 | |||
| 808 | Ga0068853_100986914 | |||
| 809 | Ga0068853_101802855 | |||
| 810 | Ga0070672_100489928 | |||
| 811 | Ga0070672_100967604 | |||
| 812 | Ga0070686_100065068 | |||
| 813 | Ga0070665_100000205 | |||
| 814 | Ga0070665_100388617 | |||
| 815 | Ga0070665_100615720 | |||
| 816 | Ga0068855_100000035 | |||
| 817 | Ga0068855_100000093 | |||
| 818 | Ga0068855_100012727 | |||
| 819 | Ga0068855_100014899 | |||
| 820 | Ga0068855_100016576 | |||
| 821 | Ga0068855_100040882 | |||
| 822 | Ga0068855_100191192 | |||
| 823 | Ga0068855_100290106 | |||
| 824 | Ga0068855_100364720 | |||
| 825 | Ga0068855_100689234 | |||
| 826 | Ga0068855_100707114 | |||
| 827 | Ga0068855_100824363 | |||
| 828 | Ga0070664_100151971 | |||
| 829 | Ga0070664_100826976 | |||
| 830 | Ga0068857_100022854 | |||
| 831 | Ga0068857_100057970 | |||
| 832 | Ga0068857_100330718 | |||
| 833 | Ga0068857_100551105 | |||
| 834 | Ga0068854_100027212 | |||
| 835 | Ga0068854_100401573 | |||
| 836 | Ga0068856_100005796 | |||
| 837 | Ga0068856_100030077 | |||
| 838 | Ga0068856_100041415 | |||
| 839 | Ga0068856_100045088 | |||
| 840 | Ga0068856_100431243 | |||
| 841 | Ga0068852_100006455 | |||
| 842 | Ga0068852_100025960 | |||
| 843 | Ga0068852_100770274 | |||
| 844 | Ga0068852_101569114 | |||
| 845 | Ga0068859_100030336 | |||
| 846 | Ga0068859_100153454 | |||
| 847 | Ga0068864_100042621 | |||
| 848 | Ga0068864_100097211 | |||
| 849 | Ga0068866_10039836 | |||
| 850 | Ga0068866_11086797 | |||
| 851 | Ga0068861_101591696 | |||
| 852 | Ga0068851_10734154 | |||
| 853 | Ga0068870_10057011 | |||
| 854 | Ga0068863_100346125 | |||
| 855 | Ga0068858_100034400 | |||
| 856 | Ga0068858_100068684 | |||
| 857 | Ga0068858_100329724 | |||
| 858 | Ga0068858_100358715 | |||
| 859 | Ga0068858_100514735 | |||
| 860 | Ga0068860_100110870 | |||
| 861 | Ga0068860_101212527 | |||
| 862 | Ga0068862_100953143 | |||
| 863 | Ga0075366_10001424 | |||
| 864 | Ga0075366_10002297 | |||
| 865 | Ga0075366_10003631 | |||
| 866 | Ga0075366_10070230 | |||
| 867 | Ga0097621_100000365 | |||
| 868 | Ga0097621_100031804 | |||
| 869 | Ga0075370_10413346 | |||
| 870 | Ga0068871_100000248 | |||
| 871 | Ga0068871_100737074 | |||
| 872 | Ga0068865_100000211 | |||
| 873 | Ga0068865_100490294 | |||
| 874 | Ga0097620_100030336 | |||
| 875 | Ga0097620_100153458 | |||
| 876 | Ga0105251_10229796 | |||
| 877 | Ga0105240_10000075 | |||
| 878 | Ga0105240_10007027 | |||
| 879 | Ga0105240_10027595 | |||
| 880 | Ga0105240_10081591 | |||
| 881 | Ga0105240_10094930 | |||
| 882 | Ga0105240_10125849 | |||
| 883 | Ga0105240_10144957 | |||
| 884 | Ga0105240_10231782 | |||
| 885 | Ga0105240_10346827 | |||
| 886 | Ga0105240_10410179 | |||
| 887 | Ga0105240_10525228 | |||
| 888 | Ga0105240_10846809 | |||
| 889 | Ga0105240_11144130 | |||
| 890 | Ga0105240_11291299 | |||
| 891 | Ga0105245_10114104 | |||
| 892 | Ga0105247_10165534 | |||
| 893 | Ga0105247_10259020 | |||
| 894 | Ga0105247_10763778 | |||
| 895 | Ga0105243_10065502 | |||
| 896 | Ga0105243_10884452 | |||
| 897 | Ga0105241_10001503 | |||
| 898 | Ga0105241_10001741 | |||
| 899 | Ga0105241_10001827 | |||
| 900 | Ga0105241_10085780 | |||
| 901 | Ga0105241_10312705 | |||
| 902 | Ga0105241_10487394 | |||
| 903 | Ga0105242_10103609 | |||
| 904 | Ga0105242_10152899 | |||
| 905 | Ga0105242_10219816 | |||
| 906 | Ga0105248_10112067 | |||
| 907 | Ga0105237_10000146 | |||
| 908 | Ga0105237_10000176 | |||
| 909 | Ga0105237_10002107 | |||
| 910 | Ga0105237_10003053 | |||
| 911 | Ga0105237_10008559 | |||
| 912 | Ga0105237_10080181 | |||
| 913 | Ga0105237_10129586 | |||
| 914 | Ga0105237_10272069 | |||
| 915 | Ga0105237_10463104 | |||
| 916 | Ga0105237_10760193 | |||
| 917 | Ga0105237_10876609 | |||
| 918 | Ga0105237_11076556 | |||
| 919 | Ga0105238_10045727 | |||
| 920 | Ga0105238_10837095 | |||
| 921 | Ga0105249_10321396 | |||
| 922 | Ga0105239_10000053 | |||
| 923 | Ga0105239_10000055 | |||
| 924 | Ga0105239_10000068 | |||
| 925 | Ga0105239_10000807 | |||
| 926 | Ga0105239_10022919 | |||
| 927 | Ga0105239_10097301 | |||
| 928 | Ga0105239_10229365 | |||
| 929 | Ga0105239_10309368 | |||
| 930 | Ga0105239_10345600 | |||
| 931 | Ga0105239_10728166 | |||
| 932 | Ga0105239_10930852 | |||
| 933 | Ga0105239_13223206 | |||
| 934 | Ga0105246_10050889 | |||
| 935 | Ga0105246_10066973 | |||
| 936 | Ga0157373_10000072 | |||
| 937 | Ga0157373_10000440 | |||
| 938 | Ga0157373_10000509 | |||
| 939 | Ga0157373_10001021 | |||
| 940 | Ga0157373_10012866 | |||
| 941 | Ga0157373_10025741 | |||
| 942 | Ga0157371_10000297 | |||
| 943 | Ga0157371_10000476 | |||
| 944 | Ga0157371_10002650 | |||
| 945 | Ga0157371_10005885 | |||
| 946 | Ga0157371_10009632 | |||
| 947 | Ga0157371_10017247 | |||
| 948 | Ga0157371_10021733 | |||
| 949 | Ga0157371_10028078 | |||
| 950 | Ga0157371_10164771 | |||
| 951 | Ga0157370_10000392 | |||
| 952 | Ga0157370_10000808 | |||
| 953 | Ga0157370_10012983 | |||
| 954 | Ga0157370_10013312 | |||
| 955 | Ga0157370_10014075 | |||
| 956 | Ga0157370_10026054 | |||
| 957 | Ga0157370_10046455 | |||
| 958 | Ga0157370_10050036 | |||
| 959 | Ga0157370_10102886 | |||
| 960 | Ga0157370_10198997 | |||
| 961 | Ga0157370_10291004 | |||
| 962 | Ga0157370_11900328 | |||
| 963 | Ga0157370_12135742 | |||
| 964 | Ga0157369_10008196 | |||
| 965 | Ga0157369_10066661 | |||
| 966 | Ga0157369_10076842 | |||
| 967 | Ga0157369_10174349 | |||
| 968 | Ga0157369_10292904 | |||
| 969 | Ga0157369_10429875 | |||
| 970 | Ga0157369_10753856 | |||
| 971 | Ga0157369_11498199 | |||
| 972 | Ga0157374_10000892 | |||
| 973 | Ga0157374_10001869 | |||
| 974 | Ga0157374_10002138 | |||
| 975 | Ga0157374_10005402 | |||
| 976 | Ga0157374_10015783 | |||
| 977 | Ga0157374_10107528 | |||
| 978 | Ga0157374_10149710 | |||
| 979 | Ga0157374_10248486 | |||
| 980 | Ga0157374_10426654 | |||
| 981 | Ga0157378_10001635 | |||
| 982 | Ga0157378_10024130 | |||
| 983 | Ga0157378_10062163 | |||
| 984 | Ga0157378_10120761 | |||
| 985 | Ga0163162_10002205 | |||
| 986 | Ga0163162_10003610 | |||
| 987 | Ga0163162_10020777 | |||
| 988 | Ga0163162_10024846 | |||
| 989 | Ga0163162_10059313 | |||
| 990 | Ga0163162_10066005 | |||
| 991 | Ga0163162_10174952 | |||
| 992 | Ga0163162_10494069 | |||
| 993 | Ga0157372_10000001 | |||
| 994 | Ga0157372_10000009 | |||
| 995 | Ga0157372_10000285 | |||
| 996 | Ga0157372_10000398 | |||
| 997 | Ga0157372_10001410 | |||
| 998 | Ga0157372_10002663 | |||
| 999 | Ga0157372_10005240 | |||
| 1000 | Ga0157372_10012648 | |||
| 1001 | Ga0157372_10043903 | |||
| 1002 | Ga0157372_10163638 | |||
| 1003 | Ga0157372_10412129 | |||
| 1004 | Ga0157372_11268274 | |||
| 1005 | Ga0157375_10000510 | |||
| 1006 | Ga0157375_10006815 | |||
| 1007 | Ga0157375_10077478 | |||
| 1008 | Ga0157375_10117438 | |||
| 1009 | Ga0157375_10125091 | |||
| 1010 | Ga0157375_10528852 | |||
| 1011 | Ga0157375_13117910 | |||
| 1012 | Ga0163163_10006370 | |||
| 1013 | Ga0163163_10612863 | |||
| 1014 | Ga0157380_11955020 | |||
| 1015 | Ga0182008_10000049 | |||
| 1016 | Ga0182008_10179788 | |||
| 1017 | Ga0157377_10029619 | |||
| 1018 | Ga0157377_10055455 | |||
| 1019 | Ga0157377_10440521 | |||
| 1020 | Ga0157379_10052504 | |||
| 1021 | Ga0157379_10519677 | |||
| 1022 | Ga0157376_10145156 | |||
| 1023 | Ga0157376_10526493 | |||
| 1024 | Ga0182006_1001021 | |||
| 1025 | Ga0182006_1002334 | |||
| 1026 | Ga0182007_10056804 | |||
| 1027 | Ga0182007_10100020 | |||
| 1028 | Ga0163161_10009664 | |||
| 1029 | Ga0163161_10419797 | |||
| 1030 | Ga0163161_11029720 | |||
| 1031 | Ga0197907_10818403 | |||
| 1032 | Ga0197907_10843955 | |||
| 1033 | Ga0197907_11052318 | |||
| 1034 | Ga0206356_10240228 | |||
| 1035 | Ga0206349_1077327 | |||
| 1036 | Ga0206349_1096684 | |||
| 1037 | Ga0206349_1210720 | |||
| 1038 | Ga0206349_1313684 | |||
| 1039 | Ga0206349_1424097 | |||
| 1040 | Ga0206349_1688161 | |||
| 1041 | Ga0206349_1720152 | |||
| 1042 | Ga0206349_1952962 | |||
| 1043 | Ga0206351_10566236 | |||
| 1044 | Ga0206351_10611578 | |||
| 1045 | Ga0206351_10676490 | |||
| 1046 | Ga0206351_10687676 | |||
| 1047 | Ga0206351_10749691 | |||
| 1048 | Ga0206352_10362601 | |||
| 1049 | Ga0206352_10607600 | |||
| 1050 | Ga0206350_10160009 | |||
| 1051 | Ga0206350_10837543 | |||
| 1052 | Ga0206350_10881467 | |||
| 1053 | Ga0206350_11142260 | |||
| 1054 | Ga0206354_10005453 | |||
| 1055 | Ga0206354_11556883 | |||
| 1056 | Ga0206353_10595393 | |||
| 1057 | Ga0206353_11382833 | |||
| 1058 | Ga0206353_11949261 | |||
| 1059 | Ga0206353_12036747 | |||
| 1060 | Ga0154015_1028243 | |||
| 1061 | Ga0154015_1331156 | |||
| 1062 | Ga0154015_1375746 | |||
| 1063 | Ga0154015_1596118 | |||
| 1064 | Ga0154015_1688781 | |||
| 1065 | Ga0224712_10054480 | |||
| 1066 | Ga0224712_10121877 | |||
| 1067 | Ga0224712_10174997 | |||
| 1068 | Ga0224712_10408725 | |||
| 1069 | Ga0224712_10531896 | |||
| 1070 | Ga0224712_10655505 | |||
| 1071 | Ga0209563_104145 | |||
| 1072 | Ga0207427_100152 | |||
| 1073 | Ga0209437_100030 | |||
| 1074 | Ga0209437_100164 | |||
| 1075 | Ga0209258_122514 | |||
| 1076 | Ga0207425_1000002 | |||
| 1077 | Ga0209026_1000745 | |||
| 1078 | Ga0209026_1001228 | |||
| 1079 | Ga0209129_1000002 | |||
| 1080 | Ga0209129_1011588 | |||
| 1081 | Ga0209233_1000038 | |||
| 1082 | Ga0209233_1000787 | |||
| 1083 | Ga0209455_1004925 | |||
| 1084 | Ga0209676_1000001 | |||
| 1085 | Ga0209676_1000042 | |||
| 1086 | Ga0209025_1000004 | |||
| 1087 | Ga0209758_1000006 | |||
| 1088 | Ga0209050_1000018 | |||
| 1089 | Ga0209050_1000035 | |||
| 1090 | Ga0207697_10100216 | |||
| 1091 | Ga0207656_10385006 | |||
| 1092 | Ga0207642_10150854 | |||
| 1093 | Ga0207710_10178265 | |||
| 1094 | Ga0207688_10609832 | |||
| 1095 | Ga0207680_10069162 | |||
| 1096 | Ga0207647_10000116 | |||
| 1097 | Ga0207647_10001267 | |||
| 1098 | Ga0207647_10001525 | |||
| 1099 | Ga0207647_10041375 | |||
| 1100 | Ga0207647_10133933 | |||
| 1101 | Ga0207647_10196374 | |||
| 1102 | Ga0207647_10257327 | |||
| 1103 | Ga0207647_10661864 | |||
| 1104 | Ga0207645_10000689 | |||
| 1105 | Ga0207645_10001124 | |||
| 1106 | Ga0207643_10613846 | |||
| 1107 | Ga0207705_10000111 | |||
| 1108 | Ga0207705_10193237 | |||
| 1109 | Ga0207705_10467219 | |||
| 1110 | Ga0207654_10116422 | |||
| 1111 | Ga0207654_10203914 | |||
| 1112 | Ga0207654_11050262 | |||
| 1113 | Ga0207695_10000055 | |||
| 1114 | Ga0207695_10023073 | |||
| 1115 | Ga0207695_10035073 | |||
| 1116 | Ga0207695_10050942 | |||
| 1117 | Ga0207695_10070669 | |||
| 1118 | Ga0207695_10127745 | |||
| 1119 | Ga0207695_10155687 | |||
| 1120 | Ga0207695_10174090 | |||
| 1121 | Ga0207695_10435332 | |||
| 1122 | Ga0207695_10456903 | |||
| 1123 | Ga0207695_10567521 | |||
| 1124 | Ga0207695_10571863 | |||
| 1125 | Ga0207695_10589082 | |||
| 1126 | Ga0207695_10845763 | |||
| 1127 | Ga0207695_11659058 | |||
| 1128 | Ga0207671_10000172 | |||
| 1129 | Ga0207671_10000634 | |||
| 1130 | Ga0207671_10003368 | |||
| 1131 | Ga0207671_10015432 | |||
| 1132 | Ga0207671_10047939 | |||
| 1133 | Ga0207671_10048002 | |||
| 1134 | Ga0207671_10612730 | |||
| 1135 | Ga0207671_10712370 | |||
| 1136 | Ga0207671_10781818 | |||
| 1137 | Ga0207660_11073784 | |||
| 1138 | Ga0207657_10033438 | |||
| 1139 | Ga0207657_10532968 | |||
| 1140 | Ga0207657_10685107 | |||
| 1141 | Ga0207649_10031066 | |||
| 1142 | Ga0207652_10030296 | |||
| 1143 | Ga0207652_10619112 | |||
| 1144 | Ga0207652_11068991 | |||
| 1145 | Ga0207681_10759748 | |||
| 1146 | Ga0207659_10093010 | |||
| 1147 | Ga0207659_10804328 | |||
| 1148 | Ga0207687_10127013 | |||
| 1149 | Ga0207644_10179876 | |||
| 1150 | Ga0207644_11286959 | |||
| 1151 | Ga0207690_10008615 | |||
| 1152 | Ga0207690_10175474 | |||
| 1153 | Ga0207690_10276611 | |||
| 1154 | Ga0207690_10503563 | |||
| 1155 | Ga0207690_10972985 | |||
| 1156 | Ga0207706_10000007 | |||
| 1157 | Ga0207706_10000858 | |||
| 1158 | Ga0207706_10059521 | |||
| 1159 | Ga0207706_10143640 | |||
| 1160 | Ga0207686_10021496 | |||
| 1161 | Ga0207686_10318651 | |||
| 1162 | Ga0207709_10491094 | |||
| 1163 | Ga0207670_10045860 | |||
| 1164 | Ga0207670_10697417 | |||
| 1165 | Ga0207669_11861060 | |||
| 1166 | Ga0207704_10000124 | |||
| 1167 | Ga0207704_10445880 | |||
| 1168 | Ga0207691_10074964 | |||
| 1169 | Ga0207691_10195531 | |||
| 1170 | Ga0207689_10003017 | |||
| 1171 | Ga0207689_10004698 | |||
| 1172 | Ga0207689_10837697 | |||
| 1173 | Ga0207661_10165297 | |||
| 1174 | Ga0207679_10284107 | |||
| 1175 | Ga0207679_10688283 | |||
| 1176 | Ga0207667_10000022 | |||
| 1177 | Ga0207667_10000588 | |||
| 1178 | Ga0207667_10030341 | |||
| 1179 | Ga0207667_10065439 | |||
| 1180 | Ga0207667_10068786 | |||
| 1181 | Ga0207667_10202794 | |||
| 1182 | Ga0207667_10306632 | |||
| 1183 | Ga0207667_10440085 | |||
| 1184 | Ga0207667_10516976 | |||
| 1185 | Ga0207651_10002650 | |||
| 1186 | Ga0207651_10318026 | |||
| 1187 | Ga0207651_10484975 | |||
| 1188 | Ga0207712_10225974 | |||
| 1189 | Ga0207658_10115523 | |||
| 1190 | Ga0207658_11389222 | |||
| 1191 | Ga0207677_10080077 | |||
| 1192 | Ga0207677_10090552 | |||
| 1193 | Ga0207677_10161661 | |||
| 1194 | Ga0207677_10202234 | |||
| 1195 | Ga0207703_10349064 | |||
| 1196 | Ga0207703_10682028 | |||
| 1197 | Ga0207703_10848622 | |||
| 1198 | Ga0207639_10078596 | |||
| 1199 | Ga0207639_10152921 | |||
| 1200 | Ga0207639_10247848 | |||
| 1201 | Ga0207639_10612733 | |||
| 1202 | Ga0207639_10693922 | |||
| 1203 | Ga0207678_10016882 | |||
| 1204 | Ga0207678_10064737 | |||
| 1205 | Ga0207678_10144877 | |||
| 1206 | Ga0207678_10237828 | |||
| 1207 | Ga0207708_10201195 | |||
| 1208 | Ga0207702_10000402 | |||
| 1209 | Ga0207702_10096207 | |||
| 1210 | Ga0207702_10374951 | |||
| 1211 | Ga0207702_11849669 | |||
| 1212 | Ga0207648_10004497 | |||
| 1213 | Ga0207648_10290939 | |||
| 1214 | Ga0207676_10005510 | |||
| 1215 | Ga0207676_10049834 | |||
| 1216 | Ga0207674_10032109 | |||
| 1217 | Ga0207674_10135554 | |||
| 1218 | Ga0207674_10174641 | |||
| 1219 | Ga0207674_10182386 | |||
| 1220 | Ga0207674_10183813 | |||
| 1221 | Ga0207683_10007450 | |||
| 1222 | Ga0207698_10099107 | |||
| 1223 | Ga0207698_10126959 | |||
| 1224 | Ga0207698_10256979 | |||
| 1225 | Ga0207698_10322212 | |||
| 1226 | Ga0268266_10001358 | |||
| 1227 | Ga0268266_11002636 | |||
| 1228 | Ga0268264_10222479 | |||
| 1229 | Ga0268264_10667123 | |||
| 1230 | Ga0307515_10000114 | |||
| 1231 | Ga0307515_10000299 | |||
| 1232 | Ga0307515_10001092 | |||
| 1233 | Ga0265338_10201202 | |||
| 1234 | Ga0316180_1032084 | |||
| 1235 | Ga0316181_1030879 | |||
| 1236 | Ga0265327_10058782 | |||
| 1237 | Ga0307509_10119184 | |||
| 1238 | Ga0307508_10367349 | |||
| 1239 | Ga0307405_10968796 | |||
| 1240 | Ga0307412_10000049 | |||
| 1241 | Ga0307412_10003083 | |||
| 1242 | Ga0307412_10040116 | |||
| 1243 | Ga0307412_10583356 | |||
| 1244 | Ga0307414_10000142 | |||
| 1245 | Ga0307414_10015762 | |||
| 1246 | Ga0307414_11906681 | |||
| 1247 | Ga0307411_11004631 | |||
| 1248 | Ga0307507_10000152 | |||
| 1249 | Ga0373941_0004177 | |||
| 1250 | Ga0395899_0000002 | |||
| 1251 | Ga0395899_0021426 | |||
| 1252 | Ga0395900_0009820 | |||
| 1253 | Ga0395900_0016084 | |||
| 1254 | Ga0395898_0163347 | |||
| 1255 | Ga0395898_0794109 | |||
| 1256 | Ga0395898_1354737 | |||
| 1257 | Ga0395905_0000169 | |||
| 1258 | Ga0395905_0022680 | |||
| 1259 | Ga0395905_0318050 | |||
| 1260 | Ga0395901_0016616 | |||
| 1261 | Ga0395901_0415196 | |||
| 1262 | Ga0395901_0823880 | |||
| 1263 | Ga0436361_0925331 | |||
| 1264 | Ga0451793_1162039 | |||
| 1265 | Ga0451802_0032271 | |||
| 1266 | Ga0451841_1119084 | |||
| 1267 | Ga0466969_0008979 | |||
| 1268 | Ga0466966_0003333 | |||
| 1269 | Ga0466961_0039266 | |||
| 1270 | Ga0466958_0093849 | |||
| 1271 | Ga0495651_0082300 | |||
| 1272 | Ga0495650_0000013 | |||
| 1273 | Ga0495650_0000036 | |||
| 1274 | Ga0495650_0000349 | |||
| 1275 | Ga0495650_0048910 | |||
| 1276 | Ga0495650_0058939 | |||
| 1277 | Ga0495585_0000651 | |||
| 1278 | Ga0495585_0046328 | |||
| 1279 | Ga0495583_0194366 | |||
| 1280 | Ga0495606_0000225 | |||
| 1281 | Ga0495606_0000815 | |||
| 1282 | Ga0495606_0002935 | |||
| 1283 | Ga0495606_0006198 | |||
| 1284 | Ga0495606_0016078 | |||
| 1285 | Ga0495606_0019988 | |||
| 1286 | Ga0495606_0024884 | |||
| 1287 | Ga0495606_0029510 | |||
| 1288 | Ga0495606_0098737 | |||
| 1289 | Ga0495606_0315256 | |||
| 1290 | Ga0495606_0425559 | |||
| 1291 | Ga0495606_0479666 | |||
| 1292 | Ga0495610_0000614 | |||
| 1293 | Ga0495610_0003064 | |||
| 1294 | Ga0495610_0004283 | |||
| 1295 | Ga0495610_0072861 | |||
| 1296 | Ga0495610_0172001 | |||
| 1297 | Ga0495616_0002468 | |||
| 1298 | Ga0495616_0003158 | |||
| 1299 | Ga0495616_0008469 | |||
| 1300 | Ga0495616_0259367 | |||
| 1301 | Ga0495620_0130838 | |||
| 1302 | Ga0495628_1149160 | |||
| 1303 | Ga0495632_0193697 | |||
| 1304 | Ga0495632_0216606 | |||
| 1305 | Ga0495637_0012297 | |||
| 1306 | Ga0495644_0022950 | |||
| 1307 | Ga0495648_0293727 | |||
| 1308 | Ga0495652_0175867 | |||
| 1309 | Ga0495609_0035512 | |||
| 1310 | Ga0495609_0058028 | |||
| 1311 | Ga0495609_0068558 | |||
| 1312 | Ga0495622_0078820 | |||
| 1313 | Ga0495633_0000167 | |||
| 1314 | Ga0495633_0000518 | |||
| 1315 | Ga0495633_0010739 | |||
| 1316 | Ga0495668_0000576 | |||
| 1317 | Ga0495668_0109513 | |||
| 1318 | Ga0495668_0159206 | |||
| 1319 | Ga0495668_0388909 | |||
| 1320 | Ga0495625_0000003 | |||
| 1321 | Ga0495625_0000007 | |||
| 1322 | Ga0495625_0000030 | |||
| 1323 | Ga0495625_0000923 | |||
| 1324 | Ga0495625_0002259 | |||
| 1325 | Ga0495625_0004491 | |||
| 1326 | Ga0495661_0001028 | |||
| 1327 | Ga0495661_0001060 | |||
| 1328 | Ga0495661_0001126 | |||
| 1329 | Ga0495661_0002399 | |||
| 1330 | Ga0495661_0007531 | |||
| 1331 | Ga0495661_0452382 | |||
| 1332 | Ga0495669_0643202 | |||
| 1333 | Ga0495670_0250414 | |||
| 1334 | Ga0495671_0034527 | |||
| 1335 | Ga0495671_0154511 | |||
| 1336 | Ga0495649_0000002 | |||
| 1337 | Ga0495649_0000007 | |||
| 1338 | Ga0495649_0000041 | |||
| 1339 | Ga0495649_0045915 | |||
| 1340 | Ga0495649_0174960 | |||
| 1341 | Ga0495600_0208167 | |||
| 1342 | Ga0495660_0001248 | |||
| 1343 | Ga0495660_0004941 | |||
| 1344 | Ga0495660_0027648 | |||
| 1345 | Ga0495683_0016345 | |||
| 1346 | Ga0495683_0274811 | |||
| 1347 | Ga0495687_004839 | |||
| 1348 | Ga0495687_007565 | |||
| 1349 | Ga0495687_023060 | |||
| 1350 | Ga0495687_025818 | |||
| 1351 | Ga0495677_0309107 | |||
| 1352 | Ga0495686_0000274 | |||
| 1353 | Ga0495686_0000607 | |||
| 1354 | Ga0495686_0044871 | |||
| 1355 | Ga0495686_0064378 | |||
| 1356 | Ga0495686_0116275 | |||
| 1357 | Ga0495686_0137973 | |||
| 1358 | Ga0495686_0191559 | |||
| 1359 | Ga0495614_0139542 | |||
| 1360 | Ga0496109_0497568 | |||
| 1361 | Ga0496110_0150140 | |||
| 1362 | Ga0496111_0161689 | |||
| 1363 | Ga0496112_0285843 | |||
| 1364 | Ga0496113_0734574 | |||
| 1365 | Ga0496122_0002725 | |||
| 1366 | Ga0496123_0004160 | |||
| 1367 | Ga0496125_0205778 | |||
| 1368 | Ga0496126_0778202 | |||
| 1369 | nmdc:mga0k408_14794_c1 | |||
| 1370 | nmdc:mga0k408_166_c1 | |||
| 1371 | nmdc:mga0k408_177_c3 | |||
| 1372 | nmdc:mga0k408_93569_c1 | |||
| 1373 | nmdc:mga07m45_363978_c1 | |||
| 1374 | nmdc:mga0n895_2082005_c1 | |||
| 1375 | Ga0500608_002462 | |||
| 1376 | Ga0500614_117474 | |||
| 1377 | Ga0500568_0086713 | |||
| 1378 | Ga0500622_0000199 | |||
| 1379 | 2599477998 | |||
| 1380 | 2599481094 | |||
| 1381 | 2738757964 | |||
| 1382 | 2776616415 | |||
| 1383 | 2852625331 | |||
| 1384 | 2852630290 | |||
| 1385 | 2884934344 | |||
| 1386 | 2919189448 | |||
| 1387 | 2919438725 | |||
| 1388 | 2928079958 | |||
| 1389 | 2928083033 | |||
| 1390 | 2928147584 | |||
| 1391 | 2928150054 | |||
| 1392 | 2932083874 | |||
| 1393 | 2932086859 | |||
| 1394 | 2939667674 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zul-assembly1.cif.gz_E-2 | small heat shock protein from mycobacterium marinum m : form-3 | 0.8569 | 41 | 131 |
| 3n3e-assembly1.cif.gz_B | zebrafish alphaa crystallin | 0.851 | 42 | 134 |
| 2cg9-assembly1.cif.gz_Y | crystal structure of an hsp90-sba1 closed chaperone complex | 0.8449 | 41 | 132 |
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.844 | 40 | 132 |
| 4mjh-assembly3.cif.gz_C | human hsp27 core domain in complex with c-terminal peptide | 0.8402 | 52 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8S1F2_1_96_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.891 | 39 | 136 | 2.60.40.790 |
| af_C7IY02_13_110_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8729 | 41 | 133 | 2.60.40.790 |
| af_I1M7E1_1_101_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8702 | 39 | 132 | 2.60.40.790 |
| af_F4HWW7_1_102_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8614 | 39 | 132 | 2.60.40.790 |
| af_K7KYJ0_12_113_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8572 | 39 | 133 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497D8D0-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8245 | 39 | 146 |
|
| AF-A0A2N1T1W6-F1-model_v4 | deleted | 0.8109 | 41 | 146 |
|
| AF-A0A1Q3RNC3-F1-model_v4 | SHSP domain-containing protein | 0.8058 | 41 | 136 |
|
| AF-A0A7V5WLV9-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8021 | 41 | 132 |
|
| AF-X7YKH7-F1-model_v4 | 18 kDa heat shock protein | 0.7962 | 42 | 146 |
|