F475963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 360 | 693 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300027364|Ga0209967_1000307|Ga0209967_10003076 |
| Length | 228 |
| Sequence | LALLEVVGPLLEVRGLHAAYGQTRVLHGLDFTLEEGSITALLGANGAGKTTTLRALCGMVRTEGEVRFAGHDIGRRKTEDIARLGIAHVPDGRGTFLNLTTEENLRLGAYARRDKKAVEADIERMFGHFPRLKERLAVSRALMMKPKLMLLDEPSFGLAPLLVRELFQILARINEAERVSMLLVEQNAAMALDLANQAYLIETGRVVQSGSAEALKRDDAVRKSYLGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 3 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 4 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 5 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 185 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 186 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 233 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 234 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 235 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 238 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 239 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 240 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 241 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 242 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 243 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 244 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 245 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 246 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 247 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 248 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 249 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 250 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 251 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 254 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 255 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 256 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 319 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 360 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.73 |
| Nodule | 0.14 |
| Rhizoplane | 4.01 |
| Rhizosphere | 88.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1000313 | 3300003781 | Bacteria | 36453 |
| 2 | Ga0055534_1000008 | 3300003784 | Bacteria | 211098 |
| 3 | Ga0055534_1003181 | 3300003784 | Bacteria | 5298 |
| 4 | Ga0055528_1000831 | 3300003790 | Bacteria | 21133 |
| 5 | Ga0055540_1001615 | 3300003792 | Bacteria | 13125 |
| 6 | Ga0055531_10001403 | 3300003794 | Bacteria | 17819 |
| 7 | Ga0065707_10012400 | 3300005295 | Bacteria | 2114 |
| 8 | Ga0065707_10188918 | 3300005295 | Bacteria | 1372 |
| 9 | Ga0070658_10055099 | 3300005327 | Bacteria | 3230 |
| 10 | Ga0070676_10008106 | 3300005328 | Bacteria | 5650 |
| 11 | Ga0070690_100005969 | 3300005330 | Bacteria | 6877 |
| 12 | Ga0070690_100060132 | 3300005330 | Bacteria | 2445 |
| 13 | Ga0070690_100403703 | 3300005330 | Bacteria | 1004 |
| 14 | Ga0070670_100205419 | 3300005331 | Bacteria | 1712 |
| 15 | Ga0070677_10002411 | 3300005333 | Bacteria | 5965 |
| 16 | Ga0068869_100004332 | 3300005334 | Bacteria | 8810 |
| 17 | Ga0068869_100019219 | 3300005334 | Bacteria | 4663 |
| 18 | Ga0068869_100030088 | 3300005334 | Bacteria | 3809 |
| 19 | Ga0068869_100081702 | 3300005334 | Bacteria | 2414 |
| 20 | Ga0070666_10001889 | 3300005335 | Bacteria | 12748 |
| 21 | Ga0070680_100019081 | 3300005336 | Bacteria | 5429 |
| 22 | Ga0070680_100055735 | 3300005336 | Bacteria | 3230 |
| 23 | Ga0070680_100225876 | 3300005336 | Bacteria | 1581 |
| 24 | Ga0068868_100038678 | 3300005338 | Bacteria | 3703 |
| 25 | Ga0068868_100746633 | 3300005338 | Bacteria | 879 |
| 26 | Ga0070689_100011408 | 3300005340 | Bacteria | 6366 |
| 27 | Ga0070689_100066434 | 3300005340 | Bacteria | 2809 |
| 28 | Ga0070687_100011217 | 3300005343 | Bacteria | 3912 |
| 29 | Ga0070687_100079559 | 3300005343 | Bacteria | 1785 |
| 30 | Ga0070687_100116518 | 3300005343 | Bacteria | 1521 |
| 31 | Ga0070692_10019347 | 3300005345 | Bacteria | 3285 |
| 32 | Ga0070692_10029742 | 3300005345 | Bacteria | 2726 |
| 33 | Ga0070692_10168692 | 3300005345 | Bacteria | 1260 |
| 34 | Ga0070692_10235958 | 3300005345 | Bacteria | 1088 |
| 35 | Ga0070668_100047700 | 3300005347 | Bacteria | 3293 |
| 36 | Ga0070668_100127885 | 3300005347 | Bacteria | 2036 |
| 37 | Ga0070668_100144256 | 3300005347 | Bacteria | 1921 |
| 38 | Ga0070669_100040122 | 3300005353 | Bacteria | 3402 |
| 39 | Ga0070669_100091953 | 3300005353 | Bacteria | 2276 |
| 40 | Ga0070675_100002630 | 3300005354 | Bacteria | 13494 |
| 41 | Ga0070675_100042071 | 3300005354 | Bacteria | 3732 |
| 42 | Ga0070675_100313930 | 3300005354 | Bacteria | 1383 |
| 43 | Ga0070671_100010559 | 3300005355 | Bacteria | 7415 |
| 44 | Ga0070671_100016816 | 3300005355 | Bacteria | 5914 |
| 45 | Ga0070671_100044385 | 3300005355 | Bacteria | 3694 |
| 46 | Ga0070674_100200041 | 3300005356 | Bacteria | 1542 |
| 47 | Ga0070673_100042648 | 3300005364 | Bacteria | 3499 |
| 48 | Ga0070673_100217654 | 3300005364 | Bacteria | 1651 |
| 49 | Ga0070688_100072006 | 3300005365 | Bacteria | 2214 |
| 50 | Ga0070667_100011577 | 3300005367 | Bacteria | 7291 |
| 51 | Ga0070667_100014472 | 3300005367 | Bacteria | 6518 |
| 52 | Ga0070714_100059530 | 3300005435 | Bacteria | 3275 |
| 53 | Ga0070714_100083363 | 3300005435 | Bacteria | 2787 |
| 54 | Ga0070705_100003022 | 3300005440 | Bacteria | 8313 |
| 55 | Ga0070705_100127233 | 3300005440 | Bacteria | 1656 |
| 56 | Ga0070705_100237547 | 3300005440 | Bacteria | 1271 |
| 57 | Ga0070700_100003507 | 3300005441 | Bacteria | 8091 |
| 58 | Ga0070700_100387100 | 3300005441 | Bacteria | 1047 |
| 59 | Ga0070694_100005593 | 3300005444 | Bacteria | 7617 |
| 60 | Ga0070694_100092879 | 3300005444 | Bacteria | 2120 |
| 61 | Ga0070694_100126096 | 3300005444 | Bacteria | 1843 |
| 62 | Ga0070694_100193556 | 3300005444 | Bacteria | 1511 |
| 63 | Ga0070678_100036514 | 3300005456 | Bacteria | 3441 |
| 64 | Ga0070678_100073025 | 3300005456 | Bacteria | 2573 |
| 65 | Ga0070662_100020143 | 3300005457 | Bacteria | 4539 |
| 66 | Ga0070662_100108122 | 3300005457 | Bacteria | 2115 |
| 67 | Ga0070681_10012298 | 3300005458 | Bacteria | 8489 |
| 68 | Ga0068867_100001086 | 3300005459 | Bacteria | 18625 |
| 69 | Ga0068867_100006301 | 3300005459 | Bacteria | 8395 |
| 70 | Ga0068867_100062804 | 3300005459 | Bacteria | 2760 |
| 71 | Ga0068867_100133791 | 3300005459 | Bacteria | 1930 |
| 72 | Ga0068867_100154201 | 3300005459 | Bacteria | 1806 |
| 73 | Ga0070685_10493892 | 3300005466 | Bacteria | 865 |
| 74 | Ga0070698_100014017 | 3300005471 | Bacteria | 8477 |
| 75 | Ga0070698_100126373 | 3300005471 | Bacteria | 2514 |
| 76 | Ga0070699_100055772 | 3300005518 | Bacteria | 3421 |
| 77 | Ga0070699_100056960 | 3300005518 | Bacteria | 3385 |
| 78 | Ga0070699_100436424 | 3300005518 | Bacteria | 1186 |
| 79 | Ga0070679_100056283 | 3300005530 | Bacteria | 3918 |
| 80 | Ga0070684_100008489 | 3300005535 | Bacteria | 8034 |
| 81 | Ga0070697_100004865 | 3300005536 | Bacteria | 10303 |
| 82 | Ga0070697_100005701 | 3300005536 | Bacteria | 9591 |
| 83 | Ga0068853_100837283 | 3300005539 | Bacteria | 882 |
| 84 | Ga0068853_100885611 | 3300005539 | Bacteria | 857 |
| 85 | Ga0070672_100004725 | 3300005543 | Bacteria | 8940 |
| 86 | Ga0070672_100077153 | 3300005543 | Bacteria | 2663 |
| 87 | Ga0070672_100139359 | 3300005543 | Bacteria | 1999 |
| 88 | Ga0070686_100012900 | 3300005544 | Bacteria | 4771 |
| 89 | Ga0070686_100403804 | 3300005544 | Bacteria | 1040 |
| 90 | Ga0070695_100087420 | 3300005545 | Bacteria | 2074 |
| 91 | Ga0070696_100009913 | 3300005546 | Bacteria | 6373 |
| 92 | Ga0070696_100028084 | 3300005546 | Bacteria | 3837 |
| 93 | Ga0070696_100055717 | 3300005546 | Bacteria | 2757 |
| 94 | Ga0070696_100069516 | 3300005546 | Bacteria | 2474 |
| 95 | Ga0070696_100520855 | 3300005546 | Bacteria | 949 |
| 96 | Ga0070693_100304747 | 3300005547 | Bacteria | 1075 |
| 97 | Ga0070704_100002583 | 3300005549 | Bacteria | 10212 |
| 98 | Ga0070704_100009156 | 3300005549 | Bacteria | 5972 |
| 99 | Ga0070704_100109550 | 3300005549 | Bacteria | 2098 |
| 100 | Ga0070704_100428010 | 3300005549 | Bacteria | 1135 |
| 101 | Ga0070664_100462481 | 3300005564 | Bacteria | 1166 |
| 102 | Ga0068857_100229490 | 3300005577 | Bacteria | 1698 |
| 103 | Ga0068854_100378415 | 3300005578 | Bacteria | 1166 |
| 104 | Ga0068856_100493265 | 3300005614 | Bacteria | 1246 |
| 105 | Ga0070702_100025696 | 3300005615 | Bacteria | 3158 |
| 106 | Ga0070702_100093456 | 3300005615 | Bacteria | 1829 |
| 107 | Ga0070702_100166575 | 3300005615 | Bacteria | 1430 |
| 108 | Ga0068852_100012855 | 3300005616 | Bacteria | 6382 |
| 109 | Ga0068852_100212763 | 3300005616 | Bacteria | 1835 |
| 110 | Ga0068852_100255336 | 3300005616 | Bacteria | 1681 |
| 111 | Ga0068859_100007812 | 3300005617 | Bacteria | 10858 |
| 112 | Ga0068859_100307229 | 3300005617 | Bacteria | 1679 |
| 113 | Ga0068859_100636880 | 3300005617 | Bacteria | 1158 |
| 114 | Ga0068864_100001309 | 3300005618 | Bacteria | 20721 |
| 115 | Ga0068864_100067142 | 3300005618 | Bacteria | 3114 |
| 116 | Ga0068864_100333926 | 3300005618 | Bacteria | 1427 |
| 117 | Ga0068861_100006046 | 3300005719 | Bacteria | 8233 |
| 118 | Ga0068861_100027677 | 3300005719 | Bacteria | 4132 |
| 119 | Ga0068870_10068810 | 3300005840 | Bacteria | 1924 |
| 120 | Ga0068863_100009149 | 3300005841 | Bacteria | 9667 |
| 121 | Ga0068863_100013734 | 3300005841 | Bacteria | 7808 |
| 122 | Ga0068863_100762482 | 3300005841 | Bacteria | 964 |
| 123 | Ga0068858_100002892 | 3300005842 | Bacteria | 17265 |
| 124 | Ga0068858_100006541 | 3300005842 | Bacteria | 11334 |
| 125 | Ga0068858_100169363 | 3300005842 | Bacteria | 2059 |
| 126 | Ga0068858_100397499 | 3300005842 | Bacteria | 1324 |
| 127 | Ga0068858_100407886 | 3300005842 | Bacteria | 1306 |
| 128 | Ga0068860_100000445 | 3300005843 | Bacteria | 52236 |
| 129 | Ga0068860_100310575 | 3300005843 | Bacteria | 1546 |
| 130 | Ga0068860_100924395 | 3300005843 | Bacteria | 889 |
| 131 | Ga0068862_100010162 | 3300005844 | Bacteria | 7766 |
| 132 | Ga0068862_100223531 | 3300005844 | Bacteria | 1705 |
| 133 | Ga0068862_100654684 | 3300005844 | Bacteria | 1013 |
| 134 | Ga0081455_10244989 | 3300005937 | Bacteria | 1315 |
| 135 | Ga0081539_10001857 | 3300005985 | Bacteria | 33255 |
| 136 | Ga0070717_10094835 | 3300006028 | Bacteria | 2525 |
| 137 | Ga0075365_10003967 | 3300006038 | Bacteria | 7748 |
| 138 | Ga0075365_10017503 | 3300006038 | Bacteria | 4385 |
| 139 | Ga0075363_100019885 | 3300006048 | Bacteria | 3362 |
| 140 | Ga0075364_10154517 | 3300006051 | Bacteria | 1547 |
| 141 | Ga0075432_10028785 | 3300006058 | Bacteria | 1917 |
| 142 | Ga0075362_10004353 | 3300006177 | Bacteria | 5074 |
| 143 | Ga0075362_10011152 | 3300006177 | Bacteria | 3533 |
| 144 | Ga0097621_100048088 | 3300006237 | Bacteria | 3459 |
| 145 | Ga0097621_100056051 | 3300006237 | Bacteria | 3219 |
| 146 | Ga0097621_100657924 | 3300006237 | Bacteria | 962 |
| 147 | Ga0068871_100010108 | 3300006358 | Bacteria | 6866 |
| 148 | Ga0068871_100111652 | 3300006358 | Bacteria | 2299 |
| 149 | Ga0075428_100000390 | 3300006844 | Bacteria | 43360 |
| 150 | Ga0075428_100061243 | 3300006844 | Bacteria | 4121 |
| 151 | Ga0075428_100296709 | 3300006844 | Bacteria | 1738 |
| 152 | Ga0075428_100426217 | 3300006844 | Bacteria | 1421 |
| 153 | Ga0075430_100000520 | 3300006846 | Bacteria | 28959 |
| 154 | Ga0075430_100011416 | 3300006846 | Bacteria | 7541 |
| 155 | Ga0075430_100018097 | 3300006846 | Bacteria | 5996 |
| 156 | Ga0075430_100100659 | 3300006846 | Bacteria | 2413 |
| 157 | Ga0075430_100598118 | 3300006846 | Bacteria | 910 |
| 158 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 159 | Ga0075431_100009047 | 3300006847 | Bacteria | 9987 |
| 160 | Ga0075431_100021141 | 3300006847 | Bacteria | 6649 |
| 161 | Ga0075431_100341770 | 3300006847 | Bacteria | 1506 |
| 162 | Ga0075431_100343858 | 3300006847 | Bacteria | 1501 |
| 163 | Ga0075433_10153428 | 3300006852 | Bacteria | 2049 |
| 164 | Ga0075433_10208504 | 3300006852 | Bacteria | 1737 |
| 165 | Ga0075433_10386854 | 3300006852 | Bacteria | 1235 |
| 166 | Ga0075434_100000132 | 3300006871 | Bacteria | 44951 |
| 167 | Ga0075434_100031833 | 3300006871 | Bacteria | 5201 |
| 168 | Ga0075434_100138712 | 3300006871 | Bacteria | 2451 |
| 169 | Ga0075434_100171243 | 3300006871 | Bacteria | 2191 |
| 170 | Ga0075434_100973233 | 3300006871 | Bacteria | 863 |
| 171 | Ga0075429_100000638 | 3300006880 | Bacteria | 27089 |
| 172 | Ga0075429_100001974 | 3300006880 | Bacteria | 17065 |
| 173 | Ga0075429_100135451 | 3300006880 | Bacteria | 2155 |
| 174 | Ga0075429_100141972 | 3300006880 | Bacteria | 2102 |
| 175 | Ga0075429_100646000 | 3300006880 | Bacteria | 927 |
| 176 | Ga0068865_100002093 | 3300006881 | Bacteria | 11787 |
| 177 | Ga0068865_100023360 | 3300006881 | Bacteria | 4047 |
| 178 | Ga0068865_100207516 | 3300006881 | Bacteria | 1524 |
| 179 | Ga0068865_100256893 | 3300006881 | Bacteria | 1381 |
| 180 | Ga0075436_100000638 | 3300006914 | Bacteria | 23058 |
| 181 | Ga0075436_100015380 | 3300006914 | Bacteria | 5241 |
| 182 | Ga0075436_100059701 | 3300006914 | Bacteria | 2634 |
| 183 | Ga0075436_100061090 | 3300006914 | Bacteria | 2603 |
| 184 | Ga0097620_100007812 | 3300006931 | Bacteria | 10858 |
| 185 | Ga0097620_100307225 | 3300006931 | Bacteria | 1679 |
| 186 | Ga0097620_100636870 | 3300006931 | Bacteria | 1158 |
| 187 | Ga0099826_10034418 | 3300006948 | Bacteria | 3619 |
| 188 | Ga0075435_100001341 | 3300007076 | Bacteria | 15839 |
| 189 | Ga0075435_100006450 | 3300007076 | Bacteria | 8299 |
| 190 | Ga0075435_100037184 | 3300007076 | Bacteria | 3875 |
| 191 | Ga0075435_100042487 | 3300007076 | Bacteria | 3637 |
| 192 | Ga0075435_100265669 | 3300007076 | Bacteria | 1463 |
| 193 | Ga0075435_100416511 | 3300007076 | Bacteria | 1157 |
| 194 | Ga0099794_10047137 | 3300007265 | Bacteria | 2066 |
| 195 | Ga0111539_10006444 | 3300009094 | Bacteria | 15127 |
| 196 | Ga0111539_10006454 | 3300009094 | Bacteria | 15113 |
| 197 | Ga0111539_10085259 | 3300009094 | Bacteria | 3713 |
| 198 | Ga0111539_10517323 | 3300009094 | Bacteria | 1390 |
| 199 | Ga0111539_11037895 | 3300009094 | Bacteria | 953 |
| 200 | Ga0105245_10047244 | 3300009098 | Bacteria | 3847 |
| 201 | Ga0105245_10051495 | 3300009098 | Bacteria | 3691 |
| 202 | Ga0105245_10060255 | 3300009098 | Bacteria | 3418 |
| 203 | Ga0105245_10082487 | 3300009098 | Bacteria | 2941 |
| 204 | Ga0114129_10000104 | 3300009147 | Bacteria | 83195 |
| 205 | Ga0114129_10007443 | 3300009147 | Bacteria | 15595 |
| 206 | Ga0114129_10015516 | 3300009147 | Bacteria | 10831 |
| 207 | Ga0114129_10331229 | 3300009147 | Bacteria | 2021 |
| 208 | Ga0105243_10000293 | 3300009148 | Bacteria | 55165 |
| 209 | Ga0105243_10021971 | 3300009148 | Bacteria | 4846 |
| 210 | Ga0105243_10915615 | 3300009148 | Bacteria | 873 |
| 211 | Ga0105242_10002945 | 3300009176 | Bacteria | 13311 |
| 212 | Ga0105242_10099494 | 3300009176 | Bacteria | 2461 |
| 213 | Ga0105242_10316876 | 3300009176 | Bacteria | 1429 |
| 214 | Ga0105242_10483246 | 3300009176 | Bacteria | 1174 |
| 215 | Ga0105248_10000595 | 3300009177 | Bacteria | 41224 |
| 216 | Ga0105248_10075724 | 3300009177 | Bacteria | 3782 |
| 217 | Ga0105248_10201416 | 3300009177 | Bacteria | 2243 |
| 218 | Ga0105249_10059135 | 3300009553 | Bacteria | 3514 |
| 219 | Ga0105249_10102811 | 3300009553 | Bacteria | 2690 |
| 220 | Ga0105249_10193064 | 3300009553 | Bacteria | 1988 |
| 221 | Ga0099796_10064994 | 3300010159 | Bacteria | 1303 |
| 222 | Ga0105239_10280495 | 3300010375 | Bacteria | 1876 |
| 223 | Ga0105246_10043687 | 3300011119 | Bacteria | 3042 |
| 224 | Ga0105246_10063724 | 3300011119 | Bacteria | 2572 |
| 225 | Ga0157374_10021499 | 3300013296 | Bacteria | 5742 |
| 226 | Ga0157378_10296911 | 3300013297 | Bacteria | 1562 |
| 227 | Ga0163162_10036523 | 3300013306 | Bacteria | 4898 |
| 228 | Ga0163162_10054073 | 3300013306 | Bacteria | 4037 |
| 229 | Ga0163162_10667626 | 3300013306 | Bacteria | 1162 |
| 230 | Ga0163162_10814830 | 3300013306 | Bacteria | 1050 |
| 231 | Ga0157375_10012725 | 3300013308 | Bacteria | 7468 |
| 232 | Ga0157375_10179321 | 3300013308 | Bacteria | 2269 |
| 233 | Ga0163163_10001922 | 3300014325 | Bacteria | 17590 |
| 234 | Ga0157380_10092441 | 3300014326 | Bacteria | 2500 |
| 235 | Ga0157380_10156949 | 3300014326 | Bacteria | 1973 |
| 236 | Ga0157380_10252527 | 3300014326 | Bacteria | 1597 |
| 237 | Ga0157380_10260290 | 3300014326 | Bacteria | 1575 |
| 238 | Ga0157380_10685965 | 3300014326 | Bacteria | 1027 |
| 239 | Ga0157377_10051344 | 3300014745 | Bacteria | 2325 |
| 240 | Ga0157379_10045614 | 3300014968 | Bacteria | 3912 |
| 241 | Ga0157379_10075107 | 3300014968 | Bacteria | 3026 |
| 242 | Ga0157376_10126000 | 3300014969 | Bacteria | 2278 |
| 243 | Ga0157376_10949251 | 3300014969 | Bacteria | 880 |
| 244 | Ga0182006_1040886 | 3300015261 | Bacteria | 1823 |
| 245 | Ga0182007_10002631 | 3300015262 | Bacteria | 8833 |
| 246 | Ga0163161_10020823 | 3300017792 | Bacteria | 4605 |
| 247 | Ga0163161_10064799 | 3300017792 | Bacteria | 2666 |
| 248 | Ga0163161_10104436 | 3300017792 | Bacteria | 2112 |
| 249 | Ga0213876_10240135 | 3300021384 | Bacteria | 963 |
| 250 | Ga0209565_1000042 | 3300025263 | Bacteria | 239712 |
| 251 | Ga0209673_1000071 | 3300025273 | Bacteria | 239966 |
| 252 | Ga0209130_1001720 | 3300025284 | Bacteria | 13127 |
| 253 | Ga0209675_1000041 | 3300025291 | Bacteria | 239712 |
| 254 | Ga0209675_1002415 | 3300025291 | Bacteria | 9634 |
| 255 | Ga0209676_1000267 | 3300025292 | Bacteria | 109237 |
| 256 | Ga0209676_1006250 | 3300025292 | Bacteria | 5935 |
| 257 | Ga0209025_1005622 | 3300025294 | Bacteria | 10120 |
| 258 | Ga0209564_1040927 | 3300025295 | Bacteria | 1250 |
| 259 | Ga0209050_1009624 | 3300025298 | Bacteria | 4912 |
| 260 | Ga0209050_1015410 | 3300025298 | Bacteria | 3213 |
| 261 | Ga0209256_1015779 | 3300025299 | Bacteria | 2620 |
| 262 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 263 | Ga0209051_1000230 | 3300025303 | Bacteria | 94027 |
| 264 | Ga0209051_1005092 | 3300025303 | Bacteria | 7811 |
| 265 | Ga0209051_1015927 | 3300025303 | Bacteria | 3436 |
| 266 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 267 | Ga0209257_1004695 | 3300025304 | Bacteria | 10259 |
| 268 | Ga0209257_1005713 | 3300025304 | Bacteria | 8541 |
| 269 | Ga0207653_10060416 | 3300025885 | Bacteria | 1277 |
| 270 | Ga0207682_10008973 | 3300025893 | Bacteria | 3951 |
| 271 | Ga0207682_10112704 | 3300025893 | Bacteria | 1199 |
| 272 | Ga0207682_10174702 | 3300025893 | Bacteria | 979 |
| 273 | Ga0207642_10302671 | 3300025899 | Bacteria | 927 |
| 274 | Ga0207642_10341732 | 3300025899 | Bacteria | 880 |
| 275 | Ga0207680_10005090 | 3300025903 | Bacteria | 6265 |
| 276 | Ga0207680_10128354 | 3300025903 | Bacteria | 1668 |
| 277 | Ga0207680_10238129 | 3300025903 | Bacteria | 1253 |
| 278 | Ga0207645_10004582 | 3300025907 | Bacteria | 10192 |
| 279 | Ga0207643_10200037 | 3300025908 | Bacteria | 1216 |
| 280 | Ga0207705_10493148 | 3300025909 | Bacteria | 951 |
| 281 | Ga0207684_10098185 | 3300025910 | Bacteria | 2501 |
| 282 | Ga0207707_10007969 | 3300025912 | Bacteria | 9208 |
| 283 | Ga0207707_10262326 | 3300025912 | Bacteria | 1499 |
| 284 | Ga0207693_10099002 | 3300025915 | Bacteria | 2286 |
| 285 | Ga0207660_10037119 | 3300025917 | Bacteria | 3393 |
| 286 | Ga0207660_10064740 | 3300025917 | Bacteria | 2639 |
| 287 | Ga0207660_10463210 | 3300025917 | Bacteria | 1026 |
| 288 | Ga0207662_10001475 | 3300025918 | Bacteria | 11429 |
| 289 | Ga0207662_10073492 | 3300025918 | Bacteria | 2074 |
| 290 | Ga0207662_10111522 | 3300025918 | Bacteria | 1706 |
| 291 | Ga0207662_10310098 | 3300025918 | Bacteria | 1051 |
| 292 | Ga0207646_10027895 | 3300025922 | Bacteria | 5147 |
| 293 | Ga0207646_10401941 | 3300025922 | Bacteria | 1237 |
| 294 | Ga0207681_10070992 | 3300025923 | Bacteria | 2427 |
| 295 | Ga0207681_10108238 | 3300025923 | Bacteria | 2017 |
| 296 | Ga0207659_10008930 | 3300025926 | Bacteria | 6247 |
| 297 | Ga0207659_10018757 | 3300025926 | Bacteria | 4540 |
| 298 | Ga0207659_10057571 | 3300025926 | Bacteria | 2787 |
| 299 | Ga0207687_10027356 | 3300025927 | Bacteria | 3826 |
| 300 | Ga0207687_10086483 | 3300025927 | Bacteria | 2276 |
| 301 | Ga0207700_10046909 | 3300025928 | Bacteria | 3199 |
| 302 | Ga0207644_10162562 | 3300025931 | Bacteria | 1736 |
| 303 | Ga0207706_10043730 | 3300025933 | Bacteria | 3969 |
| 304 | Ga0207706_10058604 | 3300025933 | Bacteria | 3392 |
| 305 | Ga0207686_10013074 | 3300025934 | Bacteria | 4583 |
| 306 | Ga0207686_10073565 | 3300025934 | Bacteria | 2205 |
| 307 | Ga0207686_10077384 | 3300025934 | Bacteria | 2160 |
| 308 | Ga0207709_10000076 | 3300025935 | Bacteria | 173292 |
| 309 | Ga0207709_10012814 | 3300025935 | Bacteria | 4623 |
| 310 | Ga0207709_10094648 | 3300025935 | Bacteria | 1961 |
| 311 | Ga0207709_10536812 | 3300025935 | Bacteria | 918 |
| 312 | Ga0207670_10232681 | 3300025936 | Bacteria | 1416 |
| 313 | Ga0207670_10239309 | 3300025936 | Bacteria | 1398 |
| 314 | Ga0207670_10348202 | 3300025936 | Bacteria | 1172 |
| 315 | Ga0207670_10371853 | 3300025936 | Bacteria | 1136 |
| 316 | Ga0207670_10535351 | 3300025936 | Bacteria | 955 |
| 317 | Ga0207669_10019212 | 3300025937 | Bacteria | 3552 |
| 318 | Ga0207704_10000959 | 3300025938 | Bacteria | 12771 |
| 319 | Ga0207665_10002514 | 3300025939 | Bacteria | 12330 |
| 320 | Ga0207665_10133396 | 3300025939 | Bacteria | 1765 |
| 321 | Ga0207691_10010762 | 3300025940 | Bacteria | 8782 |
| 322 | Ga0207691_10013009 | 3300025940 | Bacteria | 7968 |
| 323 | Ga0207691_10182815 | 3300025940 | Bacteria | 1831 |
| 324 | Ga0207691_10187331 | 3300025940 | Bacteria | 1806 |
| 325 | Ga0207711_10014494 | 3300025941 | Bacteria | 6551 |
| 326 | Ga0207711_10032992 | 3300025941 | Bacteria | 4379 |
| 327 | Ga0207711_10044194 | 3300025941 | Bacteria | 3802 |
| 328 | Ga0207689_10004853 | 3300025942 | Bacteria | 12116 |
| 329 | Ga0207689_10066161 | 3300025942 | Bacteria | 2973 |
| 330 | Ga0207689_10130471 | 3300025942 | Bacteria | 2068 |
| 331 | Ga0207689_10305431 | 3300025942 | Bacteria | 1319 |
| 332 | Ga0207679_10346775 | 3300025945 | Bacteria | 1293 |
| 333 | Ga0207651_10055288 | 3300025960 | Bacteria | 2725 |
| 334 | Ga0207651_10342988 | 3300025960 | Bacteria | 1255 |
| 335 | Ga0207712_10011898 | 3300025961 | Bacteria | 5548 |
| 336 | Ga0207712_10014058 | 3300025961 | Bacteria | 5138 |
| 337 | Ga0207668_10178096 | 3300025972 | Bacteria | 1674 |
| 338 | Ga0207668_10196102 | 3300025972 | Bacteria | 1604 |
| 339 | Ga0207668_10387152 | 3300025972 | Bacteria | 1178 |
| 340 | Ga0207640_10421571 | 3300025981 | Bacteria | 1092 |
| 341 | Ga0207658_10003494 | 3300025986 | Bacteria | 11091 |
| 342 | Ga0207658_10017863 | 3300025986 | Bacteria | 4888 |
| 343 | Ga0207677_10024617 | 3300026023 | Bacteria | 3743 |
| 344 | Ga0207677_10040343 | 3300026023 | Bacteria | 3077 |
| 345 | Ga0207703_10001799 | 3300026035 | Bacteria | 19132 |
| 346 | Ga0207703_10032151 | 3300026035 | Bacteria | 4152 |
| 347 | Ga0207703_10136337 | 3300026035 | Bacteria | 2125 |
| 348 | Ga0207678_10115574 | 3300026067 | Bacteria | 2289 |
| 349 | Ga0207702_10012690 | 3300026078 | Bacteria | 7011 |
| 350 | Ga0207641_10015255 | 3300026088 | Bacteria | 6295 |
| 351 | Ga0207641_10020481 | 3300026088 | Bacteria | 5432 |
| 352 | Ga0207641_10091584 | 3300026088 | Bacteria | 2661 |
| 353 | Ga0207641_10269131 | 3300026088 | Bacteria | 1598 |
| 354 | Ga0207648_10004422 | 3300026089 | Bacteria | 14428 |
| 355 | Ga0207648_10004667 | 3300026089 | Bacteria | 14019 |
| 356 | Ga0207648_10021486 | 3300026089 | Bacteria | 5801 |
| 357 | Ga0207648_10079880 | 3300026089 | Bacteria | 2853 |
| 358 | Ga0207648_10148602 | 3300026089 | Bacteria | 2067 |
| 359 | Ga0207648_10277875 | 3300026089 | Bacteria | 1497 |
| 360 | Ga0207676_10005019 | 3300026095 | Bacteria | 9371 |
| 361 | Ga0207676_10052933 | 3300026095 | Bacteria | 3175 |
| 362 | Ga0207676_10280300 | 3300026095 | Bacteria | 1513 |
| 363 | Ga0207674_10071800 | 3300026116 | Bacteria | 3478 |
| 364 | Ga0207675_100003929 | 3300026118 | Bacteria | 14428 |
| 365 | Ga0207675_100007314 | 3300026118 | Bacteria | 10439 |
| 366 | Ga0207675_100034843 | 3300026118 | Bacteria | 4695 |
| 367 | Ga0207683_10007125 | 3300026121 | Bacteria | 9584 |
| 368 | Ga0207683_10054461 | 3300026121 | Bacteria | 3508 |
| 369 | Ga0207683_10087574 | 3300026121 | Bacteria | 2770 |
| 370 | Ga0207683_10175359 | 3300026121 | Bacteria | 1943 |
| 371 | Ga0207698_10013120 | 3300026142 | Bacteria | 5455 |
| 372 | Ga0209969_1000217 | 3300027360 | Bacteria | 7674 |
| 373 | Ga0209967_1000307 | 3300027364 | Bacteria | 6635 |
| 374 | Ga0209981_1007810 | 3300027378 | Bacteria | 1447 |
| 375 | Ga0209995_1002322 | 3300027471 | Bacteria | 3003 |
| 376 | Ga0209995_1017851 | 3300027471 | Bacteria | 1168 |
| 377 | Ga0209968_1001103 | 3300027526 | Bacteria | 4119 |
| 378 | Ga0209999_1000946 | 3300027543 | Bacteria | 4895 |
| 379 | Ga0209999_1021022 | 3300027543 | Bacteria | 1199 |
| 380 | Ga0209588_1070903 | 3300027671 | Bacteria | 1126 |
| 381 | Ga0209971_1016951 | 3300027682 | Bacteria | 1728 |
| 382 | Ga0209966_1004350 | 3300027695 | Bacteria | 2401 |
| 383 | Ga0209966_1040200 | 3300027695 | Bacteria | 973 |
| 384 | Ga0209966_1041344 | 3300027695 | Bacteria | 962 |
| 385 | Ga0207428_10006513 | 3300027907 | Bacteria | 10774 |
| 386 | Ga0207428_10036411 | 3300027907 | Bacteria | 4014 |
| 387 | Ga0207428_10062275 | 3300027907 | Bacteria | 2951 |
| 388 | Ga0207428_10064629 | 3300027907 | Bacteria | 2888 |
| 389 | Ga0207428_10130805 | 3300027907 | Bacteria | 1920 |
| 390 | Ga0268266_10132081 | 3300028379 | Bacteria | 2234 |
| 391 | Ga0268265_10003470 | 3300028380 | Bacteria | 11327 |
| 392 | Ga0268265_10004016 | 3300028380 | Bacteria | 10360 |
| 393 | Ga0268264_10009491 | 3300028381 | Bacteria | 8058 |
| 394 | Ga0307515_10000014 | 3300028794 | Bacteria | 562358 |
| 395 | Ga0265338_10342619 | 3300028800 | Bacteria | 1077 |
| 396 | Ga0307408_100111218 | 3300031548 | Bacteria | 2104 |
| 397 | Ga0307408_100158207 | 3300031548 | Bacteria | 1797 |
| 398 | Ga0307408_100204454 | 3300031548 | Bacteria | 1601 |
| 399 | Ga0307408_100604311 | 3300031548 | Bacteria | 975 |
| 400 | Ga0316575_10004257 | 3300031665 | Bacteria | 5024 |
| 401 | Ga0316575_10012111 | 3300031665 | Bacteria | 3202 |
| 402 | Ga0316579_10005426 | 3300031691 | Bacteria | 5146 |
| 403 | Ga0316578_10005156 | 3300031728 | Bacteria | 6297 |
| 404 | Ga0307405_10003735 | 3300031731 | Bacteria | 7071 |
| 405 | Ga0307405_10471017 | 3300031731 | Bacteria | 1000 |
| 406 | Ga0307413_10026207 | 3300031824 | Bacteria | 3209 |
| 407 | Ga0307413_10351451 | 3300031824 | Bacteria | 1138 |
| 408 | Ga0307410_10014455 | 3300031852 | Bacteria | 4644 |
| 409 | Ga0307406_10005448 | 3300031901 | Bacteria | 6964 |
| 410 | Ga0307406_10060538 | 3300031901 | Bacteria | 2442 |
| 411 | Ga0307407_10002451 | 3300031903 | Bacteria | 7268 |
| 412 | Ga0307412_10009014 | 3300031911 | Bacteria | 5717 |
| 413 | Ga0307412_10131568 | 3300031911 | Bacteria | 1818 |
| 414 | Ga0307412_10475281 | 3300031911 | Bacteria | 1035 |
| 415 | Ga0307409_100022174 | 3300031995 | Bacteria | 4371 |
| 416 | Ga0307409_100060900 | 3300031995 | Bacteria | 2946 |
| 417 | Ga0307416_100000708 | 3300032002 | Bacteria | 17322 |
| 418 | Ga0307416_100001584 | 3300032002 | Bacteria | 12484 |
| 419 | Ga0307416_100644672 | 3300032002 | Bacteria | 1143 |
| 420 | Ga0307414_10031261 | 3300032004 | Bacteria | 3490 |
| 421 | Ga0307414_10348942 | 3300032004 | Bacteria | 1269 |
| 422 | Ga0307411_10002419 | 3300032005 | Bacteria | 8242 |
| 423 | Ga0307411_10043524 | 3300032005 | Bacteria | 2873 |
| 424 | Ga0307411_10058141 | 3300032005 | Bacteria | 2558 |
| 425 | Ga0307411_10501255 | 3300032005 | Bacteria | 1026 |
| 426 | Ga0307415_100000614 | 3300032126 | Bacteria | 15599 |
| 427 | Ga0307415_100011692 | 3300032126 | Bacteria | 5038 |
| 428 | Ga0316583_10039443 | 3300032133 | Bacteria | 1672 |
| 429 | Ga0373958_0085622 | 3300034819 | Bacteria | 720 |
| 430 | Ga0373926_0008656 | 3300035083 | Bacteria | 3386 |
| 431 | Ga0373934_0014547 | 3300035086 | Bacteria | 2982 |
| 432 | Ga0373940_0042687 | 3300035088 | Bacteria | 1251 |
| 433 | Ga0373944_0011437 | 3300035089 | Bacteria | 2431 |
| 434 | Ga0373923_0030765 | 3300035111 | Bacteria | 2161 |
| 435 | Ga0373923_0099352 | 3300035111 | Bacteria | 1282 |
| 436 | Ga0373936_0052583 | 3300035113 | Bacteria | 1650 |
| 437 | Ga0373945_0025276 | 3300035116 | Bacteria | 2062 |
| 438 | Ga0373953_0028534 | 3300035117 | Bacteria | 2153 |
| 439 | Ga0373953_0058600 | 3300035117 | Bacteria | 1570 |
| 440 | Ga0373953_0073036 | 3300035117 | Bacteria | 1417 |
| 441 | Ga0373954_0000033 | 3300035118 | Bacteria | 54385 |
| 442 | Ga0373954_0076756 | 3300035118 | Bacteria | 1593 |
| 443 | Ga0373956_0037187 | 3300035119 | Bacteria | 2151 |
| 444 | Ga0373960_0005406 | 3300035121 | Bacteria | 2958 |
| 445 | Ga0373960_0088817 | 3300035121 | Bacteria | 985 |
| 446 | Ga0373943_0029685 | 3300035170 | Bacteria | 2584 |
| 447 | Ga0373943_0157809 | 3300035170 | Bacteria | 1233 |
| 448 | Ga0373946_0005978 | 3300035171 | Bacteria | 4412 |
| 449 | Ga0373955_0120682 | 3300035172 | Bacteria | 1524 |
| 450 | Ga0373955_0137289 | 3300035172 | Bacteria | 1431 |
| 451 | Ga0373955_0144799 | 3300035172 | Bacteria | 1395 |
| 452 | Ga0373955_0152859 | 3300035172 | Bacteria | 1359 |
| 453 | Ga0373962_0034885 | 3300035242 | Bacteria | 1395 |
| 454 | Ga0316574_0006010 | 3300035398 | Bacteria | 6522 |
| 455 | Ga0373924_0003359 | 3300035410 | Bacteria | 5498 |
| 456 | Ga0373924_0196423 | 3300035410 | Bacteria | 889 |
| 457 | Ga0373931_0037609 | 3300035691 | Bacteria | 2528 |
| 458 | Ga0373935_0016858 | 3300035692 | Bacteria | 4423 |
| 459 | Ga0373935_0323187 | 3300035692 | Bacteria | 1095 |
| 460 | Ga0373927_0124659 | 3300035695 | Bacteria | 1681 |
| 461 | Ga0373927_0266369 | 3300035695 | Bacteria | 1127 |
| 462 | Ga0373933_0002353 | 3300035724 | Bacteria | 10700 |
| 463 | Ga0373933_0006414 | 3300035724 | Bacteria | 6403 |
| 464 | Ga0373933_0080313 | 3300035724 | Bacteria | 1999 |
| 465 | Ga0373947_0005516 | 3300035725 | Bacteria | 7382 |
| 466 | Ga0373947_0245236 | 3300035725 | Bacteria | 1183 |
| 467 | Ga0373937_0000377 | 3300036401 | Bacteria | 41470 |
| 468 | Ga0373937_0003134 | 3300036401 | Bacteria | 13831 |
| 469 | Ga0373937_0028570 | 3300036401 | Bacteria | 5047 |
| 470 | Ga0373937_0051673 | 3300036401 | Bacteria | 3767 |
| 471 | Ga0373937_0055460 | 3300036401 | Bacteria | 3638 |
| 472 | Ga0373937_0093825 | 3300036401 | Bacteria | 2783 |
| 473 | Ga0373937_0481177 | 3300036401 | Bacteria | 1179 |
| 474 | Ga0373937_0805311 | 3300036401 | Bacteria | 887 |
| 475 | Ga0316582_0007634 | 3300036647 | Bacteria | 5768 |
| 476 | Ga0373925_0150090 | 3300037068 | Bacteria | 1829 |
| 477 | Ga0395899_0006613 | 3300037312 | Bacteria | 8984 |
| 478 | Ga0395900_0036357 | 3300037418 | Bacteria | 5077 |
| 479 | Ga0395900_0187454 | 3300037418 | Bacteria | 2099 |
| 480 | Ga0395900_0347057 | 3300037418 | Bacteria | 1458 |
| 481 | Ga0395898_0062414 | 3300037466 | Bacteria | 3618 |
| 482 | Ga0395898_0138897 | 3300037466 | Bacteria | 2326 |
| 483 | Ga0395905_0017834 | 3300037471 | Bacteria | 6744 |
| 484 | Ga0316581_0010467 | 3300037588 | Bacteria | 2572 |
| 485 | Ga0395901_0028082 | 3300038443 | Bacteria | 5788 |
| 486 | Ga0395901_0274049 | 3300038443 | Bacteria | 1754 |
| 487 | Ga0395901_0295082 | 3300038443 | Bacteria | 1681 |
| 488 | Ga0436365_0852937 | 3300039437 | Bacteria | 998 |
| 489 | Ga0439436_0060856 | 3300041404 | Bacteria | 1057 |
| 490 | Ga0439453_0003181 | 3300041408 | Bacteria | 2338 |
| 491 | Ga0439466_0036387 | 3300041411 | Bacteria | 1662 |
| 492 | Ga0439465_0052638 | 3300041413 | Bacteria | 1336 |
| 493 | Ga0439433_0007425 | 3300041999 | Bacteria | 2367 |
| 494 | Ga0439437_003681 | 3300042000 | Bacteria | 1657 |
| 495 | Ga0439441_021612 | 3300042001 | Bacteria | 1189 |
| 496 | Ga0439442_015691 | 3300042002 | Bacteria | 1561 |
| 497 | Ga0439432_020405 | 3300042006 | Bacteria | 2203 |
| 498 | Ga0439450_004026 | 3300042008 | Bacteria | 2480 |
| 499 | Ga0439452_009876 | 3300042010 | Bacteria | 2798 |
| 500 | Ga0450911_000599 | 3300042115 | Bacteria | 10973 |
| 501 | Ga0450921_000584 | 3300042123 | Bacteria | 1809 |
| 502 | Ga0450923_001005 | 3300042125 | Bacteria | 3516 |
| 503 | Ga0450897_002588 | 3300042128 | Bacteria | 1374 |
| 504 | Ga0450892_005129 | 3300042130 | Bacteria | 1075 |
| 505 | Ga0450894_005256 | 3300042131 | Bacteria | 1676 |
| 506 | Ga0450907_018092 | 3300042146 | Bacteria | 1177 |
| 507 | Ga0439458_0012922 | 3300042157 | Bacteria | 1877 |
| 508 | Ga0450909_006969 | 3300042185 | Bacteria | 1631 |
| 509 | Ga0439434_0002341 | 3300042435 | Bacteria | 5514 |
| 510 | Ga0439435_0023098 | 3300042436 | Bacteria | 1629 |
| 511 | Ga0439444_0003193 | 3300042437 | Bacteria | 2302 |
| 512 | Ga0439464_0002254 | 3300042439 | Bacteria | 4719 |
| 513 | Ga0439464_0019192 | 3300042439 | Bacteria | 1865 |
| 514 | Ga0439464_0101343 | 3300042439 | Bacteria | 875 |
| 515 | Ga0439460_0019517 | 3300042461 | Bacteria | 1837 |
| 516 | Ga0439460_0027746 | 3300042461 | Bacteria | 1592 |
| 517 | Ga0450893_0016014 | 3300042532 | Bacteria | 1267 |
| 518 | Ga0451577_0479843 | 3300042876 | Bacteria | 1129 |
| 519 | Ga0453683_0172369 | 3300044673 | Bacteria | 1371 |
| 520 | Ga0453684_0140881 | 3300044712 | Bacteria | 2880 |
| 521 | Ga0466957_0189904 | 3300044842 | Bacteria | 1345 |
| 522 | Ga0466957_0432766 | 3300044842 | Bacteria | 904 |
| 523 | Ga0451576_0006891 | 3300045051 | Bacteria | 13760 |
| 524 | Ga0451576_0031204 | 3300045051 | Bacteria | 5685 |
| 525 | Ga0451576_0183272 | 3300045051 | Bacteria | 2186 |
| 526 | Ga0451576_0455958 | 3300045051 | Bacteria | 1342 |
| 527 | Ga0451576_0476451 | 3300045051 | Bacteria | 1311 |
| 528 | Ga0451576_0830180 | 3300045051 | Bacteria | 970 |
| 529 | Ga0451576_1014595 | 3300045051 | Bacteria | 870 |
| 530 | Ga0466958_0328617 | 3300045836 | Bacteria | 983 |
| 531 | Ga0466967_0079451 | 3300045976 | Bacteria | 2957 |
| 532 | Ga0495592_0001640 | 3300046454 | Bacteria | 15673 |
| 533 | Ga0495592_0193777 | 3300046454 | Bacteria | 1376 |
| 534 | Ga0495603_0083299 | 3300046455 | Bacteria | 1873 |
| 535 | Ga0495603_0110883 | 3300046455 | Bacteria | 1601 |
| 536 | Ga0495580_0090652 | 3300046472 | Bacteria | 2128 |
| 537 | Ga0495639_0009324 | 3300046475 | Bacteria | 4209 |
| 538 | Ga0495662_0006212 | 3300046476 | Bacteria | 5973 |
| 539 | Ga0495608_0001201 | 3300046511 | Bacteria | 18376 |
| 540 | Ga0495618_0186598 | 3300046514 | Bacteria | 1316 |
| 541 | Ga0495628_0016307 | 3300046516 | Bacteria | 6198 |
| 542 | Ga0495630_0006364 | 3300046517 | Bacteria | 8393 |
| 543 | Ga0495630_0009974 | 3300046517 | Bacteria | 6839 |
| 544 | Ga0495644_0111715 | 3300046523 | Bacteria | 1037 |
| 545 | Ga0495663_0034868 | 3300046525 | Bacteria | 1509 |
| 546 | Ga0495666_0008813 | 3300046526 | Bacteria | 5053 |
| 547 | Ga0495642_0038531 | 3300046528 | Bacteria | 1937 |
| 548 | Ga0495652_0114824 | 3300046529 | Bacteria | 2159 |
| 549 | Ga0495652_0254727 | 3300046529 | Bacteria | 1299 |
| 550 | Ga0495640_0074165 | 3300046533 | Bacteria | 2276 |
| 551 | Ga0495586_0001023 | 3300046535 | Bacteria | 15804 |
| 552 | Ga0495586_0001380 | 3300046535 | Bacteria | 13472 |
| 553 | Ga0495587_0078496 | 3300046536 | Bacteria | 1915 |
| 554 | Ga0495598_0019864 | 3300046537 | Bacteria | 1767 |
| 555 | Ga0495598_0024753 | 3300046537 | Bacteria | 1630 |
| 556 | Ga0495598_0124827 | 3300046537 | Bacteria | 876 |
| 557 | Ga0495621_0004599 | 3300046539 | Bacteria | 3897 |
| 558 | Ga0495621_0032660 | 3300046539 | Bacteria | 1791 |
| 559 | Ga0495621_0035209 | 3300046539 | Bacteria | 1733 |
| 560 | Ga0495667_0001209 | 3300046559 | Bacteria | 16884 |
| 561 | Ga0495656_0033821 | 3300046615 | Bacteria | 2089 |
| 562 | Ga0495656_0121859 | 3300046615 | Bacteria | 1232 |
| 563 | Ga0495634_0009948 | 3300046642 | Bacteria | 6989 |
| 564 | Ga0495588_0051627 | 3300046674 | Bacteria | 2118 |
| 565 | Ga0495657_0074663 | 3300046675 | Bacteria | 2206 |
| 566 | Ga0495599_0016727 | 3300046678 | Bacteria | 4555 |
| 567 | Ga0495599_0120644 | 3300046678 | Bacteria | 1630 |
| 568 | Ga0495647_0002083 | 3300046681 | Bacteria | 6257 |
| 569 | Ga0495658_0007232 | 3300046683 | Bacteria | 5486 |
| 570 | Ga0495658_0197666 | 3300046683 | Bacteria | 1252 |
| 571 | Ga0495669_0080760 | 3300046684 | Bacteria | 1492 |
| 572 | Ga0495613_0001053 | 3300046689 | Bacteria | 21060 |
| 573 | Ga0495581_0309169 | 3300047315 | Bacteria | 924 |
| 574 | Ga0495604_0000790 | 3300047317 | Bacteria | 26619 |
| 575 | Ga0495604_0357683 | 3300047317 | Bacteria | 969 |
| 576 | Ga0495674_0390948 | 3300047319 | Bacteria | 1124 |
| 577 | Ga0495676_0177652 | 3300047321 | Bacteria | 1494 |
| 578 | Ga0495680_0005704 | 3300047322 | Bacteria | 11655 |
| 579 | Ga0495680_0076220 | 3300047322 | Bacteria | 2543 |
| 580 | Ga0495680_0183593 | 3300047322 | Bacteria | 1508 |
| 581 | Ga0495677_0038047 | 3300047445 | Bacteria | 1758 |
| 582 | Ga0495684_0297168 | 3300047471 | Bacteria | 1161 |
| 583 | Ga0495602_0025774 | 3300048088 | Bacteria | 5685 |
| 584 | Ga0495602_0162955 | 3300048088 | Bacteria | 1739 |
| 585 | Ga0496101_0234287 | 3300048904 | Bacteria | 1428 |
| 586 | Ga0496102_0308054 | 3300048905 | Bacteria | 1492 |
| 587 | Ga0496103_0131709 | 3300048906 | Bacteria | 1597 |
| 588 | Ga0496104_0003573 | 3300048907 | Bacteria | 13420 |
| 589 | Ga0496104_0009110 | 3300048907 | Bacteria | 8827 |
| 590 | Ga0496104_0087772 | 3300048907 | Bacteria | 2971 |
| 591 | Ga0496104_0784792 | 3300048907 | Bacteria | 859 |
| 592 | Ga0496105_0045498 | 3300048908 | Bacteria | 3621 |
| 593 | Ga0496105_0051490 | 3300048908 | Bacteria | 3402 |
| 594 | Ga0496105_0364248 | 3300048908 | Bacteria | 1153 |
| 595 | Ga0496106_0020051 | 3300048909 | Bacteria | 4959 |
| 596 | Ga0496108_0229768 | 3300048911 | Bacteria | 1613 |
| 597 | Ga0496108_0521588 | 3300048911 | Bacteria | 1037 |
| 598 | Ga0496109_0059341 | 3300048912 | Bacteria | 3495 |
| 599 | Ga0496109_0113962 | 3300048912 | Bacteria | 2515 |
| 600 | Ga0496109_0151931 | 3300048912 | Bacteria | 2168 |
| 601 | Ga0496110_0121428 | 3300048913 | Bacteria | 2354 |
| 602 | Ga0496110_0124275 | 3300048913 | Bacteria | 2327 |
| 603 | Ga0496111_0116578 | 3300048914 | Bacteria | 1970 |
| 604 | Ga0496111_0180781 | 3300048914 | Bacteria | 1568 |
| 605 | Ga0496111_0490910 | 3300048914 | Bacteria | 904 |
| 606 | Ga0496111_0575958 | 3300048914 | Bacteria | 825 |
| 607 | Ga0496112_0005345 | 3300048915 | Bacteria | 11087 |
| 608 | Ga0496112_0222715 | 3300048915 | Bacteria | 1842 |
| 609 | Ga0496113_0159342 | 3300048916 | Bacteria | 1784 |
| 610 | Ga0496114_0170559 | 3300048917 | Bacteria | 1896 |
| 611 | Ga0496114_0194934 | 3300048917 | Bacteria | 1773 |
| 612 | Ga0496115_0173042 | 3300048918 | Bacteria | 1785 |
| 613 | Ga0496121_0002968 | 3300048924 | Bacteria | 24705 |
| 614 | Ga0496125_0026075 | 3300048928 | Bacteria | 5337 |
| 615 | Ga0501294_004268 | 3300049517 | Bacteria | 1346 |
| 616 | Ga0501299_026584 | 3300049522 | Bacteria | 1094 |
| 617 | Ga0501040_0297910 | 3300049576 | Bacteria | 1153 |
| 618 | Ga0501041_0289415 | 3300049577 | Bacteria | 1032 |
| 619 | Ga0501047_0024991 | 3300049581 | Bacteria | 5738 |
| 620 | Ga0501047_0236845 | 3300049581 | Bacteria | 1677 |
| 621 | Ga0501047_0271401 | 3300049581 | Bacteria | 1542 |
| 622 | Ga0501067_0041320 | 3300049583 | Bacteria | 2561 |
| 623 | Ga0501068_0211803 | 3300049584 | Bacteria | 1231 |
| 624 | Ga0501071_0000638 | 3300049587 | Bacteria | 18217 |
| 625 | Ga0501071_0324506 | 3300049587 | Bacteria | 1169 |
| 626 | Ga0501072_0363138 | 3300049588 | Bacteria | 1149 |
| 627 | Ga0501073_0337639 | 3300049589 | Bacteria | 1040 |
| 628 | Ga0501073_0410484 | 3300049589 | Bacteria | 936 |
| 629 | Ga0501074_0265147 | 3300049590 | Bacteria | 1221 |
| 630 | Ga0501075_0051262 | 3300049591 | Bacteria | 3103 |
| 631 | Ga0501077_0487755 | 3300049593 | Bacteria | 790 |
| 632 | Ga0501257_019873 | 3300049686 | Bacteria | 1573 |
| 633 | Ga0501079_0040802 | 3300049741 | Bacteria | 3582 |
| 634 | Ga0501080_0175196 | 3300049742 | Bacteria | 1976 |
| 635 | Ga0501080_0768348 | 3300049742 | Bacteria | 846 |
| 636 | Ga0501083_0020742 | 3300049744 | Bacteria | 4568 |
| 637 | Ga0501279_024390 | 3300049775 | Bacteria | 875 |
| 638 | Ga0501045_0326131 | 3300049824 | Bacteria | 1142 |
| 639 | nmdc:mga03683_116490_c1 | 3300050489 | Bacteria | 1185 |
| 640 | nmdc:mga03683_1540_c1 | 3300050489 | Bacteria | 6871 |
| 641 | nmdc:mga03n38_6527_c1 | 3300050490 | Bacteria | 4061 |
| 642 | nmdc:mga00v17_9302_c1 | 3300050491 | Bacteria | 5314 |
| 643 | nmdc:mga0yw44_1966_c1 | 3300050492 | Bacteria | 8521 |
| 644 | nmdc:mga0k408_33541_c1 | 3300050493 | Bacteria | 2937 |
| 645 | nmdc:mga04h51_29931_c1 | 3300050495 | Bacteria | 1710 |
| 646 | nmdc:mga07m45_33632_c1 | 3300050496 | Bacteria | 2848 |
| 647 | nmdc:mga05p37_215_c1 | 3300050507 | Bacteria | 57982 |
| 648 | nmdc:mga05p37_21838_c1 | 3300050507 | Bacteria | 7754 |
| 649 | nmdc:mga05p37_728014_c1 | 3300050507 | Bacteria | 1097 |
| 650 | nmdc:mga05p37_980_c1 | 3300050507 | Bacteria | 32442 |
| 651 | nmdc:mga09592_136871_c1 | 3300050508 | Bacteria | 2110 |
| 652 | nmdc:mga09592_230500_c1 | 3300050508 | Bacteria | 1605 |
| 653 | nmdc:mga09592_947_c1 | 3300050508 | Bacteria | 22820 |
| 654 | nmdc:mga0qj67_3084_c1 | 3300050509 | Bacteria | 11977 |
| 655 | nmdc:mga0qj67_705_c1 | 3300050509 | Bacteria | 22775 |
| 656 | nmdc:mga0qj67_8082_c1 | 3300050509 | Bacteria | 7787 |
| 657 | nmdc:mga0qj67_950382_c1 | 3300050509 | Bacteria | 676 |
| 658 | nmdc:mga06r32_133398_c1 | 3300050510 | Bacteria | 2457 |
| 659 | nmdc:mga06r32_2106_c1 | 3300050510 | Bacteria | 17820 |
| 660 | nmdc:mga06r32_277909_c1 | 3300050510 | Bacteria | 1662 |
| 661 | nmdc:mga06r32_637_c1 | 3300050510 | Bacteria | 30492 |
| 662 | nmdc:mga06r32_85802_c1 | 3300050510 | Bacteria | 3070 |
| 663 | nmdc:mga08y16_176_c1 | 3300050511 | Bacteria | 56313 |
| 664 | nmdc:mga08y16_186917_c1 | 3300050511 | Bacteria | 2150 |
| 665 | nmdc:mga08y16_36382_c1 | 3300050511 | Bacteria | 5170 |
| 666 | nmdc:mga08y16_71819_c1 | 3300050511 | Bacteria | 3607 |
| 667 | nmdc:mga0n895_51200_c1 | 3300050512 | Bacteria | 4051 |
| 668 | nmdc:mga0n895_881820_c1 | 3300050512 | Bacteria | 881 |
| 669 | nmdc:mga0n895_90796_c1 | 3300050512 | Bacteria | 3057 |
| 670 | nmdc:mga0rr50_265655_c1 | 3300050513 | Bacteria | 1429 |
| 671 | nmdc:mga0rr50_26750_c1 | 3300050513 | Bacteria | 4031 |
| 672 | nmdc:mga0rr50_38273_c1 | 3300050513 | Bacteria | 3469 |
| 673 | nmdc:mga0rr50_561902_c1 | 3300050513 | Bacteria | 972 |
| 674 | nmdc:mga08x19_13653_c1 | 3300050514 | Bacteria | 4914 |
| 675 | nmdc:mga08x19_15018_c1 | 3300050514 | Bacteria | 4703 |
| 676 | nmdc:mga08x19_2618_c1 | 3300050514 | Bacteria | 10913 |
| 677 | nmdc:mga08x19_30171_c1 | 3300050514 | Bacteria | 3405 |
| 678 | nmdc:mga08x19_343420_c1 | 3300050514 | Bacteria | 1041 |
| 679 | nmdc:mga08x19_4783_c1 | 3300050514 | Bacteria | 8027 |
| 680 | nmdc:mga0a205_253999_c1 | 3300050515 | Bacteria | 1637 |
| 681 | nmdc:mga0a205_27029_c1 | 3300050515 | Bacteria | 5478 |
| 682 | nmdc:mga0a205_302074_c1 | 3300050515 | Bacteria | 1473 |
| 683 | nmdc:mga0a205_307022_c1 | 3300050515 | Bacteria | 1459 |
| 684 | Ga0495601_0008645 | 3300053077 | Bacteria | 6010 |
| 685 | Ga0495601_0026917 | 3300053077 | Bacteria | 3554 |
| 686 | Ga0495612_0210761 | 3300053078 | Bacteria | 859 |
| 687 | Ga0495655_0018690 | 3300053083 | Bacteria | 1528 |
| 688 | Ga0495619_0021394 | 3300053085 | Bacteria | 4129 |
| 689 | Ga0495619_0232637 | 3300053085 | Bacteria | 1277 |
| 690 | Ga0500637_0308513 | 3300053178 | Bacteria | 860 |
| 691 | Ga0501084_0090115 | 3300054114 | Bacteria | 2574 |
| 692 | Ga0590077_011627 | 3300059426 | Bacteria | 1818 |
| 693 | Ga0501082_0202239 | 3300060353 | Bacteria | 1728 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025909 | Ga0207705_10493148 | Ga0207705_104931482 | 197 |
| 2 | 3300047317 | Ga0495604_0357683 | Ga0495604_0357683_180_824 | 214 |
| 3 | 3300031548 | Ga0307408_100604311 | Ga0307408_1006043112 | 215 |
| 4 | 3300035172 | Ga0373955_0120682 | Ga0373955_0120682_23_670 | 215 |
| 5 | 3300049824 | Ga0501045_0326131 | Ga0501045_0326131_22_669 | 215 |
| 6 | 3300050509 | nmdc:mga0qj67_950382_c1 | nmdc:mga0qj67_950382_c1_18_665 | 215 |
| 7 | 3300042439 | Ga0439464_0101343 | Ga0439464_0101343_198_854 | 218 |
| 8 | 3300007076 | Ga0075435_100265669 | Ga0075435_1002656692 | 219 |
| 9 | 3300045051 | Ga0451576_1014595 | Ga0451576_1014595_20_679 | 219 |
| 10 | 3300049587 | Ga0501071_0324506 | Ga0501071_0324506_19_678 | 219 |
| 11 | 3300049742 | Ga0501080_0768348 | Ga0501080_0768348_173_832 | 219 |
| 12 | 3300050507 | nmdc:mga05p37_728014_c1 | nmdc:mga05p37_728014_c1_224_883 | 219 |
| 13 | 3300050513 | nmdc:mga0rr50_561902_c1 | nmdc:mga0rr50_561902_c1_252_911 | 219 |
| 14 | 3300034819 | Ga0373958_0085622 | Ga0373958_0085622_23_685 | 220 |
| 15 | 3300025885 | Ga0207653_10060416 | Ga0207653_100604162 | 221 |
| 16 | 3300042876 | Ga0451577_0479843 | Ga0451577_0479843_223_930 | 222 |
| 17 | 3300027364 | Ga0209967_1000307 | Ga0209967_10003076 | 223 |
| 18 | 3300027378 | Ga0209981_1007810 | Ga0209981_10078102 | 223 |
| 19 | 3300027471 | Ga0209995_1002322 | Ga0209995_10023223 | 223 |
| 20 | 3300027526 | Ga0209968_1001103 | Ga0209968_10011032 | 223 |
| 21 | 3300027543 | Ga0209999_1000946 | Ga0209999_10009463 | 223 |
| 22 | 3300005440 | Ga0070705_100003022 | Ga0070705_1000030229 | 228 |
| 23 | 3300005440 | Ga0070705_100127233 | Ga0070705_1001272332 | 228 |
| 24 | 3300005518 | Ga0070699_100056960 | Ga0070699_1000569602 | 228 |
| 25 | 3300005536 | Ga0070697_100005701 | Ga0070697_10000570110 | 228 |
| 26 | 3300005546 | Ga0070696_100009913 | Ga0070696_1000099134 | 228 |
| 27 | 3300006871 | Ga0075434_100031833 | Ga0075434_1000318333 | 228 |
| 28 | 3300025922 | Ga0207646_10401941 | Ga0207646_104019412 | 228 |
| 29 | 3300035691 | Ga0373931_0037609 | Ga0373931_0037609_1767_2453 | 228 |
| 30 | 3300050512 | nmdc:mga0n895_51200_c1 | nmdc:mga0n895_51200_c1_1385_2071 | 228 |
| 31 | 3300050513 | nmdc:mga0rr50_265655_c1 | nmdc:mga0rr50_265655_c1_651_1337 | 228 |
| 32 | 3300050514 | nmdc:mga08x19_15018_c1 | nmdc:mga08x19_15018_c1_2334_3020 | 228 |
| 33 | 3300050515 | nmdc:mga0a205_27029_c1 | nmdc:mga0a205_27029_c1_1808_2494 | 228 |
| 34 | 3300044842 | Ga0466957_0189904 | Ga0466957_0189904_212_907 | 231 |
| 35 | 3300045836 | Ga0466958_0328617 | Ga0466958_0328617_209_904 | 231 |
| 36 | 3300045976 | Ga0466967_0079451 | Ga0466967_0079451_1344_2039 | 231 |
| 37 | 3300049775 | Ga0501279_024390 | Ga0501279_024390_19_714 | 231 |
| 38 | 3300006871 | Ga0075434_100171243 | Ga0075434_1001712433 | 234 |
| 39 | 3300007076 | Ga0075435_100037184 | Ga0075435_1000371843 | 234 |
| 40 | iso_pu_bacteria | 2643221628 | 2644159759 | 234 |
| 41 | iso_pu_bacteria | 2917699015 | 2917701096 | 234 |
| 42 | iso_pu_bacteria | 2919704043 | 2919707893 | 234 |
| 43 | 3300005355 | Ga0070671_100010559 | Ga0070671_1000105597 | 235 |
| 44 | 3300005458 | Ga0070681_10012298 | Ga0070681_1001229810 | 235 |
| 45 | 3300005518 | Ga0070699_100436424 | Ga0070699_1004364241 | 235 |
| 46 | 3300005530 | Ga0070679_100056283 | Ga0070679_1000562834 | 235 |
| 47 | 3300005536 | Ga0070697_100004865 | Ga0070697_1000048654 | 235 |
| 48 | 3300005549 | Ga0070704_100428010 | Ga0070704_1004280101 | 235 |
| 49 | 3300006852 | Ga0075433_10208504 | Ga0075433_102085042 | 235 |
| 50 | 3300006871 | Ga0075434_100000132 | Ga0075434_1000001327 | 235 |
| 51 | 3300006871 | Ga0075434_100138712 | Ga0075434_1001387122 | 235 |
| 52 | 3300006871 | Ga0075434_100973233 | Ga0075434_1009732331 | 235 |
| 53 | 3300007076 | Ga0075435_100001341 | Ga0075435_1000013414 | 235 |
| 54 | 3300007076 | Ga0075435_100006450 | Ga0075435_1000064506 | 235 |
| 55 | 3300014326 | Ga0157380_10252527 | Ga0157380_102525273 | 235 |
| 56 | 3300025903 | Ga0207680_10128354 | Ga0207680_101283541 | 235 |
| 57 | 3300025910 | Ga0207684_10098185 | Ga0207684_100981853 | 235 |
| 58 | 3300025912 | Ga0207707_10007969 | Ga0207707_1000796911 | 235 |
| 59 | 3300025912 | Ga0207707_10262326 | Ga0207707_102623262 | 235 |
| 60 | 3300025915 | Ga0207693_10099002 | Ga0207693_100990022 | 235 |
| 61 | 3300025917 | Ga0207660_10037119 | Ga0207660_100371193 | 235 |
| 62 | 3300025917 | Ga0207660_10463210 | Ga0207660_104632102 | 235 |
| 63 | 3300025939 | Ga0207665_10133396 | Ga0207665_101333962 | 235 |
| 64 | 3300027671 | Ga0209588_1070903 | Ga0209588_10709032 | 235 |
| 65 | 3300031824 | Ga0307413_10351451 | Ga0307413_103514512 | 235 |
| 66 | 3300032005 | Ga0307411_10058141 | Ga0307411_100581413 | 235 |
| 67 | 3300035083 | Ga0373926_0008656 | Ga0373926_0008656_2660_3367 | 235 |
| 68 | 3300035086 | Ga0373934_0014547 | Ga0373934_0014547_1795_2502 | 235 |
| 69 | 3300035089 | Ga0373944_0011437 | Ga0373944_0011437_1284_1991 | 235 |
| 70 | 3300035111 | Ga0373923_0030765 | Ga0373923_0030765_447_1154 | 235 |
| 71 | 3300035113 | Ga0373936_0052583 | Ga0373936_0052583_774_1481 | 235 |
| 72 | 3300035116 | Ga0373945_0025276 | Ga0373945_0025276_780_1487 | 235 |
| 73 | 3300035117 | Ga0373953_0028534 | Ga0373953_0028534_759_1466 | 235 |
| 74 | 3300035118 | Ga0373954_0000033 | Ga0373954_0000033_27878_28585 | 235 |
| 75 | 3300035121 | Ga0373960_0005406 | Ga0373960_0005406_619_1326 | 235 |
| 76 | 3300035171 | Ga0373946_0005978 | Ga0373946_0005978_2146_2853 | 235 |
| 77 | 3300035242 | Ga0373962_0034885 | Ga0373962_0034885_188_895 | 235 |
| 78 | 3300035410 | Ga0373924_0003359 | Ga0373924_0003359_2688_3395 | 235 |
| 79 | 3300035410 | Ga0373924_0196423 | Ga0373924_0196423_40_747 | 235 |
| 80 | 3300035695 | Ga0373927_0124659 | Ga0373927_0124659_194_901 | 235 |
| 81 | 3300035724 | Ga0373933_0002353 | Ga0373933_0002353_3782_4489 | 235 |
| 82 | 3300035724 | Ga0373933_0006414 | Ga0373933_0006414_1234_1941 | 235 |
| 83 | 3300035725 | Ga0373947_0005516 | Ga0373947_0005516_6273_6980 | 235 |
| 84 | 3300035725 | Ga0373947_0245236 | Ga0373947_0245236_187_894 | 235 |
| 85 | 3300036401 | Ga0373937_0000377 | Ga0373937_0000377_31239_31946 | 235 |
| 86 | 3300036401 | Ga0373937_0093825 | Ga0373937_0093825_891_1598 | 235 |
| 87 | 3300046454 | Ga0495592_0193777 | Ga0495592_0193777_38_745 | 235 |
| 88 | 3300046455 | Ga0495603_0083299 | Ga0495603_0083299_447_1154 | 235 |
| 89 | 3300046472 | Ga0495580_0090652 | Ga0495580_0090652_955_1662 | 235 |
| 90 | 3300046475 | Ga0495639_0009324 | Ga0495639_0009324_1741_2448 | 235 |
| 91 | 3300046535 | Ga0495586_0001380 | Ga0495586_0001380_95_802 | 235 |
| 92 | 3300046674 | Ga0495588_0051627 | Ga0495588_0051627_558_1265 | 235 |
| 93 | 3300046675 | Ga0495657_0074663 | Ga0495657_0074663_1105_1812 | 235 |
| 94 | 3300046678 | Ga0495599_0120644 | Ga0495599_0120644_378_1085 | 235 |
| 95 | 3300046681 | Ga0495647_0002083 | Ga0495647_0002083_2355_3062 | 235 |
| 96 | 3300046683 | Ga0495658_0197666 | Ga0495658_0197666_111_818 | 235 |
| 97 | 3300047321 | Ga0495676_0177652 | Ga0495676_0177652_35_742 | 235 |
| 98 | 3300047322 | Ga0495680_0076220 | Ga0495680_0076220_1607_2314 | 235 |
| 99 | 3300047471 | Ga0495684_0297168 | Ga0495684_0297168_46_753 | 235 |
| 100 | 3300048088 | Ga0495602_0162955 | Ga0495602_0162955_280_987 | 235 |
| 101 | 3300050512 | nmdc:mga0n895_881820_c1 | nmdc:mga0n895_881820_c1_124_831 | 235 |
| 102 | 3300050512 | nmdc:mga0n895_90796_c1 | nmdc:mga0n895_90796_c1_351_1058 | 235 |
| 103 | 3300050513 | nmdc:mga0rr50_26750_c1 | nmdc:mga0rr50_26750_c1_2249_2956 | 235 |
| 104 | 3300050515 | nmdc:mga0a205_253999_c1 | nmdc:mga0a205_253999_c1_612_1319 | 235 |
| 105 | 3300050515 | nmdc:mga0a205_307022_c1 | nmdc:mga0a205_307022_c1_394_1101 | 235 |
| 106 | 3300053078 | Ga0495612_0210761 | Ga0495612_0210761_37_744 | 235 |
| 107 | iso_pu_bacteria | 2513020051 | 2513229602 | 235 |
| 108 | iso_pu_bacteria | 2643221683 | 2644466704 | 235 |
| 109 | 3300005295 | Ga0065707_10012400 | Ga0065707_100124002 | 236 |
| 110 | 3300005295 | Ga0065707_10188918 | Ga0065707_101889182 | 236 |
| 111 | 3300005331 | Ga0070670_100205419 | Ga0070670_1002054193 | 236 |
| 112 | 3300005334 | Ga0068869_100019219 | Ga0068869_1000192195 | 236 |
| 113 | 3300005336 | Ga0070680_100019081 | Ga0070680_1000190815 | 236 |
| 114 | 3300005336 | Ga0070680_100055735 | Ga0070680_1000557353 | 236 |
| 115 | 3300005340 | Ga0070689_100066434 | Ga0070689_1000664343 | 236 |
| 116 | 3300005343 | Ga0070687_100079559 | Ga0070687_1000795592 | 236 |
| 117 | 3300005345 | Ga0070692_10019347 | Ga0070692_100193473 | 236 |
| 118 | 3300005345 | Ga0070692_10029742 | Ga0070692_100297423 | 236 |
| 119 | 3300005345 | Ga0070692_10235958 | Ga0070692_102359581 | 236 |
| 120 | 3300005347 | Ga0070668_100144256 | Ga0070668_1001442562 | 236 |
| 121 | 3300005353 | Ga0070669_100091953 | Ga0070669_1000919532 | 236 |
| 122 | 3300005354 | Ga0070675_100313930 | Ga0070675_1003139302 | 236 |
| 123 | 3300005440 | Ga0070705_100237547 | Ga0070705_1002375472 | 236 |
| 124 | 3300005441 | Ga0070700_100003507 | Ga0070700_1000035079 | 236 |
| 125 | 3300005441 | Ga0070700_100387100 | Ga0070700_1003871002 | 236 |
| 126 | 3300005444 | Ga0070694_100005593 | Ga0070694_1000055934 | 236 |
| 127 | 3300005444 | Ga0070694_100092879 | Ga0070694_1000928792 | 236 |
| 128 | 3300005444 | Ga0070694_100126096 | Ga0070694_1001260962 | 236 |
| 129 | 3300005444 | Ga0070694_100193556 | Ga0070694_1001935562 | 236 |
| 130 | 3300005459 | Ga0068867_100001086 | Ga0068867_1000010864 | 236 |
| 131 | 3300005471 | Ga0070698_100014017 | Ga0070698_1000140173 | 236 |
| 132 | 3300005539 | Ga0068853_100885611 | Ga0068853_1008856112 | 236 |
| 133 | 3300005544 | Ga0070686_100012900 | Ga0070686_1000129001 | 236 |
| 134 | 3300005545 | Ga0070695_100087420 | Ga0070695_1000874203 | 236 |
| 135 | 3300005546 | Ga0070696_100028084 | Ga0070696_1000280843 | 236 |
| 136 | 3300005546 | Ga0070696_100055717 | Ga0070696_1000557173 | 236 |
| 137 | 3300005546 | Ga0070696_100069516 | Ga0070696_1000695162 | 236 |
| 138 | 3300005546 | Ga0070696_100520855 | Ga0070696_1005208552 | 236 |
| 139 | 3300005549 | Ga0070704_100002583 | Ga0070704_1000025839 | 236 |
| 140 | 3300005549 | Ga0070704_100009156 | Ga0070704_1000091561 | 236 |
| 141 | 3300005549 | Ga0070704_100109550 | Ga0070704_1001095502 | 236 |
| 142 | 3300005577 | Ga0068857_100229490 | Ga0068857_1002294902 | 236 |
| 143 | 3300005615 | Ga0070702_100025696 | Ga0070702_1000256961 | 236 |
| 144 | 3300005615 | Ga0070702_100166575 | Ga0070702_1001665752 | 236 |
| 145 | 3300005617 | Ga0068859_100007812 | Ga0068859_1000078123 | 236 |
| 146 | 3300005617 | Ga0068859_100636880 | Ga0068859_1006368802 | 236 |
| 147 | 3300005618 | Ga0068864_100333926 | Ga0068864_1003339262 | 236 |
| 148 | 3300005719 | Ga0068861_100027677 | Ga0068861_1000276773 | 236 |
| 149 | 3300005840 | Ga0068870_10068810 | Ga0068870_100688102 | 236 |
| 150 | 3300005841 | Ga0068863_100762482 | Ga0068863_1007624822 | 236 |
| 151 | 3300005844 | Ga0068862_100223531 | Ga0068862_1002235312 | 236 |
| 152 | 3300005844 | Ga0068862_100654684 | Ga0068862_1006546842 | 236 |
| 153 | 3300006844 | Ga0075428_100061243 | Ga0075428_1000612433 | 236 |
| 154 | 3300006844 | Ga0075428_100426217 | Ga0075428_1004262172 | 236 |
| 155 | 3300006846 | Ga0075430_100000520 | Ga0075430_10000052031 | 236 |
| 156 | 3300006846 | Ga0075430_100100659 | Ga0075430_1001006593 | 236 |
| 157 | 3300006847 | Ga0075431_100009047 | Ga0075431_1000090472 | 236 |
| 158 | 3300006847 | Ga0075431_100021141 | Ga0075431_1000211414 | 236 |
| 159 | 3300006852 | Ga0075433_10153428 | Ga0075433_101534282 | 236 |
| 160 | 3300006852 | Ga0075433_10386854 | Ga0075433_103868542 | 236 |
| 161 | 3300006880 | Ga0075429_100000638 | Ga0075429_10000063819 | 236 |
| 162 | 3300006880 | Ga0075429_100135451 | Ga0075429_1001354513 | 236 |
| 163 | 3300006880 | Ga0075429_100141972 | Ga0075429_1001419723 | 236 |
| 164 | 3300006880 | Ga0075429_100646000 | Ga0075429_1006460002 | 236 |
| 165 | 3300006881 | Ga0068865_100023360 | Ga0068865_1000233605 | 236 |
| 166 | 3300006914 | Ga0075436_100015380 | Ga0075436_1000153803 | 236 |
| 167 | 3300006914 | Ga0075436_100061090 | Ga0075436_1000610902 | 236 |
| 168 | 3300006931 | Ga0097620_100007812 | Ga0097620_1000078123 | 236 |
| 169 | 3300006931 | Ga0097620_100636870 | Ga0097620_1006368702 | 236 |
| 170 | 3300007076 | Ga0075435_100416511 | Ga0075435_1004165112 | 236 |
| 171 | 3300007265 | Ga0099794_10047137 | Ga0099794_100471372 | 236 |
| 172 | 3300009094 | Ga0111539_10085259 | Ga0111539_100852592 | 236 |
| 173 | 3300009094 | Ga0111539_11037895 | Ga0111539_110378952 | 236 |
| 174 | 3300009098 | Ga0105245_10051495 | Ga0105245_100514952 | 236 |
| 175 | 3300009147 | Ga0114129_10007443 | Ga0114129_100074439 | 236 |
| 176 | 3300009147 | Ga0114129_10015516 | Ga0114129_100155164 | 236 |
| 177 | 3300009147 | Ga0114129_10331229 | Ga0114129_103312292 | 236 |
| 178 | 3300009148 | Ga0105243_10915615 | Ga0105243_109156152 | 236 |
| 179 | 3300009176 | Ga0105242_10002945 | Ga0105242_1000294515 | 236 |
| 180 | 3300009553 | Ga0105249_10102811 | Ga0105249_101028112 | 236 |
| 181 | 3300010159 | Ga0099796_10064994 | Ga0099796_100649941 | 236 |
| 182 | 3300014326 | Ga0157380_10092441 | Ga0157380_100924412 | 236 |
| 183 | 3300014745 | Ga0157377_10051344 | Ga0157377_100513442 | 236 |
| 184 | 3300025917 | Ga0207660_10064740 | Ga0207660_100647402 | 236 |
| 185 | 3300025918 | Ga0207662_10073492 | Ga0207662_100734922 | 236 |
| 186 | 3300025918 | Ga0207662_10111522 | Ga0207662_101115222 | 236 |
| 187 | 3300025923 | Ga0207681_10070992 | Ga0207681_100709922 | 236 |
| 188 | 3300025926 | Ga0207659_10018757 | Ga0207659_100187573 | 236 |
| 189 | 3300025927 | Ga0207687_10086483 | Ga0207687_100864833 | 236 |
| 190 | 3300025934 | Ga0207686_10013074 | Ga0207686_100130742 | 236 |
| 191 | 3300025935 | Ga0207709_10094648 | Ga0207709_100946483 | 236 |
| 192 | 3300025935 | Ga0207709_10536812 | Ga0207709_105368121 | 236 |
| 193 | 3300025936 | Ga0207670_10535351 | Ga0207670_105353512 | 236 |
| 194 | 3300025938 | Ga0207704_10000959 | Ga0207704_1000095912 | 236 |
| 195 | 3300025939 | Ga0207665_10002514 | Ga0207665_100025149 | 236 |
| 196 | 3300025940 | Ga0207691_10187331 | Ga0207691_101873312 | 236 |
| 197 | 3300025942 | Ga0207689_10066161 | Ga0207689_100661612 | 236 |
| 198 | 3300025942 | Ga0207689_10305431 | Ga0207689_103054312 | 236 |
| 199 | 3300025961 | Ga0207712_10014058 | Ga0207712_100140584 | 236 |
| 200 | 3300025972 | Ga0207668_10178096 | Ga0207668_101780962 | 236 |
| 201 | 3300025981 | Ga0207640_10421571 | Ga0207640_104215712 | 236 |
| 202 | 3300026088 | Ga0207641_10269131 | Ga0207641_102691312 | 236 |
| 203 | 3300026089 | Ga0207648_10004422 | Ga0207648_100044224 | 236 |
| 204 | 3300026095 | Ga0207676_10280300 | Ga0207676_102803002 | 236 |
| 205 | 3300026116 | Ga0207674_10071800 | Ga0207674_100718002 | 236 |
| 206 | 3300026118 | Ga0207675_100003929 | Ga0207675_1000039294 | 236 |
| 207 | 3300027360 | Ga0209969_1000217 | Ga0209969_10002172 | 236 |
| 208 | 3300027471 | Ga0209995_1017851 | Ga0209995_10178512 | 236 |
| 209 | 3300027543 | Ga0209999_1021022 | Ga0209999_10210222 | 236 |
| 210 | 3300027682 | Ga0209971_1016951 | Ga0209971_10169512 | 236 |
| 211 | 3300027695 | Ga0209966_1040200 | Ga0209966_10402002 | 236 |
| 212 | 3300027695 | Ga0209966_1041344 | Ga0209966_10413442 | 236 |
| 213 | 3300027907 | Ga0207428_10036411 | Ga0207428_100364115 | 236 |
| 214 | 3300027907 | Ga0207428_10062275 | Ga0207428_100622751 | 236 |
| 215 | 3300027907 | Ga0207428_10064629 | Ga0207428_100646292 | 236 |
| 216 | 3300028380 | Ga0268265_10003470 | Ga0268265_1000347012 | 236 |
| 217 | 3300031548 | Ga0307408_100158207 | Ga0307408_1001582072 | 236 |
| 218 | 3300031665 | Ga0316575_10004257 | Ga0316575_100042573 | 236 |
| 219 | 3300031665 | Ga0316575_10012111 | Ga0316575_100121113 | 236 |
| 220 | 3300031691 | Ga0316579_10005426 | Ga0316579_100054262 | 236 |
| 221 | 3300031728 | Ga0316578_10005156 | Ga0316578_100051565 | 236 |
| 222 | 3300032133 | Ga0316583_10039443 | Ga0316583_100394432 | 236 |
| 223 | 3300035088 | Ga0373940_0042687 | Ga0373940_0042687_198_908 | 236 |
| 224 | 3300035117 | Ga0373953_0058600 | Ga0373953_0058600_612_1322 | 236 |
| 225 | 3300035170 | Ga0373943_0157809 | Ga0373943_0157809_143_853 | 236 |
| 226 | 3300035172 | Ga0373955_0137289 | Ga0373955_0137289_621_1331 | 236 |
| 227 | 3300035172 | Ga0373955_0152859 | Ga0373955_0152859_159_869 | 236 |
| 228 | 3300035398 | Ga0316574_0006010 | Ga0316574_0006010_5584_6294 | 236 |
| 229 | 3300035692 | Ga0373935_0016858 | Ga0373935_0016858_1837_2547 | 236 |
| 230 | 3300036401 | Ga0373937_0028570 | Ga0373937_0028570_4034_4744 | 236 |
| 231 | 3300036401 | Ga0373937_0051673 | Ga0373937_0051673_180_890 | 236 |
| 232 | 3300036401 | Ga0373937_0481177 | Ga0373937_0481177_295_1005 | 236 |
| 233 | 3300036647 | Ga0316582_0007634 | Ga0316582_0007634_4936_5646 | 236 |
| 234 | 3300037068 | Ga0373925_0150090 | Ga0373925_0150090_97_807 | 236 |
| 235 | 3300037588 | Ga0316581_0010467 | Ga0316581_0010467_1800_2510 | 236 |
| 236 | 3300041408 | Ga0439453_0003181 | Ga0439453_0003181_759_1469 | 236 |
| 237 | 3300042001 | Ga0439441_021612 | Ga0439441_021612_349_1059 | 236 |
| 238 | 3300042436 | Ga0439435_0023098 | Ga0439435_0023098_578_1288 | 236 |
| 239 | 3300042437 | Ga0439444_0003193 | Ga0439444_0003193_685_1395 | 236 |
| 240 | 3300045051 | Ga0451576_0006891 | Ga0451576_0006891_2510_3220 | 236 |
| 241 | 3300045051 | Ga0451576_0455958 | Ga0451576_0455958_259_969 | 236 |
| 242 | 3300045051 | Ga0451576_0830180 | Ga0451576_0830180_185_895 | 236 |
| 243 | 3300046454 | Ga0495592_0001640 | Ga0495592_0001640_8121_8831 | 236 |
| 244 | 3300046476 | Ga0495662_0006212 | Ga0495662_0006212_1839_2549 | 236 |
| 245 | 3300046511 | Ga0495608_0001201 | Ga0495608_0001201_2371_3081 | 236 |
| 246 | 3300046514 | Ga0495618_0186598 | Ga0495618_0186598_471_1181 | 236 |
| 247 | 3300046516 | Ga0495628_0016307 | Ga0495628_0016307_1386_2096 | 236 |
| 248 | 3300046517 | Ga0495630_0006364 | Ga0495630_0006364_4415_5125 | 236 |
| 249 | 3300046517 | Ga0495630_0009974 | Ga0495630_0009974_2916_3626 | 236 |
| 250 | 3300046525 | Ga0495663_0034868 | Ga0495663_0034868_163_873 | 236 |
| 251 | 3300046526 | Ga0495666_0008813 | Ga0495666_0008813_2325_3035 | 236 |
| 252 | 3300046529 | Ga0495652_0114824 | Ga0495652_0114824_361_1071 | 236 |
| 253 | 3300046533 | Ga0495640_0074165 | Ga0495640_0074165_892_1602 | 236 |
| 254 | 3300046535 | Ga0495586_0001023 | Ga0495586_0001023_5413_6123 | 236 |
| 255 | 3300046536 | Ga0495587_0078496 | Ga0495587_0078496_504_1214 | 236 |
| 256 | 3300046537 | Ga0495598_0024753 | Ga0495598_0024753_174_884 | 236 |
| 257 | 3300046539 | Ga0495621_0035209 | Ga0495621_0035209_213_923 | 236 |
| 258 | 3300046559 | Ga0495667_0001209 | Ga0495667_0001209_3896_4606 | 236 |
| 259 | 3300046642 | Ga0495634_0009948 | Ga0495634_0009948_3395_4105 | 236 |
| 260 | 3300046678 | Ga0495599_0016727 | Ga0495599_0016727_753_1463 | 236 |
| 261 | 3300046683 | Ga0495658_0007232 | Ga0495658_0007232_1666_2376 | 236 |
| 262 | 3300046684 | Ga0495669_0080760 | Ga0495669_0080760_618_1328 | 236 |
| 263 | 3300046689 | Ga0495613_0001053 | Ga0495613_0001053_18490_19200 | 236 |
| 264 | 3300047317 | Ga0495604_0000790 | Ga0495604_0000790_16080_16790 | 236 |
| 265 | 3300047322 | Ga0495680_0005704 | Ga0495680_0005704_6843_7553 | 236 |
| 266 | 3300047322 | Ga0495680_0183593 | Ga0495680_0183593_183_893 | 236 |
| 267 | 3300047445 | Ga0495677_0038047 | Ga0495677_0038047_910_1620 | 236 |
| 268 | 3300049522 | Ga0501299_026584 | Ga0501299_026584_183_893 | 236 |
| 269 | 3300049577 | Ga0501041_0289415 | Ga0501041_0289415_194_904 | 236 |
| 270 | 3300049583 | Ga0501067_0041320 | Ga0501067_0041320_293_1003 | 236 |
| 271 | 3300049584 | Ga0501068_0211803 | Ga0501068_0211803_365_1075 | 236 |
| 272 | 3300049588 | Ga0501072_0363138 | Ga0501072_0363138_54_764 | 236 |
| 273 | 3300049589 | Ga0501073_0410484 | Ga0501073_0410484_181_891 | 236 |
| 274 | 3300049590 | Ga0501074_0265147 | Ga0501074_0265147_156_866 | 236 |
| 275 | 3300049593 | Ga0501077_0487755 | Ga0501077_0487755_55_765 | 236 |
| 276 | 3300050507 | nmdc:mga05p37_21838_c1 | nmdc:mga05p37_21838_c1_3913_4623 | 236 |
| 277 | 3300050507 | nmdc:mga05p37_980_c1 | nmdc:mga05p37_980_c1_22900_23610 | 236 |
| 278 | 3300050508 | nmdc:mga09592_136871_c1 | nmdc:mga09592_136871_c1_1272_1982 | 236 |
| 279 | 3300050508 | nmdc:mga09592_230500_c1 | nmdc:mga09592_230500_c1_446_1156 | 236 |
| 280 | 3300050508 | nmdc:mga09592_947_c1 | nmdc:mga09592_947_c1_7562_8272 | 236 |
| 281 | 3300050509 | nmdc:mga0qj67_705_c1 | nmdc:mga0qj67_705_c1_20827_21537 | 236 |
| 282 | 3300050510 | nmdc:mga06r32_133398_c1 | nmdc:mga06r32_133398_c1_393_1103 | 236 |
| 283 | 3300050510 | nmdc:mga06r32_2106_c1 | nmdc:mga06r32_2106_c1_9202_9912 | 236 |
| 284 | 3300050510 | nmdc:mga06r32_277909_c1 | nmdc:mga06r32_277909_c1_516_1226 | 236 |
| 285 | 3300050510 | nmdc:mga06r32_85802_c1 | nmdc:mga06r32_85802_c1_1275_1985 | 236 |
| 286 | 3300050511 | nmdc:mga08y16_186917_c1 | nmdc:mga08y16_186917_c1_256_966 | 236 |
| 287 | 3300050511 | nmdc:mga08y16_71819_c1 | nmdc:mga08y16_71819_c1_137_847 | 236 |
| 288 | 3300050514 | nmdc:mga08x19_13653_c1 | nmdc:mga08x19_13653_c1_2566_3276 | 236 |
| 289 | 3300050515 | nmdc:mga0a205_302074_c1 | nmdc:mga0a205_302074_c1_636_1346 | 236 |
| 290 | 3300053077 | Ga0495601_0008645 | Ga0495601_0008645_1835_2545 | 236 |
| 291 | 3300053085 | Ga0495619_0021394 | Ga0495619_0021394_648_1358 | 236 |
| 292 | 3300059426 | Ga0590077_011627 | Ga0590077_011627_752_1462 | 236 |
| 293 | 3300005330 | Ga0070690_100403703 | Ga0070690_1004037032 | 237 |
| 294 | 3300005336 | Ga0070680_100225876 | Ga0070680_1002258761 | 237 |
| 295 | 3300005338 | Ga0068868_100746633 | Ga0068868_1007466332 | 237 |
| 296 | 3300005435 | Ga0070714_100083363 | Ga0070714_1000833632 | 237 |
| 297 | 3300005459 | Ga0068867_100133791 | Ga0068867_1001337912 | 237 |
| 298 | 3300005471 | Ga0070698_100126373 | Ga0070698_1001263733 | 237 |
| 299 | 3300005539 | Ga0068853_100837283 | Ga0068853_1008372831 | 237 |
| 300 | 3300005544 | Ga0070686_100403804 | Ga0070686_1004038041 | 237 |
| 301 | 3300005547 | Ga0070693_100304747 | Ga0070693_1003047471 | 237 |
| 302 | 3300005616 | Ga0068852_100212763 | Ga0068852_1002127631 | 237 |
| 303 | 3300005842 | Ga0068858_100169363 | Ga0068858_1001693632 | 237 |
| 304 | 3300005842 | Ga0068858_100397499 | Ga0068858_1003974992 | 237 |
| 305 | 3300005843 | Ga0068860_100924395 | Ga0068860_1009243952 | 237 |
| 306 | 3300005985 | Ga0081539_10001857 | Ga0081539_1000185719 | 237 |
| 307 | 3300006028 | Ga0070717_10094835 | Ga0070717_100948352 | 237 |
| 308 | 3300006038 | Ga0075365_10017503 | Ga0075365_100175033 | 237 |
| 309 | 3300006048 | Ga0075363_100019885 | Ga0075363_1000198853 | 237 |
| 310 | 3300006237 | Ga0097621_100657924 | Ga0097621_1006579242 | 237 |
| 311 | 3300006844 | Ga0075428_100000390 | Ga0075428_10000039038 | 237 |
| 312 | 3300006846 | Ga0075430_100011416 | Ga0075430_1000114168 | 237 |
| 313 | 3300006846 | Ga0075430_100018097 | Ga0075430_1000180974 | 237 |
| 314 | 3300006847 | Ga0075431_100000003 | Ga0075431_10000000363 | 237 |
| 315 | 3300006847 | Ga0075431_100343858 | Ga0075431_1003438582 | 237 |
| 316 | 3300006880 | Ga0075429_100001974 | Ga0075429_1000019744 | 237 |
| 317 | 3300006881 | Ga0068865_100256893 | Ga0068865_1002568932 | 237 |
| 318 | 3300006914 | Ga0075436_100000638 | Ga0075436_1000006389 | 237 |
| 319 | 3300009094 | Ga0111539_10006444 | Ga0111539_100064444 | 237 |
| 320 | 3300009094 | Ga0111539_10006454 | Ga0111539_100064543 | 237 |
| 321 | 3300009098 | Ga0105245_10047244 | Ga0105245_100472443 | 237 |
| 322 | 3300009098 | Ga0105245_10082487 | Ga0105245_100824874 | 237 |
| 323 | 3300009147 | Ga0114129_10000104 | Ga0114129_1000010457 | 237 |
| 324 | 3300009176 | Ga0105242_10316876 | Ga0105242_103168762 | 237 |
| 325 | 3300010375 | Ga0105239_10280495 | Ga0105239_102804952 | 237 |
| 326 | 3300011119 | Ga0105246_10043687 | Ga0105246_100436873 | 237 |
| 327 | 3300013306 | Ga0163162_10667626 | Ga0163162_106676261 | 237 |
| 328 | 3300014968 | Ga0157379_10075107 | Ga0157379_100751073 | 237 |
| 329 | 3300021384 | Ga0213876_10240135 | Ga0213876_102401352 | 237 |
| 330 | 3300025899 | Ga0207642_10302671 | Ga0207642_103026711 | 237 |
| 331 | 3300025934 | Ga0207686_10073565 | Ga0207686_100735652 | 237 |
| 332 | 3300025936 | Ga0207670_10239309 | Ga0207670_102393092 | 237 |
| 333 | 3300025936 | Ga0207670_10348202 | Ga0207670_103482022 | 237 |
| 334 | 3300026035 | Ga0207703_10136337 | Ga0207703_101363372 | 237 |
| 335 | 3300026067 | Ga0207678_10115574 | Ga0207678_101155743 | 237 |
| 336 | 3300026089 | Ga0207648_10079880 | Ga0207648_100798802 | 237 |
| 337 | 3300026089 | Ga0207648_10148602 | Ga0207648_101486022 | 237 |
| 338 | 3300026121 | Ga0207683_10175359 | Ga0207683_101753593 | 237 |
| 339 | 3300027695 | Ga0209966_1004350 | Ga0209966_10043502 | 237 |
| 340 | 3300027907 | Ga0207428_10006513 | Ga0207428_100065134 | 237 |
| 341 | 3300028379 | Ga0268266_10132081 | Ga0268266_101320812 | 237 |
| 342 | 3300028800 | Ga0265338_10342619 | Ga0265338_103426192 | 237 |
| 343 | 3300035111 | Ga0373923_0099352 | Ga0373923_0099352_384_1097 | 237 |
| 344 | 3300035119 | Ga0373956_0037187 | Ga0373956_0037187_1142_1855 | 237 |
| 345 | 3300035692 | Ga0373935_0323187 | Ga0373935_0323187_313_1026 | 237 |
| 346 | 3300035724 | Ga0373933_0080313 | Ga0373933_0080313_785_1498 | 237 |
| 347 | 3300036401 | Ga0373937_0055460 | Ga0373937_0055460_209_922 | 237 |
| 348 | 3300036401 | Ga0373937_0805311 | Ga0373937_0805311_114_827 | 237 |
| 349 | 3300038443 | Ga0395901_0028082 | Ga0395901_0028082_4334_5047 | 237 |
| 350 | 3300039437 | Ga0436365_0852937 | Ga0436365_0852937_37_753 | 237 |
| 351 | 3300042461 | Ga0439460_0019517 | Ga0439460_0019517_548_1264 | 237 |
| 352 | 3300044712 | Ga0453684_0140881 | Ga0453684_0140881_1981_2694 | 237 |
| 353 | 3300045051 | Ga0451576_0031204 | Ga0451576_0031204_2279_2992 | 237 |
| 354 | 3300046523 | Ga0495644_0111715 | Ga0495644_0111715_261_974 | 237 |
| 355 | 3300046537 | Ga0495598_0019864 | Ga0495598_0019864_817_1530 | 237 |
| 356 | 3300046537 | Ga0495598_0124827 | Ga0495598_0124827_151_864 | 237 |
| 357 | 3300046539 | Ga0495621_0004599 | Ga0495621_0004599_2492_3205 | 237 |
| 358 | 3300046539 | Ga0495621_0032660 | Ga0495621_0032660_502_1215 | 237 |
| 359 | 3300046615 | Ga0495656_0033821 | Ga0495656_0033821_1316_2029 | 237 |
| 360 | 3300047319 | Ga0495674_0390948 | Ga0495674_0390948_394_1107 | 237 |
| 361 | 3300048088 | Ga0495602_0025774 | Ga0495602_0025774_2759_3472 | 237 |
| 362 | 3300048905 | Ga0496102_0308054 | Ga0496102_0308054_188_901 | 237 |
| 363 | 3300048906 | Ga0496103_0131709 | Ga0496103_0131709_738_1451 | 237 |
| 364 | 3300048907 | Ga0496104_0003573 | Ga0496104_0003573_27_740 | 237 |
| 365 | 3300048912 | Ga0496109_0151931 | Ga0496109_0151931_809_1522 | 237 |
| 366 | 3300048913 | Ga0496110_0124275 | Ga0496110_0124275_1202_1915 | 237 |
| 367 | 3300048914 | Ga0496111_0490910 | Ga0496111_0490910_165_878 | 237 |
| 368 | 3300048915 | Ga0496112_0222715 | Ga0496112_0222715_429_1142 | 237 |
| 369 | 3300048916 | Ga0496113_0159342 | Ga0496113_0159342_739_1452 | 237 |
| 370 | 3300048917 | Ga0496114_0170559 | Ga0496114_0170559_828_1541 | 237 |
| 371 | 3300048918 | Ga0496115_0173042 | Ga0496115_0173042_705_1418 | 237 |
| 372 | 3300049576 | Ga0501040_0297910 | Ga0501040_0297910_80_793 | 237 |
| 373 | 3300049581 | Ga0501047_0024991 | Ga0501047_0024991_1691_2404 | 237 |
| 374 | 3300049581 | Ga0501047_0236845 | Ga0501047_0236845_260_973 | 237 |
| 375 | 3300049581 | Ga0501047_0271401 | Ga0501047_0271401_659_1372 | 237 |
| 376 | 3300049587 | Ga0501071_0000638 | Ga0501071_0000638_1487_2200 | 237 |
| 377 | 3300049589 | Ga0501073_0337639 | Ga0501073_0337639_296_1009 | 237 |
| 378 | 3300049591 | Ga0501075_0051262 | Ga0501075_0051262_107_820 | 237 |
| 379 | 3300049741 | Ga0501079_0040802 | Ga0501079_0040802_2758_3471 | 237 |
| 380 | 3300049742 | Ga0501080_0175196 | Ga0501080_0175196_379_1092 | 237 |
| 381 | 3300049744 | Ga0501083_0020742 | Ga0501083_0020742_946_1659 | 237 |
| 382 | 3300050489 | nmdc:mga03683_116490_c1 | nmdc:mga03683_116490_c1_355_1068 | 237 |
| 383 | 3300050495 | nmdc:mga04h51_29931_c1 | nmdc:mga04h51_29931_c1_211_924 | 237 |
| 384 | 3300050507 | nmdc:mga05p37_215_c1 | nmdc:mga05p37_215_c1_43201_43917 | 237 |
| 385 | 3300050509 | nmdc:mga0qj67_3084_c1 | nmdc:mga0qj67_3084_c1_8657_9370 | 237 |
| 386 | 3300050509 | nmdc:mga0qj67_8082_c1 | nmdc:mga0qj67_8082_c1_3082_3798 | 237 |
| 387 | 3300050510 | nmdc:mga06r32_637_c1 | nmdc:mga06r32_637_c1_12847_13563 | 237 |
| 388 | 3300050511 | nmdc:mga08y16_176_c1 | nmdc:mga08y16_176_c1_44557_45273 | 237 |
| 389 | 3300050511 | nmdc:mga08y16_36382_c1 | nmdc:mga08y16_36382_c1_1754_2467 | 237 |
| 390 | 3300050514 | nmdc:mga08x19_2618_c1 | nmdc:mga08x19_2618_c1_4537_5250 | 237 |
| 391 | 3300050514 | nmdc:mga08x19_343420_c1 | nmdc:mga08x19_343420_c1_48_761 | 237 |
| 392 | 3300050514 | nmdc:mga08x19_4783_c1 | nmdc:mga08x19_4783_c1_4671_5384 | 237 |
| 393 | 3300053077 | Ga0495601_0026917 | Ga0495601_0026917_1714_2427 | 237 |
| 394 | 3300053083 | Ga0495655_0018690 | Ga0495655_0018690_201_914 | 237 |
| 395 | 3300053085 | Ga0495619_0232637 | Ga0495619_0232637_130_843 | 237 |
| 396 | 3300054114 | Ga0501084_0090115 | Ga0501084_0090115_1740_2453 | 237 |
| 397 | 3300060353 | Ga0501082_0202239 | Ga0501082_0202239_582_1295 | 237 |
| 398 | 3300003784 | Ga0055534_1000008 | Ga0055534_100000839 | 238 |
| 399 | 3300003790 | Ga0055528_1000831 | Ga0055528_100083132 | 238 |
| 400 | 3300003794 | Ga0055531_10001403 | Ga0055531_1000140314 | 238 |
| 401 | 3300005327 | Ga0070658_10055099 | Ga0070658_100550991 | 238 |
| 402 | 3300005328 | Ga0070676_10008106 | Ga0070676_100081063 | 238 |
| 403 | 3300005330 | Ga0070690_100005969 | Ga0070690_1000059695 | 238 |
| 404 | 3300005330 | Ga0070690_100060132 | Ga0070690_1000601323 | 238 |
| 405 | 3300005333 | Ga0070677_10002411 | Ga0070677_100024113 | 238 |
| 406 | 3300005334 | Ga0068869_100004332 | Ga0068869_1000043325 | 238 |
| 407 | 3300005334 | Ga0068869_100030088 | Ga0068869_1000300884 | 238 |
| 408 | 3300005334 | Ga0068869_100081702 | Ga0068869_1000817022 | 238 |
| 409 | 3300005335 | Ga0070666_10001889 | Ga0070666_100018899 | 238 |
| 410 | 3300005338 | Ga0068868_100038678 | Ga0068868_1000386782 | 238 |
| 411 | 3300005340 | Ga0070689_100011408 | Ga0070689_1000114085 | 238 |
| 412 | 3300005343 | Ga0070687_100011217 | Ga0070687_1000112173 | 238 |
| 413 | 3300005343 | Ga0070687_100116518 | Ga0070687_1001165182 | 238 |
| 414 | 3300005345 | Ga0070692_10168692 | Ga0070692_101686922 | 238 |
| 415 | 3300005347 | Ga0070668_100047700 | Ga0070668_1000477002 | 238 |
| 416 | 3300005347 | Ga0070668_100127885 | Ga0070668_1001278853 | 238 |
| 417 | 3300005353 | Ga0070669_100040122 | Ga0070669_1000401223 | 238 |
| 418 | 3300005354 | Ga0070675_100002630 | Ga0070675_1000026309 | 238 |
| 419 | 3300005354 | Ga0070675_100042071 | Ga0070675_1000420712 | 238 |
| 420 | 3300005355 | Ga0070671_100016816 | Ga0070671_1000168166 | 238 |
| 421 | 3300005355 | Ga0070671_100044385 | Ga0070671_1000443853 | 238 |
| 422 | 3300005356 | Ga0070674_100200041 | Ga0070674_1002000412 | 238 |
| 423 | 3300005364 | Ga0070673_100042648 | Ga0070673_1000426483 | 238 |
| 424 | 3300005364 | Ga0070673_100217654 | Ga0070673_1002176542 | 238 |
| 425 | 3300005365 | Ga0070688_100072006 | Ga0070688_1000720062 | 238 |
| 426 | 3300005367 | Ga0070667_100011577 | Ga0070667_1000115771 | 238 |
| 427 | 3300005367 | Ga0070667_100014472 | Ga0070667_1000144724 | 238 |
| 428 | 3300005435 | Ga0070714_100059530 | Ga0070714_1000595303 | 238 |
| 429 | 3300005456 | Ga0070678_100036514 | Ga0070678_1000365144 | 238 |
| 430 | 3300005456 | Ga0070678_100073025 | Ga0070678_1000730252 | 238 |
| 431 | 3300005457 | Ga0070662_100020143 | Ga0070662_1000201433 | 238 |
| 432 | 3300005457 | Ga0070662_100108122 | Ga0070662_1001081222 | 238 |
| 433 | 3300005459 | Ga0068867_100006301 | Ga0068867_1000063017 | 238 |
| 434 | 3300005459 | Ga0068867_100062804 | Ga0068867_1000628043 | 238 |
| 435 | 3300005459 | Ga0068867_100154201 | Ga0068867_1001542012 | 238 |
| 436 | 3300005466 | Ga0070685_10493892 | Ga0070685_104938921 | 238 |
| 437 | 3300005518 | Ga0070699_100055772 | Ga0070699_1000557722 | 238 |
| 438 | 3300005535 | Ga0070684_100008489 | Ga0070684_1000084895 | 238 |
| 439 | 3300005543 | Ga0070672_100004725 | Ga0070672_1000047256 | 238 |
| 440 | 3300005543 | Ga0070672_100077153 | Ga0070672_1000771532 | 238 |
| 441 | 3300005543 | Ga0070672_100139359 | Ga0070672_1001393593 | 238 |
| 442 | 3300005564 | Ga0070664_100462481 | Ga0070664_1004624812 | 238 |
| 443 | 3300005578 | Ga0068854_100378415 | Ga0068854_1003784152 | 238 |
| 444 | 3300005614 | Ga0068856_100493265 | Ga0068856_1004932652 | 238 |
| 445 | 3300005615 | Ga0070702_100093456 | Ga0070702_1000934562 | 238 |
| 446 | 3300005616 | Ga0068852_100012855 | Ga0068852_1000128556 | 238 |
| 447 | 3300005616 | Ga0068852_100255336 | Ga0068852_1002553362 | 238 |
| 448 | 3300005617 | Ga0068859_100307229 | Ga0068859_1003072292 | 238 |
| 449 | 3300005618 | Ga0068864_100001309 | Ga0068864_10000130913 | 238 |
| 450 | 3300005618 | Ga0068864_100067142 | Ga0068864_1000671424 | 238 |
| 451 | 3300005719 | Ga0068861_100006046 | Ga0068861_1000060462 | 238 |
| 452 | 3300005841 | Ga0068863_100009149 | Ga0068863_1000091497 | 238 |
| 453 | 3300005841 | Ga0068863_100013734 | Ga0068863_1000137342 | 238 |
| 454 | 3300005842 | Ga0068858_100002892 | Ga0068858_10000289212 | 238 |
| 455 | 3300005842 | Ga0068858_100006541 | Ga0068858_1000065415 | 238 |
| 456 | 3300005842 | Ga0068858_100407886 | Ga0068858_1004078862 | 238 |
| 457 | 3300005843 | Ga0068860_100000445 | Ga0068860_10000044541 | 238 |
| 458 | 3300005843 | Ga0068860_100310575 | Ga0068860_1003105752 | 238 |
| 459 | 3300005844 | Ga0068862_100010162 | Ga0068862_1000101622 | 238 |
| 460 | 3300005937 | Ga0081455_10244989 | Ga0081455_102449892 | 238 |
| 461 | 3300006038 | Ga0075365_10003967 | Ga0075365_100039677 | 238 |
| 462 | 3300006051 | Ga0075364_10154517 | Ga0075364_101545172 | 238 |
| 463 | 3300006058 | Ga0075432_10028785 | Ga0075432_100287852 | 238 |
| 464 | 3300006177 | Ga0075362_10004353 | Ga0075362_100043534 | 238 |
| 465 | 3300006177 | Ga0075362_10011152 | Ga0075362_100111522 | 238 |
| 466 | 3300006237 | Ga0097621_100048088 | Ga0097621_1000480884 | 238 |
| 467 | 3300006237 | Ga0097621_100056051 | Ga0097621_1000560513 | 238 |
| 468 | 3300006358 | Ga0068871_100010108 | Ga0068871_1000101082 | 238 |
| 469 | 3300006358 | Ga0068871_100111652 | Ga0068871_1001116523 | 238 |
| 470 | 3300006844 | Ga0075428_100296709 | Ga0075428_1002967092 | 238 |
| 471 | 3300006846 | Ga0075430_100598118 | Ga0075430_1005981182 | 238 |
| 472 | 3300006847 | Ga0075431_100341770 | Ga0075431_1003417702 | 238 |
| 473 | 3300006881 | Ga0068865_100002093 | Ga0068865_1000020933 | 238 |
| 474 | 3300006881 | Ga0068865_100207516 | Ga0068865_1002075162 | 238 |
| 475 | 3300006914 | Ga0075436_100059701 | Ga0075436_1000597012 | 238 |
| 476 | 3300006931 | Ga0097620_100307225 | Ga0097620_1003072252 | 238 |
| 477 | 3300006948 | Ga0099826_10034418 | Ga0099826_100344182 | 238 |
| 478 | 3300007076 | Ga0075435_100042487 | Ga0075435_1000424873 | 238 |
| 479 | 3300009094 | Ga0111539_10517323 | Ga0111539_105173232 | 238 |
| 480 | 3300009098 | Ga0105245_10060255 | Ga0105245_100602553 | 238 |
| 481 | 3300009148 | Ga0105243_10021971 | Ga0105243_100219713 | 238 |
| 482 | 3300009176 | Ga0105242_10099494 | Ga0105242_100994943 | 238 |
| 483 | 3300009176 | Ga0105242_10483246 | Ga0105242_104832462 | 238 |
| 484 | 3300009177 | Ga0105248_10000595 | Ga0105248_1000059539 | 238 |
| 485 | 3300009177 | Ga0105248_10075724 | Ga0105248_100757243 | 238 |
| 486 | 3300009177 | Ga0105248_10201416 | Ga0105248_102014163 | 238 |
| 487 | 3300009553 | Ga0105249_10059135 | Ga0105249_100591353 | 238 |
| 488 | 3300009553 | Ga0105249_10193064 | Ga0105249_101930643 | 238 |
| 489 | 3300011119 | Ga0105246_10063724 | Ga0105246_100637242 | 238 |
| 490 | 3300013296 | Ga0157374_10021499 | Ga0157374_100214993 | 238 |
| 491 | 3300013297 | Ga0157378_10296911 | Ga0157378_102969112 | 238 |
| 492 | 3300013306 | Ga0163162_10036523 | Ga0163162_100365232 | 238 |
| 493 | 3300013306 | Ga0163162_10054073 | Ga0163162_100540732 | 238 |
| 494 | 3300013306 | Ga0163162_10814830 | Ga0163162_108148302 | 238 |
| 495 | 3300013308 | Ga0157375_10012725 | Ga0157375_100127253 | 238 |
| 496 | 3300013308 | Ga0157375_10179321 | Ga0157375_101793213 | 238 |
| 497 | 3300014325 | Ga0163163_10001922 | Ga0163163_1000192210 | 238 |
| 498 | 3300014326 | Ga0157380_10156949 | Ga0157380_101569493 | 238 |
| 499 | 3300014326 | Ga0157380_10260290 | Ga0157380_102602902 | 238 |
| 500 | 3300014326 | Ga0157380_10685965 | Ga0157380_106859652 | 238 |
| 501 | 3300014968 | Ga0157379_10045614 | Ga0157379_100456143 | 238 |
| 502 | 3300014969 | Ga0157376_10126000 | Ga0157376_101260003 | 238 |
| 503 | 3300014969 | Ga0157376_10949251 | Ga0157376_109492512 | 238 |
| 504 | 3300015261 | Ga0182006_1040886 | Ga0182006_10408862 | 238 |
| 505 | 3300015262 | Ga0182007_10002631 | Ga0182007_100026313 | 238 |
| 506 | 3300017792 | Ga0163161_10020823 | Ga0163161_100208234 | 238 |
| 507 | 3300017792 | Ga0163161_10064799 | Ga0163161_100647992 | 238 |
| 508 | 3300025263 | Ga0209565_1000042 | Ga0209565_100004239 | 238 |
| 509 | 3300025273 | Ga0209673_1000071 | Ga0209673_1000071188 | 238 |
| 510 | 3300025291 | Ga0209675_1000041 | Ga0209675_1000041187 | 238 |
| 511 | 3300025294 | Ga0209025_1005622 | Ga0209025_10056229 | 238 |
| 512 | 3300025295 | Ga0209564_1040927 | Ga0209564_10409272 | 238 |
| 513 | 3300025299 | Ga0209256_1015779 | Ga0209256_10157793 | 238 |
| 514 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025335 | 238 |
| 515 | 3300025303 | Ga0209051_1015927 | Ga0209051_10159272 | 238 |
| 516 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039273 | 238 |
| 517 | 3300025893 | Ga0207682_10008973 | Ga0207682_100089734 | 238 |
| 518 | 3300025893 | Ga0207682_10112704 | Ga0207682_101127041 | 238 |
| 519 | 3300025893 | Ga0207682_10174702 | Ga0207682_101747022 | 238 |
| 520 | 3300025899 | Ga0207642_10341732 | Ga0207642_103417321 | 238 |
| 521 | 3300025903 | Ga0207680_10005090 | Ga0207680_100050903 | 238 |
| 522 | 3300025903 | Ga0207680_10238129 | Ga0207680_102381291 | 238 |
| 523 | 3300025907 | Ga0207645_10004582 | Ga0207645_100045827 | 238 |
| 524 | 3300025908 | Ga0207643_10200037 | Ga0207643_102000371 | 238 |
| 525 | 3300025918 | Ga0207662_10001475 | Ga0207662_100014755 | 238 |
| 526 | 3300025918 | Ga0207662_10310098 | Ga0207662_103100981 | 238 |
| 527 | 3300025922 | Ga0207646_10027895 | Ga0207646_100278953 | 238 |
| 528 | 3300025923 | Ga0207681_10108238 | Ga0207681_101082381 | 238 |
| 529 | 3300025926 | Ga0207659_10008930 | Ga0207659_100089305 | 238 |
| 530 | 3300025926 | Ga0207659_10057571 | Ga0207659_100575713 | 238 |
| 531 | 3300025927 | Ga0207687_10027356 | Ga0207687_100273562 | 238 |
| 532 | 3300025928 | Ga0207700_10046909 | Ga0207700_100469093 | 238 |
| 533 | 3300025931 | Ga0207644_10162562 | Ga0207644_101625622 | 238 |
| 534 | 3300025933 | Ga0207706_10043730 | Ga0207706_100437302 | 238 |
| 535 | 3300025933 | Ga0207706_10058604 | Ga0207706_100586043 | 238 |
| 536 | 3300025934 | Ga0207686_10077384 | Ga0207686_100773842 | 238 |
| 537 | 3300025935 | Ga0207709_10012814 | Ga0207709_100128143 | 238 |
| 538 | 3300025936 | Ga0207670_10232681 | Ga0207670_102326812 | 238 |
| 539 | 3300025936 | Ga0207670_10371853 | Ga0207670_103718531 | 238 |
| 540 | 3300025937 | Ga0207669_10019212 | Ga0207669_100192122 | 238 |
| 541 | 3300025940 | Ga0207691_10010762 | Ga0207691_100107623 | 238 |
| 542 | 3300025940 | Ga0207691_10013009 | Ga0207691_100130094 | 238 |
| 543 | 3300025940 | Ga0207691_10182815 | Ga0207691_101828152 | 238 |
| 544 | 3300025941 | Ga0207711_10014494 | Ga0207711_100144944 | 238 |
| 545 | 3300025941 | Ga0207711_10032992 | Ga0207711_100329923 | 238 |
| 546 | 3300025941 | Ga0207711_10044194 | Ga0207711_100441943 | 238 |
| 547 | 3300025942 | Ga0207689_10004853 | Ga0207689_100048533 | 238 |
| 548 | 3300025942 | Ga0207689_10130471 | Ga0207689_101304712 | 238 |
| 549 | 3300025945 | Ga0207679_10346775 | Ga0207679_103467752 | 238 |
| 550 | 3300025960 | Ga0207651_10055288 | Ga0207651_100552882 | 238 |
| 551 | 3300025960 | Ga0207651_10342988 | Ga0207651_103429882 | 238 |
| 552 | 3300025961 | Ga0207712_10011898 | Ga0207712_100118982 | 238 |
| 553 | 3300025972 | Ga0207668_10196102 | Ga0207668_101961022 | 238 |
| 554 | 3300025972 | Ga0207668_10387152 | Ga0207668_103871522 | 238 |
| 555 | 3300025986 | Ga0207658_10003494 | Ga0207658_100034947 | 238 |
| 556 | 3300025986 | Ga0207658_10017863 | Ga0207658_100178634 | 238 |
| 557 | 3300026023 | Ga0207677_10024617 | Ga0207677_100246173 | 238 |
| 558 | 3300026023 | Ga0207677_10040343 | Ga0207677_100403432 | 238 |
| 559 | 3300026035 | Ga0207703_10001799 | Ga0207703_1000179911 | 238 |
| 560 | 3300026035 | Ga0207703_10032151 | Ga0207703_100321512 | 238 |
| 561 | 3300026078 | Ga0207702_10012690 | Ga0207702_100126903 | 238 |
| 562 | 3300026088 | Ga0207641_10015255 | Ga0207641_100152554 | 238 |
| 563 | 3300026088 | Ga0207641_10020481 | Ga0207641_100204813 | 238 |
| 564 | 3300026088 | Ga0207641_10091584 | Ga0207641_100915843 | 238 |
| 565 | 3300026089 | Ga0207648_10004667 | Ga0207648_1000466711 | 238 |
| 566 | 3300026089 | Ga0207648_10021486 | Ga0207648_100214864 | 238 |
| 567 | 3300026089 | Ga0207648_10277875 | Ga0207648_102778752 | 238 |
| 568 | 3300026095 | Ga0207676_10005019 | Ga0207676_100050192 | 238 |
| 569 | 3300026095 | Ga0207676_10052933 | Ga0207676_100529332 | 238 |
| 570 | 3300026118 | Ga0207675_100007314 | Ga0207675_1000073143 | 238 |
| 571 | 3300026118 | Ga0207675_100034843 | Ga0207675_1000348432 | 238 |
| 572 | 3300026121 | Ga0207683_10007125 | Ga0207683_100071258 | 238 |
| 573 | 3300026121 | Ga0207683_10054461 | Ga0207683_100544612 | 238 |
| 574 | 3300026121 | Ga0207683_10087574 | Ga0207683_100875742 | 238 |
| 575 | 3300026142 | Ga0207698_10013120 | Ga0207698_100131205 | 238 |
| 576 | 3300027907 | Ga0207428_10130805 | Ga0207428_101308052 | 238 |
| 577 | 3300028380 | Ga0268265_10004016 | Ga0268265_100040165 | 238 |
| 578 | 3300028381 | Ga0268264_10009491 | Ga0268264_100094912 | 238 |
| 579 | 3300028794 | Ga0307515_10000014 | Ga0307515_10000014312 | 238 |
| 580 | 3300031548 | Ga0307408_100111218 | Ga0307408_1001112183 | 238 |
| 581 | 3300031548 | Ga0307408_100204454 | Ga0307408_1002044542 | 238 |
| 582 | 3300031731 | Ga0307405_10003735 | Ga0307405_100037352 | 238 |
| 583 | 3300031731 | Ga0307405_10471017 | Ga0307405_104710172 | 238 |
| 584 | 3300031824 | Ga0307413_10026207 | Ga0307413_100262072 | 238 |
| 585 | 3300031852 | Ga0307410_10014455 | Ga0307410_100144552 | 238 |
| 586 | 3300031901 | Ga0307406_10005448 | Ga0307406_100054485 | 238 |
| 587 | 3300031901 | Ga0307406_10060538 | Ga0307406_100605382 | 238 |
| 588 | 3300031903 | Ga0307407_10002451 | Ga0307407_100024512 | 238 |
| 589 | 3300031911 | Ga0307412_10009014 | Ga0307412_100090145 | 238 |
| 590 | 3300031911 | Ga0307412_10131568 | Ga0307412_101315682 | 238 |
| 591 | 3300031911 | Ga0307412_10475281 | Ga0307412_104752812 | 238 |
| 592 | 3300031995 | Ga0307409_100022174 | Ga0307409_1000221742 | 238 |
| 593 | 3300031995 | Ga0307409_100060900 | Ga0307409_1000609001 | 238 |
| 594 | 3300032002 | Ga0307416_100000708 | Ga0307416_10000070810 | 238 |
| 595 | 3300032002 | Ga0307416_100001584 | Ga0307416_10000158410 | 238 |
| 596 | 3300032004 | Ga0307414_10031261 | Ga0307414_100312612 | 238 |
| 597 | 3300032004 | Ga0307414_10348942 | Ga0307414_103489422 | 238 |
| 598 | 3300032005 | Ga0307411_10002419 | Ga0307411_100024194 | 238 |
| 599 | 3300032005 | Ga0307411_10501255 | Ga0307411_105012551 | 238 |
| 600 | 3300032126 | Ga0307415_100000614 | Ga0307415_1000006148 | 238 |
| 601 | 3300032126 | Ga0307415_100011692 | Ga0307415_1000116923 | 238 |
| 602 | 3300035117 | Ga0373953_0073036 | Ga0373953_0073036_544_1269 | 238 |
| 603 | 3300035118 | Ga0373954_0076756 | Ga0373954_0076756_525_1250 | 238 |
| 604 | 3300035121 | Ga0373960_0088817 | Ga0373960_0088817_57_776 | 238 |
| 605 | 3300035170 | Ga0373943_0029685 | Ga0373943_0029685_1703_2419 | 238 |
| 606 | 3300035172 | Ga0373955_0144799 | Ga0373955_0144799_540_1265 | 238 |
| 607 | 3300035695 | Ga0373927_0266369 | Ga0373927_0266369_213_929 | 238 |
| 608 | 3300036401 | Ga0373937_0003134 | Ga0373937_0003134_3807_4532 | 238 |
| 609 | 3300037312 | Ga0395899_0006613 | Ga0395899_0006613_868_1584 | 238 |
| 610 | 3300037418 | Ga0395900_0036357 | Ga0395900_0036357_4238_4954 | 238 |
| 611 | 3300037418 | Ga0395900_0187454 | Ga0395900_0187454_1156_1872 | 238 |
| 612 | 3300037418 | Ga0395900_0347057 | Ga0395900_0347057_228_944 | 238 |
| 613 | 3300037466 | Ga0395898_0062414 | Ga0395898_0062414_315_1031 | 238 |
| 614 | 3300037466 | Ga0395898_0138897 | Ga0395898_0138897_330_1046 | 238 |
| 615 | 3300037471 | Ga0395905_0017834 | Ga0395905_0017834_658_1374 | 238 |
| 616 | 3300038443 | Ga0395901_0274049 | Ga0395901_0274049_555_1271 | 238 |
| 617 | 3300038443 | Ga0395901_0295082 | Ga0395901_0295082_528_1244 | 238 |
| 618 | 3300041404 | Ga0439436_0060856 | Ga0439436_0060856_169_894 | 238 |
| 619 | 3300041411 | Ga0439466_0036387 | Ga0439466_0036387_829_1554 | 238 |
| 620 | 3300041413 | Ga0439465_0052638 | Ga0439465_0052638_528_1253 | 238 |
| 621 | 3300041999 | Ga0439433_0007425 | Ga0439433_0007425_1196_1921 | 238 |
| 622 | 3300042000 | Ga0439437_003681 | Ga0439437_003681_88_813 | 238 |
| 623 | 3300042002 | Ga0439442_015691 | Ga0439442_015691_728_1453 | 238 |
| 624 | 3300042006 | Ga0439432_020405 | Ga0439432_020405_825_1550 | 238 |
| 625 | 3300042008 | Ga0439450_004026 | Ga0439450_004026_324_1046 | 238 |
| 626 | 3300042010 | Ga0439452_009876 | Ga0439452_009876_341_1066 | 238 |
| 627 | 3300042115 | Ga0450911_000599 | Ga0450911_000599_10067_10783 | 238 |
| 628 | 3300042123 | Ga0450921_000584 | Ga0450921_000584_387_1112 | 238 |
| 629 | 3300042125 | Ga0450923_001005 | Ga0450923_001005_1765_2490 | 238 |
| 630 | 3300042128 | Ga0450897_002588 | Ga0450897_002588_207_932 | 238 |
| 631 | 3300042130 | Ga0450892_005129 | Ga0450892_005129_81_803 | 238 |
| 632 | 3300042131 | Ga0450894_005256 | Ga0450894_005256_565_1290 | 238 |
| 633 | 3300042146 | Ga0450907_018092 | Ga0450907_018092_193_918 | 238 |
| 634 | 3300042157 | Ga0439458_0012922 | Ga0439458_0012922_648_1373 | 238 |
| 635 | 3300042185 | Ga0450909_006969 | Ga0450909_006969_369_1094 | 238 |
| 636 | 3300042435 | Ga0439434_0002341 | Ga0439434_0002341_2620_3345 | 238 |
| 637 | 3300042439 | Ga0439464_0002254 | Ga0439464_0002254_3258_3980 | 238 |
| 638 | 3300042439 | Ga0439464_0019192 | Ga0439464_0019192_903_1628 | 238 |
| 639 | 3300042461 | Ga0439460_0027746 | Ga0439460_0027746_47_769 | 238 |
| 640 | 3300042532 | Ga0450893_0016014 | Ga0450893_0016014_355_1080 | 238 |
| 641 | 3300044673 | Ga0453683_0172369 | Ga0453683_0172369_248_964 | 238 |
| 642 | 3300044842 | Ga0466957_0432766 | Ga0466957_0432766_110_826 | 238 |
| 643 | 3300045051 | Ga0451576_0183272 | Ga0451576_0183272_812_1537 | 238 |
| 644 | 3300045051 | Ga0451576_0476451 | Ga0451576_0476451_174_890 | 238 |
| 645 | 3300046455 | Ga0495603_0110883 | Ga0495603_0110883_797_1513 | 238 |
| 646 | 3300046528 | Ga0495642_0038531 | Ga0495642_0038531_420_1136 | 238 |
| 647 | 3300046529 | Ga0495652_0254727 | Ga0495652_0254727_234_959 | 238 |
| 648 | 3300046615 | Ga0495656_0121859 | Ga0495656_0121859_138_860 | 238 |
| 649 | 3300047315 | Ga0495581_0309169 | Ga0495581_0309169_63_779 | 238 |
| 650 | 3300048904 | Ga0496101_0234287 | Ga0496101_0234287_51_767 | 238 |
| 651 | 3300048907 | Ga0496104_0009110 | Ga0496104_0009110_189_905 | 238 |
| 652 | 3300048907 | Ga0496104_0087772 | Ga0496104_0087772_649_1371 | 238 |
| 653 | 3300048907 | Ga0496104_0784792 | Ga0496104_0784792_29_745 | 238 |
| 654 | 3300048908 | Ga0496105_0045498 | Ga0496105_0045498_225_941 | 238 |
| 655 | 3300048908 | Ga0496105_0051490 | Ga0496105_0051490_298_1014 | 238 |
| 656 | 3300048908 | Ga0496105_0364248 | Ga0496105_0364248_288_1004 | 238 |
| 657 | 3300048909 | Ga0496106_0020051 | Ga0496106_0020051_4203_4919 | 238 |
| 658 | 3300048911 | Ga0496108_0229768 | Ga0496108_0229768_676_1392 | 238 |
| 659 | 3300048911 | Ga0496108_0521588 | Ga0496108_0521588_82_798 | 238 |
| 660 | 3300048912 | Ga0496109_0059341 | Ga0496109_0059341_1854_2570 | 238 |
| 661 | 3300048912 | Ga0496109_0113962 | Ga0496109_0113962_1625_2341 | 238 |
| 662 | 3300048913 | Ga0496110_0121428 | Ga0496110_0121428_1148_1864 | 238 |
| 663 | 3300048914 | Ga0496111_0116578 | Ga0496111_0116578_832_1548 | 238 |
| 664 | 3300048914 | Ga0496111_0180781 | Ga0496111_0180781_498_1220 | 238 |
| 665 | 3300048914 | Ga0496111_0575958 | Ga0496111_0575958_52_768 | 238 |
| 666 | 3300048915 | Ga0496112_0005345 | Ga0496112_0005345_9659_10375 | 238 |
| 667 | 3300048917 | Ga0496114_0194934 | Ga0496114_0194934_397_1113 | 238 |
| 668 | 3300048924 | Ga0496121_0002968 | Ga0496121_0002968_21286_22002 | 238 |
| 669 | 3300048928 | Ga0496125_0026075 | Ga0496125_0026075_1261_1977 | 238 |
| 670 | 3300049517 | Ga0501294_004268 | Ga0501294_004268_465_1202 | 238 |
| 671 | 3300049686 | Ga0501257_019873 | Ga0501257_019873_160_897 | 238 |
| 672 | 3300050489 | nmdc:mga03683_1540_c1 | nmdc:mga03683_1540_c1_998_1723 | 238 |
| 673 | 3300050490 | nmdc:mga03n38_6527_c1 | nmdc:mga03n38_6527_c1_84_809 | 238 |
| 674 | 3300050491 | nmdc:mga00v17_9302_c1 | nmdc:mga00v17_9302_c1_1312_2037 | 238 |
| 675 | 3300050492 | nmdc:mga0yw44_1966_c1 | nmdc:mga0yw44_1966_c1_2867_3592 | 238 |
| 676 | 3300050493 | nmdc:mga0k408_33541_c1 | nmdc:mga0k408_33541_c1_830_1555 | 238 |
| 677 | 3300050496 | nmdc:mga07m45_33632_c1 | nmdc:mga07m45_33632_c1_1067_1792 | 238 |
| 678 | 3300050513 | nmdc:mga0rr50_38273_c1 | nmdc:mga0rr50_38273_c1_2732_3454 | 238 |
| 679 | 3300050514 | nmdc:mga08x19_30171_c1 | nmdc:mga08x19_30171_c1_1874_2596 | 238 |
| 680 | 3300053178 | Ga0500637_0308513 | Ga0500637_0308513_33_749 | 238 |
| 681 | 3300003781 | Ga0055536_1000313 | Ga0055536_10003132 | 239 |
| 682 | 3300003784 | Ga0055534_1003181 | Ga0055534_10031813 | 239 |
| 683 | 3300003792 | Ga0055540_1001615 | Ga0055540_10016155 | 239 |
| 684 | 3300009148 | Ga0105243_10000293 | Ga0105243_1000029311 | 239 |
| 685 | 3300017792 | Ga0163161_10104436 | Ga0163161_101044363 | 239 |
| 686 | 3300025284 | Ga0209130_1001720 | Ga0209130_100172012 | 239 |
| 687 | 3300025291 | Ga0209675_1002415 | Ga0209675_10024154 | 239 |
| 688 | 3300025292 | Ga0209676_1000267 | Ga0209676_100026734 | 239 |
| 689 | 3300025292 | Ga0209676_1006250 | Ga0209676_10062502 | 239 |
| 690 | 3300025298 | Ga0209050_1009624 | Ga0209050_10096243 | 239 |
| 691 | 3300025298 | Ga0209050_1015410 | Ga0209050_10154102 | 239 |
| 692 | 3300025303 | Ga0209051_1000230 | Ga0209051_100023059 | 239 |
| 693 | 3300025303 | Ga0209051_1005092 | Ga0209051_10050925 | 239 |
| 694 | 3300025304 | Ga0209257_1004695 | Ga0209257_10046953 | 239 |
| 695 | 3300025304 | Ga0209257_1005713 | Ga0209257_10057133 | 239 |
| 696 | 3300025935 | Ga0207709_10000076 | Ga0207709_1000007672 | 239 |
| 697 | 3300032002 | Ga0307416_100644672 | Ga0307416_1006446722 | 239 |
| 698 | 3300032005 | Ga0307411_10043524 | Ga0307411_100435243 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9465 | 1 | 239 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9426 | 1 | 239 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9269 | 6 | 226 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9189 | 3 | 228 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9177 | 3 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9712 | 6 | 234 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9687 | 1 | 239 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9647 | 1 | 239 | 3.40.50.300 |
| 1ji0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9415 | 1 | 239 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9388 | 6 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1N4U0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9859 | 3 | 239 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A7T2SAA5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9778 | 3 | 239 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A7W1N4U0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9776 | 3 | 239 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A6G6K803-F1-model_v4 | ABC transporter ATP-binding protein | 0.9774 | 6 | 239 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A4R9AIB0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9757 | 6 | 239 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar