F475963

General Info

Members Datasets Scaffolds Average Seq Length
698 360 693 237

Family's Representative Sequence

Representative Sequence 3300027364|Ga0209967_1000307|Ga0209967_10003076
Length 228
Sequence LALLEVVGPLLEVRGLHAAYGQTRVLHGLDFTLEEGSITALLGANGAGKTTTLRALCGMVRTEGEVRFAGHDIGRRKTEDIARLGIAHVPDGRGTFLNLTTEENLRLGAYARRDKKAVEADIERMFGHFPRLKERLAVSRALMMKPKLMLLDEPSFGLAPLLVRELFQILARINEAERVSMLLVEQNAAMALDLANQAYLIETGRVVQSGSAEALKRDDAVRKSYLGY

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
3 2643221683 Variovorax sp. Root473 Isolate Unclassified
4 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
5 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
238 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
239 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
240 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
241 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
244 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
245 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
246 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
247 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
248 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
249 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
254 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
255 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
256 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
257 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
319 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0.14
Rhizoplane 4.01
Rhizosphere 88.97
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000313 3300003781 Bacteria 36453
2 Ga0055534_1000008 3300003784 Bacteria 211098
3 Ga0055534_1003181 3300003784 Bacteria 5298
4 Ga0055528_1000831 3300003790 Bacteria 21133
5 Ga0055540_1001615 3300003792 Bacteria 13125
6 Ga0055531_10001403 3300003794 Bacteria 17819
7 Ga0065707_10012400 3300005295 Bacteria 2114
8 Ga0065707_10188918 3300005295 Bacteria 1372
9 Ga0070658_10055099 3300005327 Bacteria 3230
10 Ga0070676_10008106 3300005328 Bacteria 5650
11 Ga0070690_100005969 3300005330 Bacteria 6877
12 Ga0070690_100060132 3300005330 Bacteria 2445
13 Ga0070690_100403703 3300005330 Bacteria 1004
14 Ga0070670_100205419 3300005331 Bacteria 1712
15 Ga0070677_10002411 3300005333 Bacteria 5965
16 Ga0068869_100004332 3300005334 Bacteria 8810
17 Ga0068869_100019219 3300005334 Bacteria 4663
18 Ga0068869_100030088 3300005334 Bacteria 3809
19 Ga0068869_100081702 3300005334 Bacteria 2414
20 Ga0070666_10001889 3300005335 Bacteria 12748
21 Ga0070680_100019081 3300005336 Bacteria 5429
22 Ga0070680_100055735 3300005336 Bacteria 3230
23 Ga0070680_100225876 3300005336 Bacteria 1581
24 Ga0068868_100038678 3300005338 Bacteria 3703
25 Ga0068868_100746633 3300005338 Bacteria 879
26 Ga0070689_100011408 3300005340 Bacteria 6366
27 Ga0070689_100066434 3300005340 Bacteria 2809
28 Ga0070687_100011217 3300005343 Bacteria 3912
29 Ga0070687_100079559 3300005343 Bacteria 1785
30 Ga0070687_100116518 3300005343 Bacteria 1521
31 Ga0070692_10019347 3300005345 Bacteria 3285
32 Ga0070692_10029742 3300005345 Bacteria 2726
33 Ga0070692_10168692 3300005345 Bacteria 1260
34 Ga0070692_10235958 3300005345 Bacteria 1088
35 Ga0070668_100047700 3300005347 Bacteria 3293
36 Ga0070668_100127885 3300005347 Bacteria 2036
37 Ga0070668_100144256 3300005347 Bacteria 1921
38 Ga0070669_100040122 3300005353 Bacteria 3402
39 Ga0070669_100091953 3300005353 Bacteria 2276
40 Ga0070675_100002630 3300005354 Bacteria 13494
41 Ga0070675_100042071 3300005354 Bacteria 3732
42 Ga0070675_100313930 3300005354 Bacteria 1383
43 Ga0070671_100010559 3300005355 Bacteria 7415
44 Ga0070671_100016816 3300005355 Bacteria 5914
45 Ga0070671_100044385 3300005355 Bacteria 3694
46 Ga0070674_100200041 3300005356 Bacteria 1542
47 Ga0070673_100042648 3300005364 Bacteria 3499
48 Ga0070673_100217654 3300005364 Bacteria 1651
49 Ga0070688_100072006 3300005365 Bacteria 2214
50 Ga0070667_100011577 3300005367 Bacteria 7291
51 Ga0070667_100014472 3300005367 Bacteria 6518
52 Ga0070714_100059530 3300005435 Bacteria 3275
53 Ga0070714_100083363 3300005435 Bacteria 2787
54 Ga0070705_100003022 3300005440 Bacteria 8313
55 Ga0070705_100127233 3300005440 Bacteria 1656
56 Ga0070705_100237547 3300005440 Bacteria 1271
57 Ga0070700_100003507 3300005441 Bacteria 8091
58 Ga0070700_100387100 3300005441 Bacteria 1047
59 Ga0070694_100005593 3300005444 Bacteria 7617
60 Ga0070694_100092879 3300005444 Bacteria 2120
61 Ga0070694_100126096 3300005444 Bacteria 1843
62 Ga0070694_100193556 3300005444 Bacteria 1511
63 Ga0070678_100036514 3300005456 Bacteria 3441
64 Ga0070678_100073025 3300005456 Bacteria 2573
65 Ga0070662_100020143 3300005457 Bacteria 4539
66 Ga0070662_100108122 3300005457 Bacteria 2115
67 Ga0070681_10012298 3300005458 Bacteria 8489
68 Ga0068867_100001086 3300005459 Bacteria 18625
69 Ga0068867_100006301 3300005459 Bacteria 8395
70 Ga0068867_100062804 3300005459 Bacteria 2760
71 Ga0068867_100133791 3300005459 Bacteria 1930
72 Ga0068867_100154201 3300005459 Bacteria 1806
73 Ga0070685_10493892 3300005466 Bacteria 865
74 Ga0070698_100014017 3300005471 Bacteria 8477
75 Ga0070698_100126373 3300005471 Bacteria 2514
76 Ga0070699_100055772 3300005518 Bacteria 3421
77 Ga0070699_100056960 3300005518 Bacteria 3385
78 Ga0070699_100436424 3300005518 Bacteria 1186
79 Ga0070679_100056283 3300005530 Bacteria 3918
80 Ga0070684_100008489 3300005535 Bacteria 8034
81 Ga0070697_100004865 3300005536 Bacteria 10303
82 Ga0070697_100005701 3300005536 Bacteria 9591
83 Ga0068853_100837283 3300005539 Bacteria 882
84 Ga0068853_100885611 3300005539 Bacteria 857
85 Ga0070672_100004725 3300005543 Bacteria 8940
86 Ga0070672_100077153 3300005543 Bacteria 2663
87 Ga0070672_100139359 3300005543 Bacteria 1999
88 Ga0070686_100012900 3300005544 Bacteria 4771
89 Ga0070686_100403804 3300005544 Bacteria 1040
90 Ga0070695_100087420 3300005545 Bacteria 2074
91 Ga0070696_100009913 3300005546 Bacteria 6373
92 Ga0070696_100028084 3300005546 Bacteria 3837
93 Ga0070696_100055717 3300005546 Bacteria 2757
94 Ga0070696_100069516 3300005546 Bacteria 2474
95 Ga0070696_100520855 3300005546 Bacteria 949
96 Ga0070693_100304747 3300005547 Bacteria 1075
97 Ga0070704_100002583 3300005549 Bacteria 10212
98 Ga0070704_100009156 3300005549 Bacteria 5972
99 Ga0070704_100109550 3300005549 Bacteria 2098
100 Ga0070704_100428010 3300005549 Bacteria 1135
101 Ga0070664_100462481 3300005564 Bacteria 1166
102 Ga0068857_100229490 3300005577 Bacteria 1698
103 Ga0068854_100378415 3300005578 Bacteria 1166
104 Ga0068856_100493265 3300005614 Bacteria 1246
105 Ga0070702_100025696 3300005615 Bacteria 3158
106 Ga0070702_100093456 3300005615 Bacteria 1829
107 Ga0070702_100166575 3300005615 Bacteria 1430
108 Ga0068852_100012855 3300005616 Bacteria 6382
109 Ga0068852_100212763 3300005616 Bacteria 1835
110 Ga0068852_100255336 3300005616 Bacteria 1681
111 Ga0068859_100007812 3300005617 Bacteria 10858
112 Ga0068859_100307229 3300005617 Bacteria 1679
113 Ga0068859_100636880 3300005617 Bacteria 1158
114 Ga0068864_100001309 3300005618 Bacteria 20721
115 Ga0068864_100067142 3300005618 Bacteria 3114
116 Ga0068864_100333926 3300005618 Bacteria 1427
117 Ga0068861_100006046 3300005719 Bacteria 8233
118 Ga0068861_100027677 3300005719 Bacteria 4132
119 Ga0068870_10068810 3300005840 Bacteria 1924
120 Ga0068863_100009149 3300005841 Bacteria 9667
121 Ga0068863_100013734 3300005841 Bacteria 7808
122 Ga0068863_100762482 3300005841 Bacteria 964
123 Ga0068858_100002892 3300005842 Bacteria 17265
124 Ga0068858_100006541 3300005842 Bacteria 11334
125 Ga0068858_100169363 3300005842 Bacteria 2059
126 Ga0068858_100397499 3300005842 Bacteria 1324
127 Ga0068858_100407886 3300005842 Bacteria 1306
128 Ga0068860_100000445 3300005843 Bacteria 52236
129 Ga0068860_100310575 3300005843 Bacteria 1546
130 Ga0068860_100924395 3300005843 Bacteria 889
131 Ga0068862_100010162 3300005844 Bacteria 7766
132 Ga0068862_100223531 3300005844 Bacteria 1705
133 Ga0068862_100654684 3300005844 Bacteria 1013
134 Ga0081455_10244989 3300005937 Bacteria 1315
135 Ga0081539_10001857 3300005985 Bacteria 33255
136 Ga0070717_10094835 3300006028 Bacteria 2525
137 Ga0075365_10003967 3300006038 Bacteria 7748
138 Ga0075365_10017503 3300006038 Bacteria 4385
139 Ga0075363_100019885 3300006048 Bacteria 3362
140 Ga0075364_10154517 3300006051 Bacteria 1547
141 Ga0075432_10028785 3300006058 Bacteria 1917
142 Ga0075362_10004353 3300006177 Bacteria 5074
143 Ga0075362_10011152 3300006177 Bacteria 3533
144 Ga0097621_100048088 3300006237 Bacteria 3459
145 Ga0097621_100056051 3300006237 Bacteria 3219
146 Ga0097621_100657924 3300006237 Bacteria 962
147 Ga0068871_100010108 3300006358 Bacteria 6866
148 Ga0068871_100111652 3300006358 Bacteria 2299
149 Ga0075428_100000390 3300006844 Bacteria 43360
150 Ga0075428_100061243 3300006844 Bacteria 4121
151 Ga0075428_100296709 3300006844 Bacteria 1738
152 Ga0075428_100426217 3300006844 Bacteria 1421
153 Ga0075430_100000520 3300006846 Bacteria 28959
154 Ga0075430_100011416 3300006846 Bacteria 7541
155 Ga0075430_100018097 3300006846 Bacteria 5996
156 Ga0075430_100100659 3300006846 Bacteria 2413
157 Ga0075430_100598118 3300006846 Bacteria 910
158 Ga0075431_100000003 3300006847 Bacteria 112884
159 Ga0075431_100009047 3300006847 Bacteria 9987
160 Ga0075431_100021141 3300006847 Bacteria 6649
161 Ga0075431_100341770 3300006847 Bacteria 1506
162 Ga0075431_100343858 3300006847 Bacteria 1501
163 Ga0075433_10153428 3300006852 Bacteria 2049
164 Ga0075433_10208504 3300006852 Bacteria 1737
165 Ga0075433_10386854 3300006852 Bacteria 1235
166 Ga0075434_100000132 3300006871 Bacteria 44951
167 Ga0075434_100031833 3300006871 Bacteria 5201
168 Ga0075434_100138712 3300006871 Bacteria 2451
169 Ga0075434_100171243 3300006871 Bacteria 2191
170 Ga0075434_100973233 3300006871 Bacteria 863
171 Ga0075429_100000638 3300006880 Bacteria 27089
172 Ga0075429_100001974 3300006880 Bacteria 17065
173 Ga0075429_100135451 3300006880 Bacteria 2155
174 Ga0075429_100141972 3300006880 Bacteria 2102
175 Ga0075429_100646000 3300006880 Bacteria 927
176 Ga0068865_100002093 3300006881 Bacteria 11787
177 Ga0068865_100023360 3300006881 Bacteria 4047
178 Ga0068865_100207516 3300006881 Bacteria 1524
179 Ga0068865_100256893 3300006881 Bacteria 1381
180 Ga0075436_100000638 3300006914 Bacteria 23058
181 Ga0075436_100015380 3300006914 Bacteria 5241
182 Ga0075436_100059701 3300006914 Bacteria 2634
183 Ga0075436_100061090 3300006914 Bacteria 2603
184 Ga0097620_100007812 3300006931 Bacteria 10858
185 Ga0097620_100307225 3300006931 Bacteria 1679
186 Ga0097620_100636870 3300006931 Bacteria 1158
187 Ga0099826_10034418 3300006948 Bacteria 3619
188 Ga0075435_100001341 3300007076 Bacteria 15839
189 Ga0075435_100006450 3300007076 Bacteria 8299
190 Ga0075435_100037184 3300007076 Bacteria 3875
191 Ga0075435_100042487 3300007076 Bacteria 3637
192 Ga0075435_100265669 3300007076 Bacteria 1463
193 Ga0075435_100416511 3300007076 Bacteria 1157
194 Ga0099794_10047137 3300007265 Bacteria 2066
195 Ga0111539_10006444 3300009094 Bacteria 15127
196 Ga0111539_10006454 3300009094 Bacteria 15113
197 Ga0111539_10085259 3300009094 Bacteria 3713
198 Ga0111539_10517323 3300009094 Bacteria 1390
199 Ga0111539_11037895 3300009094 Bacteria 953
200 Ga0105245_10047244 3300009098 Bacteria 3847
201 Ga0105245_10051495 3300009098 Bacteria 3691
202 Ga0105245_10060255 3300009098 Bacteria 3418
203 Ga0105245_10082487 3300009098 Bacteria 2941
204 Ga0114129_10000104 3300009147 Bacteria 83195
205 Ga0114129_10007443 3300009147 Bacteria 15595
206 Ga0114129_10015516 3300009147 Bacteria 10831
207 Ga0114129_10331229 3300009147 Bacteria 2021
208 Ga0105243_10000293 3300009148 Bacteria 55165
209 Ga0105243_10021971 3300009148 Bacteria 4846
210 Ga0105243_10915615 3300009148 Bacteria 873
211 Ga0105242_10002945 3300009176 Bacteria 13311
212 Ga0105242_10099494 3300009176 Bacteria 2461
213 Ga0105242_10316876 3300009176 Bacteria 1429
214 Ga0105242_10483246 3300009176 Bacteria 1174
215 Ga0105248_10000595 3300009177 Bacteria 41224
216 Ga0105248_10075724 3300009177 Bacteria 3782
217 Ga0105248_10201416 3300009177 Bacteria 2243
218 Ga0105249_10059135 3300009553 Bacteria 3514
219 Ga0105249_10102811 3300009553 Bacteria 2690
220 Ga0105249_10193064 3300009553 Bacteria 1988
221 Ga0099796_10064994 3300010159 Bacteria 1303
222 Ga0105239_10280495 3300010375 Bacteria 1876
223 Ga0105246_10043687 3300011119 Bacteria 3042
224 Ga0105246_10063724 3300011119 Bacteria 2572
225 Ga0157374_10021499 3300013296 Bacteria 5742
226 Ga0157378_10296911 3300013297 Bacteria 1562
227 Ga0163162_10036523 3300013306 Bacteria 4898
228 Ga0163162_10054073 3300013306 Bacteria 4037
229 Ga0163162_10667626 3300013306 Bacteria 1162
230 Ga0163162_10814830 3300013306 Bacteria 1050
231 Ga0157375_10012725 3300013308 Bacteria 7468
232 Ga0157375_10179321 3300013308 Bacteria 2269
233 Ga0163163_10001922 3300014325 Bacteria 17590
234 Ga0157380_10092441 3300014326 Bacteria 2500
235 Ga0157380_10156949 3300014326 Bacteria 1973
236 Ga0157380_10252527 3300014326 Bacteria 1597
237 Ga0157380_10260290 3300014326 Bacteria 1575
238 Ga0157380_10685965 3300014326 Bacteria 1027
239 Ga0157377_10051344 3300014745 Bacteria 2325
240 Ga0157379_10045614 3300014968 Bacteria 3912
241 Ga0157379_10075107 3300014968 Bacteria 3026
242 Ga0157376_10126000 3300014969 Bacteria 2278
243 Ga0157376_10949251 3300014969 Bacteria 880
244 Ga0182006_1040886 3300015261 Bacteria 1823
245 Ga0182007_10002631 3300015262 Bacteria 8833
246 Ga0163161_10020823 3300017792 Bacteria 4605
247 Ga0163161_10064799 3300017792 Bacteria 2666
248 Ga0163161_10104436 3300017792 Bacteria 2112
249 Ga0213876_10240135 3300021384 Bacteria 963
250 Ga0209565_1000042 3300025263 Bacteria 239712
251 Ga0209673_1000071 3300025273 Bacteria 239966
252 Ga0209130_1001720 3300025284 Bacteria 13127
253 Ga0209675_1000041 3300025291 Bacteria 239712
254 Ga0209675_1002415 3300025291 Bacteria 9634
255 Ga0209676_1000267 3300025292 Bacteria 109237
256 Ga0209676_1006250 3300025292 Bacteria 5935
257 Ga0209025_1005622 3300025294 Bacteria 10120
258 Ga0209564_1040927 3300025295 Bacteria 1250
259 Ga0209050_1009624 3300025298 Bacteria 4912
260 Ga0209050_1015410 3300025298 Bacteria 3213
261 Ga0209256_1015779 3300025299 Bacteria 2620
262 Ga0209051_1000025 3300025303 Bacteria 415397
263 Ga0209051_1000230 3300025303 Bacteria 94027
264 Ga0209051_1005092 3300025303 Bacteria 7811
265 Ga0209051_1015927 3300025303 Bacteria 3436
266 Ga0209257_1000039 3300025304 Bacteria 591694
267 Ga0209257_1004695 3300025304 Bacteria 10259
268 Ga0209257_1005713 3300025304 Bacteria 8541
269 Ga0207653_10060416 3300025885 Bacteria 1277
270 Ga0207682_10008973 3300025893 Bacteria 3951
271 Ga0207682_10112704 3300025893 Bacteria 1199
272 Ga0207682_10174702 3300025893 Bacteria 979
273 Ga0207642_10302671 3300025899 Bacteria 927
274 Ga0207642_10341732 3300025899 Bacteria 880
275 Ga0207680_10005090 3300025903 Bacteria 6265
276 Ga0207680_10128354 3300025903 Bacteria 1668
277 Ga0207680_10238129 3300025903 Bacteria 1253
278 Ga0207645_10004582 3300025907 Bacteria 10192
279 Ga0207643_10200037 3300025908 Bacteria 1216
280 Ga0207705_10493148 3300025909 Bacteria 951
281 Ga0207684_10098185 3300025910 Bacteria 2501
282 Ga0207707_10007969 3300025912 Bacteria 9208
283 Ga0207707_10262326 3300025912 Bacteria 1499
284 Ga0207693_10099002 3300025915 Bacteria 2286
285 Ga0207660_10037119 3300025917 Bacteria 3393
286 Ga0207660_10064740 3300025917 Bacteria 2639
287 Ga0207660_10463210 3300025917 Bacteria 1026
288 Ga0207662_10001475 3300025918 Bacteria 11429
289 Ga0207662_10073492 3300025918 Bacteria 2074
290 Ga0207662_10111522 3300025918 Bacteria 1706
291 Ga0207662_10310098 3300025918 Bacteria 1051
292 Ga0207646_10027895 3300025922 Bacteria 5147
293 Ga0207646_10401941 3300025922 Bacteria 1237
294 Ga0207681_10070992 3300025923 Bacteria 2427
295 Ga0207681_10108238 3300025923 Bacteria 2017
296 Ga0207659_10008930 3300025926 Bacteria 6247
297 Ga0207659_10018757 3300025926 Bacteria 4540
298 Ga0207659_10057571 3300025926 Bacteria 2787
299 Ga0207687_10027356 3300025927 Bacteria 3826
300 Ga0207687_10086483 3300025927 Bacteria 2276
301 Ga0207700_10046909 3300025928 Bacteria 3199
302 Ga0207644_10162562 3300025931 Bacteria 1736
303 Ga0207706_10043730 3300025933 Bacteria 3969
304 Ga0207706_10058604 3300025933 Bacteria 3392
305 Ga0207686_10013074 3300025934 Bacteria 4583
306 Ga0207686_10073565 3300025934 Bacteria 2205
307 Ga0207686_10077384 3300025934 Bacteria 2160
308 Ga0207709_10000076 3300025935 Bacteria 173292
309 Ga0207709_10012814 3300025935 Bacteria 4623
310 Ga0207709_10094648 3300025935 Bacteria 1961
311 Ga0207709_10536812 3300025935 Bacteria 918
312 Ga0207670_10232681 3300025936 Bacteria 1416
313 Ga0207670_10239309 3300025936 Bacteria 1398
314 Ga0207670_10348202 3300025936 Bacteria 1172
315 Ga0207670_10371853 3300025936 Bacteria 1136
316 Ga0207670_10535351 3300025936 Bacteria 955
317 Ga0207669_10019212 3300025937 Bacteria 3552
318 Ga0207704_10000959 3300025938 Bacteria 12771
319 Ga0207665_10002514 3300025939 Bacteria 12330
320 Ga0207665_10133396 3300025939 Bacteria 1765
321 Ga0207691_10010762 3300025940 Bacteria 8782
322 Ga0207691_10013009 3300025940 Bacteria 7968
323 Ga0207691_10182815 3300025940 Bacteria 1831
324 Ga0207691_10187331 3300025940 Bacteria 1806
325 Ga0207711_10014494 3300025941 Bacteria 6551
326 Ga0207711_10032992 3300025941 Bacteria 4379
327 Ga0207711_10044194 3300025941 Bacteria 3802
328 Ga0207689_10004853 3300025942 Bacteria 12116
329 Ga0207689_10066161 3300025942 Bacteria 2973
330 Ga0207689_10130471 3300025942 Bacteria 2068
331 Ga0207689_10305431 3300025942 Bacteria 1319
332 Ga0207679_10346775 3300025945 Bacteria 1293
333 Ga0207651_10055288 3300025960 Bacteria 2725
334 Ga0207651_10342988 3300025960 Bacteria 1255
335 Ga0207712_10011898 3300025961 Bacteria 5548
336 Ga0207712_10014058 3300025961 Bacteria 5138
337 Ga0207668_10178096 3300025972 Bacteria 1674
338 Ga0207668_10196102 3300025972 Bacteria 1604
339 Ga0207668_10387152 3300025972 Bacteria 1178
340 Ga0207640_10421571 3300025981 Bacteria 1092
341 Ga0207658_10003494 3300025986 Bacteria 11091
342 Ga0207658_10017863 3300025986 Bacteria 4888
343 Ga0207677_10024617 3300026023 Bacteria 3743
344 Ga0207677_10040343 3300026023 Bacteria 3077
345 Ga0207703_10001799 3300026035 Bacteria 19132
346 Ga0207703_10032151 3300026035 Bacteria 4152
347 Ga0207703_10136337 3300026035 Bacteria 2125
348 Ga0207678_10115574 3300026067 Bacteria 2289
349 Ga0207702_10012690 3300026078 Bacteria 7011
350 Ga0207641_10015255 3300026088 Bacteria 6295
351 Ga0207641_10020481 3300026088 Bacteria 5432
352 Ga0207641_10091584 3300026088 Bacteria 2661
353 Ga0207641_10269131 3300026088 Bacteria 1598
354 Ga0207648_10004422 3300026089 Bacteria 14428
355 Ga0207648_10004667 3300026089 Bacteria 14019
356 Ga0207648_10021486 3300026089 Bacteria 5801
357 Ga0207648_10079880 3300026089 Bacteria 2853
358 Ga0207648_10148602 3300026089 Bacteria 2067
359 Ga0207648_10277875 3300026089 Bacteria 1497
360 Ga0207676_10005019 3300026095 Bacteria 9371
361 Ga0207676_10052933 3300026095 Bacteria 3175
362 Ga0207676_10280300 3300026095 Bacteria 1513
363 Ga0207674_10071800 3300026116 Bacteria 3478
364 Ga0207675_100003929 3300026118 Bacteria 14428
365 Ga0207675_100007314 3300026118 Bacteria 10439
366 Ga0207675_100034843 3300026118 Bacteria 4695
367 Ga0207683_10007125 3300026121 Bacteria 9584
368 Ga0207683_10054461 3300026121 Bacteria 3508
369 Ga0207683_10087574 3300026121 Bacteria 2770
370 Ga0207683_10175359 3300026121 Bacteria 1943
371 Ga0207698_10013120 3300026142 Bacteria 5455
372 Ga0209969_1000217 3300027360 Bacteria 7674
373 Ga0209967_1000307 3300027364 Bacteria 6635
374 Ga0209981_1007810 3300027378 Bacteria 1447
375 Ga0209995_1002322 3300027471 Bacteria 3003
376 Ga0209995_1017851 3300027471 Bacteria 1168
377 Ga0209968_1001103 3300027526 Bacteria 4119
378 Ga0209999_1000946 3300027543 Bacteria 4895
379 Ga0209999_1021022 3300027543 Bacteria 1199
380 Ga0209588_1070903 3300027671 Bacteria 1126
381 Ga0209971_1016951 3300027682 Bacteria 1728
382 Ga0209966_1004350 3300027695 Bacteria 2401
383 Ga0209966_1040200 3300027695 Bacteria 973
384 Ga0209966_1041344 3300027695 Bacteria 962
385 Ga0207428_10006513 3300027907 Bacteria 10774
386 Ga0207428_10036411 3300027907 Bacteria 4014
387 Ga0207428_10062275 3300027907 Bacteria 2951
388 Ga0207428_10064629 3300027907 Bacteria 2888
389 Ga0207428_10130805 3300027907 Bacteria 1920
390 Ga0268266_10132081 3300028379 Bacteria 2234
391 Ga0268265_10003470 3300028380 Bacteria 11327
392 Ga0268265_10004016 3300028380 Bacteria 10360
393 Ga0268264_10009491 3300028381 Bacteria 8058
394 Ga0307515_10000014 3300028794 Bacteria 562358
395 Ga0265338_10342619 3300028800 Bacteria 1077
396 Ga0307408_100111218 3300031548 Bacteria 2104
397 Ga0307408_100158207 3300031548 Bacteria 1797
398 Ga0307408_100204454 3300031548 Bacteria 1601
399 Ga0307408_100604311 3300031548 Bacteria 975
400 Ga0316575_10004257 3300031665 Bacteria 5024
401 Ga0316575_10012111 3300031665 Bacteria 3202
402 Ga0316579_10005426 3300031691 Bacteria 5146
403 Ga0316578_10005156 3300031728 Bacteria 6297
404 Ga0307405_10003735 3300031731 Bacteria 7071
405 Ga0307405_10471017 3300031731 Bacteria 1000
406 Ga0307413_10026207 3300031824 Bacteria 3209
407 Ga0307413_10351451 3300031824 Bacteria 1138
408 Ga0307410_10014455 3300031852 Bacteria 4644
409 Ga0307406_10005448 3300031901 Bacteria 6964
410 Ga0307406_10060538 3300031901 Bacteria 2442
411 Ga0307407_10002451 3300031903 Bacteria 7268
412 Ga0307412_10009014 3300031911 Bacteria 5717
413 Ga0307412_10131568 3300031911 Bacteria 1818
414 Ga0307412_10475281 3300031911 Bacteria 1035
415 Ga0307409_100022174 3300031995 Bacteria 4371
416 Ga0307409_100060900 3300031995 Bacteria 2946
417 Ga0307416_100000708 3300032002 Bacteria 17322
418 Ga0307416_100001584 3300032002 Bacteria 12484
419 Ga0307416_100644672 3300032002 Bacteria 1143
420 Ga0307414_10031261 3300032004 Bacteria 3490
421 Ga0307414_10348942 3300032004 Bacteria 1269
422 Ga0307411_10002419 3300032005 Bacteria 8242
423 Ga0307411_10043524 3300032005 Bacteria 2873
424 Ga0307411_10058141 3300032005 Bacteria 2558
425 Ga0307411_10501255 3300032005 Bacteria 1026
426 Ga0307415_100000614 3300032126 Bacteria 15599
427 Ga0307415_100011692 3300032126 Bacteria 5038
428 Ga0316583_10039443 3300032133 Bacteria 1672
429 Ga0373958_0085622 3300034819 Bacteria 720
430 Ga0373926_0008656 3300035083 Bacteria 3386
431 Ga0373934_0014547 3300035086 Bacteria 2982
432 Ga0373940_0042687 3300035088 Bacteria 1251
433 Ga0373944_0011437 3300035089 Bacteria 2431
434 Ga0373923_0030765 3300035111 Bacteria 2161
435 Ga0373923_0099352 3300035111 Bacteria 1282
436 Ga0373936_0052583 3300035113 Bacteria 1650
437 Ga0373945_0025276 3300035116 Bacteria 2062
438 Ga0373953_0028534 3300035117 Bacteria 2153
439 Ga0373953_0058600 3300035117 Bacteria 1570
440 Ga0373953_0073036 3300035117 Bacteria 1417
441 Ga0373954_0000033 3300035118 Bacteria 54385
442 Ga0373954_0076756 3300035118 Bacteria 1593
443 Ga0373956_0037187 3300035119 Bacteria 2151
444 Ga0373960_0005406 3300035121 Bacteria 2958
445 Ga0373960_0088817 3300035121 Bacteria 985
446 Ga0373943_0029685 3300035170 Bacteria 2584
447 Ga0373943_0157809 3300035170 Bacteria 1233
448 Ga0373946_0005978 3300035171 Bacteria 4412
449 Ga0373955_0120682 3300035172 Bacteria 1524
450 Ga0373955_0137289 3300035172 Bacteria 1431
451 Ga0373955_0144799 3300035172 Bacteria 1395
452 Ga0373955_0152859 3300035172 Bacteria 1359
453 Ga0373962_0034885 3300035242 Bacteria 1395
454 Ga0316574_0006010 3300035398 Bacteria 6522
455 Ga0373924_0003359 3300035410 Bacteria 5498
456 Ga0373924_0196423 3300035410 Bacteria 889
457 Ga0373931_0037609 3300035691 Bacteria 2528
458 Ga0373935_0016858 3300035692 Bacteria 4423
459 Ga0373935_0323187 3300035692 Bacteria 1095
460 Ga0373927_0124659 3300035695 Bacteria 1681
461 Ga0373927_0266369 3300035695 Bacteria 1127
462 Ga0373933_0002353 3300035724 Bacteria 10700
463 Ga0373933_0006414 3300035724 Bacteria 6403
464 Ga0373933_0080313 3300035724 Bacteria 1999
465 Ga0373947_0005516 3300035725 Bacteria 7382
466 Ga0373947_0245236 3300035725 Bacteria 1183
467 Ga0373937_0000377 3300036401 Bacteria 41470
468 Ga0373937_0003134 3300036401 Bacteria 13831
469 Ga0373937_0028570 3300036401 Bacteria 5047
470 Ga0373937_0051673 3300036401 Bacteria 3767
471 Ga0373937_0055460 3300036401 Bacteria 3638
472 Ga0373937_0093825 3300036401 Bacteria 2783
473 Ga0373937_0481177 3300036401 Bacteria 1179
474 Ga0373937_0805311 3300036401 Bacteria 887
475 Ga0316582_0007634 3300036647 Bacteria 5768
476 Ga0373925_0150090 3300037068 Bacteria 1829
477 Ga0395899_0006613 3300037312 Bacteria 8984
478 Ga0395900_0036357 3300037418 Bacteria 5077
479 Ga0395900_0187454 3300037418 Bacteria 2099
480 Ga0395900_0347057 3300037418 Bacteria 1458
481 Ga0395898_0062414 3300037466 Bacteria 3618
482 Ga0395898_0138897 3300037466 Bacteria 2326
483 Ga0395905_0017834 3300037471 Bacteria 6744
484 Ga0316581_0010467 3300037588 Bacteria 2572
485 Ga0395901_0028082 3300038443 Bacteria 5788
486 Ga0395901_0274049 3300038443 Bacteria 1754
487 Ga0395901_0295082 3300038443 Bacteria 1681
488 Ga0436365_0852937 3300039437 Bacteria 998
489 Ga0439436_0060856 3300041404 Bacteria 1057
490 Ga0439453_0003181 3300041408 Bacteria 2338
491 Ga0439466_0036387 3300041411 Bacteria 1662
492 Ga0439465_0052638 3300041413 Bacteria 1336
493 Ga0439433_0007425 3300041999 Bacteria 2367
494 Ga0439437_003681 3300042000 Bacteria 1657
495 Ga0439441_021612 3300042001 Bacteria 1189
496 Ga0439442_015691 3300042002 Bacteria 1561
497 Ga0439432_020405 3300042006 Bacteria 2203
498 Ga0439450_004026 3300042008 Bacteria 2480
499 Ga0439452_009876 3300042010 Bacteria 2798
500 Ga0450911_000599 3300042115 Bacteria 10973
501 Ga0450921_000584 3300042123 Bacteria 1809
502 Ga0450923_001005 3300042125 Bacteria 3516
503 Ga0450897_002588 3300042128 Bacteria 1374
504 Ga0450892_005129 3300042130 Bacteria 1075
505 Ga0450894_005256 3300042131 Bacteria 1676
506 Ga0450907_018092 3300042146 Bacteria 1177
507 Ga0439458_0012922 3300042157 Bacteria 1877
508 Ga0450909_006969 3300042185 Bacteria 1631
509 Ga0439434_0002341 3300042435 Bacteria 5514
510 Ga0439435_0023098 3300042436 Bacteria 1629
511 Ga0439444_0003193 3300042437 Bacteria 2302
512 Ga0439464_0002254 3300042439 Bacteria 4719
513 Ga0439464_0019192 3300042439 Bacteria 1865
514 Ga0439464_0101343 3300042439 Bacteria 875
515 Ga0439460_0019517 3300042461 Bacteria 1837
516 Ga0439460_0027746 3300042461 Bacteria 1592
517 Ga0450893_0016014 3300042532 Bacteria 1267
518 Ga0451577_0479843 3300042876 Bacteria 1129
519 Ga0453683_0172369 3300044673 Bacteria 1371
520 Ga0453684_0140881 3300044712 Bacteria 2880
521 Ga0466957_0189904 3300044842 Bacteria 1345
522 Ga0466957_0432766 3300044842 Bacteria 904
523 Ga0451576_0006891 3300045051 Bacteria 13760
524 Ga0451576_0031204 3300045051 Bacteria 5685
525 Ga0451576_0183272 3300045051 Bacteria 2186
526 Ga0451576_0455958 3300045051 Bacteria 1342
527 Ga0451576_0476451 3300045051 Bacteria 1311
528 Ga0451576_0830180 3300045051 Bacteria 970
529 Ga0451576_1014595 3300045051 Bacteria 870
530 Ga0466958_0328617 3300045836 Bacteria 983
531 Ga0466967_0079451 3300045976 Bacteria 2957
532 Ga0495592_0001640 3300046454 Bacteria 15673
533 Ga0495592_0193777 3300046454 Bacteria 1376
534 Ga0495603_0083299 3300046455 Bacteria 1873
535 Ga0495603_0110883 3300046455 Bacteria 1601
536 Ga0495580_0090652 3300046472 Bacteria 2128
537 Ga0495639_0009324 3300046475 Bacteria 4209
538 Ga0495662_0006212 3300046476 Bacteria 5973
539 Ga0495608_0001201 3300046511 Bacteria 18376
540 Ga0495618_0186598 3300046514 Bacteria 1316
541 Ga0495628_0016307 3300046516 Bacteria 6198
542 Ga0495630_0006364 3300046517 Bacteria 8393
543 Ga0495630_0009974 3300046517 Bacteria 6839
544 Ga0495644_0111715 3300046523 Bacteria 1037
545 Ga0495663_0034868 3300046525 Bacteria 1509
546 Ga0495666_0008813 3300046526 Bacteria 5053
547 Ga0495642_0038531 3300046528 Bacteria 1937
548 Ga0495652_0114824 3300046529 Bacteria 2159
549 Ga0495652_0254727 3300046529 Bacteria 1299
550 Ga0495640_0074165 3300046533 Bacteria 2276
551 Ga0495586_0001023 3300046535 Bacteria 15804
552 Ga0495586_0001380 3300046535 Bacteria 13472
553 Ga0495587_0078496 3300046536 Bacteria 1915
554 Ga0495598_0019864 3300046537 Bacteria 1767
555 Ga0495598_0024753 3300046537 Bacteria 1630
556 Ga0495598_0124827 3300046537 Bacteria 876
557 Ga0495621_0004599 3300046539 Bacteria 3897
558 Ga0495621_0032660 3300046539 Bacteria 1791
559 Ga0495621_0035209 3300046539 Bacteria 1733
560 Ga0495667_0001209 3300046559 Bacteria 16884
561 Ga0495656_0033821 3300046615 Bacteria 2089
562 Ga0495656_0121859 3300046615 Bacteria 1232
563 Ga0495634_0009948 3300046642 Bacteria 6989
564 Ga0495588_0051627 3300046674 Bacteria 2118
565 Ga0495657_0074663 3300046675 Bacteria 2206
566 Ga0495599_0016727 3300046678 Bacteria 4555
567 Ga0495599_0120644 3300046678 Bacteria 1630
568 Ga0495647_0002083 3300046681 Bacteria 6257
569 Ga0495658_0007232 3300046683 Bacteria 5486
570 Ga0495658_0197666 3300046683 Bacteria 1252
571 Ga0495669_0080760 3300046684 Bacteria 1492
572 Ga0495613_0001053 3300046689 Bacteria 21060
573 Ga0495581_0309169 3300047315 Bacteria 924
574 Ga0495604_0000790 3300047317 Bacteria 26619
575 Ga0495604_0357683 3300047317 Bacteria 969
576 Ga0495674_0390948 3300047319 Bacteria 1124
577 Ga0495676_0177652 3300047321 Bacteria 1494
578 Ga0495680_0005704 3300047322 Bacteria 11655
579 Ga0495680_0076220 3300047322 Bacteria 2543
580 Ga0495680_0183593 3300047322 Bacteria 1508
581 Ga0495677_0038047 3300047445 Bacteria 1758
582 Ga0495684_0297168 3300047471 Bacteria 1161
583 Ga0495602_0025774 3300048088 Bacteria 5685
584 Ga0495602_0162955 3300048088 Bacteria 1739
585 Ga0496101_0234287 3300048904 Bacteria 1428
586 Ga0496102_0308054 3300048905 Bacteria 1492
587 Ga0496103_0131709 3300048906 Bacteria 1597
588 Ga0496104_0003573 3300048907 Bacteria 13420
589 Ga0496104_0009110 3300048907 Bacteria 8827
590 Ga0496104_0087772 3300048907 Bacteria 2971
591 Ga0496104_0784792 3300048907 Bacteria 859
592 Ga0496105_0045498 3300048908 Bacteria 3621
593 Ga0496105_0051490 3300048908 Bacteria 3402
594 Ga0496105_0364248 3300048908 Bacteria 1153
595 Ga0496106_0020051 3300048909 Bacteria 4959
596 Ga0496108_0229768 3300048911 Bacteria 1613
597 Ga0496108_0521588 3300048911 Bacteria 1037
598 Ga0496109_0059341 3300048912 Bacteria 3495
599 Ga0496109_0113962 3300048912 Bacteria 2515
600 Ga0496109_0151931 3300048912 Bacteria 2168
601 Ga0496110_0121428 3300048913 Bacteria 2354
602 Ga0496110_0124275 3300048913 Bacteria 2327
603 Ga0496111_0116578 3300048914 Bacteria 1970
604 Ga0496111_0180781 3300048914 Bacteria 1568
605 Ga0496111_0490910 3300048914 Bacteria 904
606 Ga0496111_0575958 3300048914 Bacteria 825
607 Ga0496112_0005345 3300048915 Bacteria 11087
608 Ga0496112_0222715 3300048915 Bacteria 1842
609 Ga0496113_0159342 3300048916 Bacteria 1784
610 Ga0496114_0170559 3300048917 Bacteria 1896
611 Ga0496114_0194934 3300048917 Bacteria 1773
612 Ga0496115_0173042 3300048918 Bacteria 1785
613 Ga0496121_0002968 3300048924 Bacteria 24705
614 Ga0496125_0026075 3300048928 Bacteria 5337
615 Ga0501294_004268 3300049517 Bacteria 1346
616 Ga0501299_026584 3300049522 Bacteria 1094
617 Ga0501040_0297910 3300049576 Bacteria 1153
618 Ga0501041_0289415 3300049577 Bacteria 1032
619 Ga0501047_0024991 3300049581 Bacteria 5738
620 Ga0501047_0236845 3300049581 Bacteria 1677
621 Ga0501047_0271401 3300049581 Bacteria 1542
622 Ga0501067_0041320 3300049583 Bacteria 2561
623 Ga0501068_0211803 3300049584 Bacteria 1231
624 Ga0501071_0000638 3300049587 Bacteria 18217
625 Ga0501071_0324506 3300049587 Bacteria 1169
626 Ga0501072_0363138 3300049588 Bacteria 1149
627 Ga0501073_0337639 3300049589 Bacteria 1040
628 Ga0501073_0410484 3300049589 Bacteria 936
629 Ga0501074_0265147 3300049590 Bacteria 1221
630 Ga0501075_0051262 3300049591 Bacteria 3103
631 Ga0501077_0487755 3300049593 Bacteria 790
632 Ga0501257_019873 3300049686 Bacteria 1573
633 Ga0501079_0040802 3300049741 Bacteria 3582
634 Ga0501080_0175196 3300049742 Bacteria 1976
635 Ga0501080_0768348 3300049742 Bacteria 846
636 Ga0501083_0020742 3300049744 Bacteria 4568
637 Ga0501279_024390 3300049775 Bacteria 875
638 Ga0501045_0326131 3300049824 Bacteria 1142
639 nmdc:mga03683_116490_c1 3300050489 Bacteria 1185
640 nmdc:mga03683_1540_c1 3300050489 Bacteria 6871
641 nmdc:mga03n38_6527_c1 3300050490 Bacteria 4061
642 nmdc:mga00v17_9302_c1 3300050491 Bacteria 5314
643 nmdc:mga0yw44_1966_c1 3300050492 Bacteria 8521
644 nmdc:mga0k408_33541_c1 3300050493 Bacteria 2937
645 nmdc:mga04h51_29931_c1 3300050495 Bacteria 1710
646 nmdc:mga07m45_33632_c1 3300050496 Bacteria 2848
647 nmdc:mga05p37_215_c1 3300050507 Bacteria 57982
648 nmdc:mga05p37_21838_c1 3300050507 Bacteria 7754
649 nmdc:mga05p37_728014_c1 3300050507 Bacteria 1097
650 nmdc:mga05p37_980_c1 3300050507 Bacteria 32442
651 nmdc:mga09592_136871_c1 3300050508 Bacteria 2110
652 nmdc:mga09592_230500_c1 3300050508 Bacteria 1605
653 nmdc:mga09592_947_c1 3300050508 Bacteria 22820
654 nmdc:mga0qj67_3084_c1 3300050509 Bacteria 11977
655 nmdc:mga0qj67_705_c1 3300050509 Bacteria 22775
656 nmdc:mga0qj67_8082_c1 3300050509 Bacteria 7787
657 nmdc:mga0qj67_950382_c1 3300050509 Bacteria 676
658 nmdc:mga06r32_133398_c1 3300050510 Bacteria 2457
659 nmdc:mga06r32_2106_c1 3300050510 Bacteria 17820
660 nmdc:mga06r32_277909_c1 3300050510 Bacteria 1662
661 nmdc:mga06r32_637_c1 3300050510 Bacteria 30492
662 nmdc:mga06r32_85802_c1 3300050510 Bacteria 3070
663 nmdc:mga08y16_176_c1 3300050511 Bacteria 56313
664 nmdc:mga08y16_186917_c1 3300050511 Bacteria 2150
665 nmdc:mga08y16_36382_c1 3300050511 Bacteria 5170
666 nmdc:mga08y16_71819_c1 3300050511 Bacteria 3607
667 nmdc:mga0n895_51200_c1 3300050512 Bacteria 4051
668 nmdc:mga0n895_881820_c1 3300050512 Bacteria 881
669 nmdc:mga0n895_90796_c1 3300050512 Bacteria 3057
670 nmdc:mga0rr50_265655_c1 3300050513 Bacteria 1429
671 nmdc:mga0rr50_26750_c1 3300050513 Bacteria 4031
672 nmdc:mga0rr50_38273_c1 3300050513 Bacteria 3469
673 nmdc:mga0rr50_561902_c1 3300050513 Bacteria 972
674 nmdc:mga08x19_13653_c1 3300050514 Bacteria 4914
675 nmdc:mga08x19_15018_c1 3300050514 Bacteria 4703
676 nmdc:mga08x19_2618_c1 3300050514 Bacteria 10913
677 nmdc:mga08x19_30171_c1 3300050514 Bacteria 3405
678 nmdc:mga08x19_343420_c1 3300050514 Bacteria 1041
679 nmdc:mga08x19_4783_c1 3300050514 Bacteria 8027
680 nmdc:mga0a205_253999_c1 3300050515 Bacteria 1637
681 nmdc:mga0a205_27029_c1 3300050515 Bacteria 5478
682 nmdc:mga0a205_302074_c1 3300050515 Bacteria 1473
683 nmdc:mga0a205_307022_c1 3300050515 Bacteria 1459
684 Ga0495601_0008645 3300053077 Bacteria 6010
685 Ga0495601_0026917 3300053077 Bacteria 3554
686 Ga0495612_0210761 3300053078 Bacteria 859
687 Ga0495655_0018690 3300053083 Bacteria 1528
688 Ga0495619_0021394 3300053085 Bacteria 4129
689 Ga0495619_0232637 3300053085 Bacteria 1277
690 Ga0500637_0308513 3300053178 Bacteria 860
691 Ga0501084_0090115 3300054114 Bacteria 2574
692 Ga0590077_011627 3300059426 Bacteria 1818
693 Ga0501082_0202239 3300060353 Bacteria 1728

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10493148 Ga0207705_104931482 197
2 3300047317 Ga0495604_0357683 Ga0495604_0357683_180_824 214
3 3300031548 Ga0307408_100604311 Ga0307408_1006043112 215
4 3300035172 Ga0373955_0120682 Ga0373955_0120682_23_670 215
5 3300049824 Ga0501045_0326131 Ga0501045_0326131_22_669 215
6 3300050509 nmdc:mga0qj67_950382_c1 nmdc:mga0qj67_950382_c1_18_665 215
7 3300042439 Ga0439464_0101343 Ga0439464_0101343_198_854 218
8 3300007076 Ga0075435_100265669 Ga0075435_1002656692 219
9 3300045051 Ga0451576_1014595 Ga0451576_1014595_20_679 219
10 3300049587 Ga0501071_0324506 Ga0501071_0324506_19_678 219
11 3300049742 Ga0501080_0768348 Ga0501080_0768348_173_832 219
12 3300050507 nmdc:mga05p37_728014_c1 nmdc:mga05p37_728014_c1_224_883 219
13 3300050513 nmdc:mga0rr50_561902_c1 nmdc:mga0rr50_561902_c1_252_911 219
14 3300034819 Ga0373958_0085622 Ga0373958_0085622_23_685 220
15 3300025885 Ga0207653_10060416 Ga0207653_100604162 221
16 3300042876 Ga0451577_0479843 Ga0451577_0479843_223_930 222
17 3300027364 Ga0209967_1000307 Ga0209967_10003076 223
18 3300027378 Ga0209981_1007810 Ga0209981_10078102 223
19 3300027471 Ga0209995_1002322 Ga0209995_10023223 223
20 3300027526 Ga0209968_1001103 Ga0209968_10011032 223
21 3300027543 Ga0209999_1000946 Ga0209999_10009463 223
22 3300005440 Ga0070705_100003022 Ga0070705_1000030229 228
23 3300005440 Ga0070705_100127233 Ga0070705_1001272332 228
24 3300005518 Ga0070699_100056960 Ga0070699_1000569602 228
25 3300005536 Ga0070697_100005701 Ga0070697_10000570110 228
26 3300005546 Ga0070696_100009913 Ga0070696_1000099134 228
27 3300006871 Ga0075434_100031833 Ga0075434_1000318333 228
28 3300025922 Ga0207646_10401941 Ga0207646_104019412 228
29 3300035691 Ga0373931_0037609 Ga0373931_0037609_1767_2453 228
30 3300050512 nmdc:mga0n895_51200_c1 nmdc:mga0n895_51200_c1_1385_2071 228
31 3300050513 nmdc:mga0rr50_265655_c1 nmdc:mga0rr50_265655_c1_651_1337 228
32 3300050514 nmdc:mga08x19_15018_c1 nmdc:mga08x19_15018_c1_2334_3020 228
33 3300050515 nmdc:mga0a205_27029_c1 nmdc:mga0a205_27029_c1_1808_2494 228
34 3300044842 Ga0466957_0189904 Ga0466957_0189904_212_907 231
35 3300045836 Ga0466958_0328617 Ga0466958_0328617_209_904 231
36 3300045976 Ga0466967_0079451 Ga0466967_0079451_1344_2039 231
37 3300049775 Ga0501279_024390 Ga0501279_024390_19_714 231
38 3300006871 Ga0075434_100171243 Ga0075434_1001712433 234
39 3300007076 Ga0075435_100037184 Ga0075435_1000371843 234
40 iso_pu_bacteria 2643221628 2644159759 234
41 iso_pu_bacteria 2917699015 2917701096 234
42 iso_pu_bacteria 2919704043 2919707893 234
43 3300005355 Ga0070671_100010559 Ga0070671_1000105597 235
44 3300005458 Ga0070681_10012298 Ga0070681_1001229810 235
45 3300005518 Ga0070699_100436424 Ga0070699_1004364241 235
46 3300005530 Ga0070679_100056283 Ga0070679_1000562834 235
47 3300005536 Ga0070697_100004865 Ga0070697_1000048654 235
48 3300005549 Ga0070704_100428010 Ga0070704_1004280101 235
49 3300006852 Ga0075433_10208504 Ga0075433_102085042 235
50 3300006871 Ga0075434_100000132 Ga0075434_1000001327 235
51 3300006871 Ga0075434_100138712 Ga0075434_1001387122 235
52 3300006871 Ga0075434_100973233 Ga0075434_1009732331 235
53 3300007076 Ga0075435_100001341 Ga0075435_1000013414 235
54 3300007076 Ga0075435_100006450 Ga0075435_1000064506 235
55 3300014326 Ga0157380_10252527 Ga0157380_102525273 235
56 3300025903 Ga0207680_10128354 Ga0207680_101283541 235
57 3300025910 Ga0207684_10098185 Ga0207684_100981853 235
58 3300025912 Ga0207707_10007969 Ga0207707_1000796911 235
59 3300025912 Ga0207707_10262326 Ga0207707_102623262 235
60 3300025915 Ga0207693_10099002 Ga0207693_100990022 235
61 3300025917 Ga0207660_10037119 Ga0207660_100371193 235
62 3300025917 Ga0207660_10463210 Ga0207660_104632102 235
63 3300025939 Ga0207665_10133396 Ga0207665_101333962 235
64 3300027671 Ga0209588_1070903 Ga0209588_10709032 235
65 3300031824 Ga0307413_10351451 Ga0307413_103514512 235
66 3300032005 Ga0307411_10058141 Ga0307411_100581413 235
67 3300035083 Ga0373926_0008656 Ga0373926_0008656_2660_3367 235
68 3300035086 Ga0373934_0014547 Ga0373934_0014547_1795_2502 235
69 3300035089 Ga0373944_0011437 Ga0373944_0011437_1284_1991 235
70 3300035111 Ga0373923_0030765 Ga0373923_0030765_447_1154 235
71 3300035113 Ga0373936_0052583 Ga0373936_0052583_774_1481 235
72 3300035116 Ga0373945_0025276 Ga0373945_0025276_780_1487 235
73 3300035117 Ga0373953_0028534 Ga0373953_0028534_759_1466 235
74 3300035118 Ga0373954_0000033 Ga0373954_0000033_27878_28585 235
75 3300035121 Ga0373960_0005406 Ga0373960_0005406_619_1326 235
76 3300035171 Ga0373946_0005978 Ga0373946_0005978_2146_2853 235
77 3300035242 Ga0373962_0034885 Ga0373962_0034885_188_895 235
78 3300035410 Ga0373924_0003359 Ga0373924_0003359_2688_3395 235
79 3300035410 Ga0373924_0196423 Ga0373924_0196423_40_747 235
80 3300035695 Ga0373927_0124659 Ga0373927_0124659_194_901 235
81 3300035724 Ga0373933_0002353 Ga0373933_0002353_3782_4489 235
82 3300035724 Ga0373933_0006414 Ga0373933_0006414_1234_1941 235
83 3300035725 Ga0373947_0005516 Ga0373947_0005516_6273_6980 235
84 3300035725 Ga0373947_0245236 Ga0373947_0245236_187_894 235
85 3300036401 Ga0373937_0000377 Ga0373937_0000377_31239_31946 235
86 3300036401 Ga0373937_0093825 Ga0373937_0093825_891_1598 235
87 3300046454 Ga0495592_0193777 Ga0495592_0193777_38_745 235
88 3300046455 Ga0495603_0083299 Ga0495603_0083299_447_1154 235
89 3300046472 Ga0495580_0090652 Ga0495580_0090652_955_1662 235
90 3300046475 Ga0495639_0009324 Ga0495639_0009324_1741_2448 235
91 3300046535 Ga0495586_0001380 Ga0495586_0001380_95_802 235
92 3300046674 Ga0495588_0051627 Ga0495588_0051627_558_1265 235
93 3300046675 Ga0495657_0074663 Ga0495657_0074663_1105_1812 235
94 3300046678 Ga0495599_0120644 Ga0495599_0120644_378_1085 235
95 3300046681 Ga0495647_0002083 Ga0495647_0002083_2355_3062 235
96 3300046683 Ga0495658_0197666 Ga0495658_0197666_111_818 235
97 3300047321 Ga0495676_0177652 Ga0495676_0177652_35_742 235
98 3300047322 Ga0495680_0076220 Ga0495680_0076220_1607_2314 235
99 3300047471 Ga0495684_0297168 Ga0495684_0297168_46_753 235
100 3300048088 Ga0495602_0162955 Ga0495602_0162955_280_987 235
101 3300050512 nmdc:mga0n895_881820_c1 nmdc:mga0n895_881820_c1_124_831 235
102 3300050512 nmdc:mga0n895_90796_c1 nmdc:mga0n895_90796_c1_351_1058 235
103 3300050513 nmdc:mga0rr50_26750_c1 nmdc:mga0rr50_26750_c1_2249_2956 235
104 3300050515 nmdc:mga0a205_253999_c1 nmdc:mga0a205_253999_c1_612_1319 235
105 3300050515 nmdc:mga0a205_307022_c1 nmdc:mga0a205_307022_c1_394_1101 235
106 3300053078 Ga0495612_0210761 Ga0495612_0210761_37_744 235
107 iso_pu_bacteria 2513020051 2513229602 235
108 iso_pu_bacteria 2643221683 2644466704 235
109 3300005295 Ga0065707_10012400 Ga0065707_100124002 236
110 3300005295 Ga0065707_10188918 Ga0065707_101889182 236
111 3300005331 Ga0070670_100205419 Ga0070670_1002054193 236
112 3300005334 Ga0068869_100019219 Ga0068869_1000192195 236
113 3300005336 Ga0070680_100019081 Ga0070680_1000190815 236
114 3300005336 Ga0070680_100055735 Ga0070680_1000557353 236
115 3300005340 Ga0070689_100066434 Ga0070689_1000664343 236
116 3300005343 Ga0070687_100079559 Ga0070687_1000795592 236
117 3300005345 Ga0070692_10019347 Ga0070692_100193473 236
118 3300005345 Ga0070692_10029742 Ga0070692_100297423 236
119 3300005345 Ga0070692_10235958 Ga0070692_102359581 236
120 3300005347 Ga0070668_100144256 Ga0070668_1001442562 236
121 3300005353 Ga0070669_100091953 Ga0070669_1000919532 236
122 3300005354 Ga0070675_100313930 Ga0070675_1003139302 236
123 3300005440 Ga0070705_100237547 Ga0070705_1002375472 236
124 3300005441 Ga0070700_100003507 Ga0070700_1000035079 236
125 3300005441 Ga0070700_100387100 Ga0070700_1003871002 236
126 3300005444 Ga0070694_100005593 Ga0070694_1000055934 236
127 3300005444 Ga0070694_100092879 Ga0070694_1000928792 236
128 3300005444 Ga0070694_100126096 Ga0070694_1001260962 236
129 3300005444 Ga0070694_100193556 Ga0070694_1001935562 236
130 3300005459 Ga0068867_100001086 Ga0068867_1000010864 236
131 3300005471 Ga0070698_100014017 Ga0070698_1000140173 236
132 3300005539 Ga0068853_100885611 Ga0068853_1008856112 236
133 3300005544 Ga0070686_100012900 Ga0070686_1000129001 236
134 3300005545 Ga0070695_100087420 Ga0070695_1000874203 236
135 3300005546 Ga0070696_100028084 Ga0070696_1000280843 236
136 3300005546 Ga0070696_100055717 Ga0070696_1000557173 236
137 3300005546 Ga0070696_100069516 Ga0070696_1000695162 236
138 3300005546 Ga0070696_100520855 Ga0070696_1005208552 236
139 3300005549 Ga0070704_100002583 Ga0070704_1000025839 236
140 3300005549 Ga0070704_100009156 Ga0070704_1000091561 236
141 3300005549 Ga0070704_100109550 Ga0070704_1001095502 236
142 3300005577 Ga0068857_100229490 Ga0068857_1002294902 236
143 3300005615 Ga0070702_100025696 Ga0070702_1000256961 236
144 3300005615 Ga0070702_100166575 Ga0070702_1001665752 236
145 3300005617 Ga0068859_100007812 Ga0068859_1000078123 236
146 3300005617 Ga0068859_100636880 Ga0068859_1006368802 236
147 3300005618 Ga0068864_100333926 Ga0068864_1003339262 236
148 3300005719 Ga0068861_100027677 Ga0068861_1000276773 236
149 3300005840 Ga0068870_10068810 Ga0068870_100688102 236
150 3300005841 Ga0068863_100762482 Ga0068863_1007624822 236
151 3300005844 Ga0068862_100223531 Ga0068862_1002235312 236
152 3300005844 Ga0068862_100654684 Ga0068862_1006546842 236
153 3300006844 Ga0075428_100061243 Ga0075428_1000612433 236
154 3300006844 Ga0075428_100426217 Ga0075428_1004262172 236
155 3300006846 Ga0075430_100000520 Ga0075430_10000052031 236
156 3300006846 Ga0075430_100100659 Ga0075430_1001006593 236
157 3300006847 Ga0075431_100009047 Ga0075431_1000090472 236
158 3300006847 Ga0075431_100021141 Ga0075431_1000211414 236
159 3300006852 Ga0075433_10153428 Ga0075433_101534282 236
160 3300006852 Ga0075433_10386854 Ga0075433_103868542 236
161 3300006880 Ga0075429_100000638 Ga0075429_10000063819 236
162 3300006880 Ga0075429_100135451 Ga0075429_1001354513 236
163 3300006880 Ga0075429_100141972 Ga0075429_1001419723 236
164 3300006880 Ga0075429_100646000 Ga0075429_1006460002 236
165 3300006881 Ga0068865_100023360 Ga0068865_1000233605 236
166 3300006914 Ga0075436_100015380 Ga0075436_1000153803 236
167 3300006914 Ga0075436_100061090 Ga0075436_1000610902 236
168 3300006931 Ga0097620_100007812 Ga0097620_1000078123 236
169 3300006931 Ga0097620_100636870 Ga0097620_1006368702 236
170 3300007076 Ga0075435_100416511 Ga0075435_1004165112 236
171 3300007265 Ga0099794_10047137 Ga0099794_100471372 236
172 3300009094 Ga0111539_10085259 Ga0111539_100852592 236
173 3300009094 Ga0111539_11037895 Ga0111539_110378952 236
174 3300009098 Ga0105245_10051495 Ga0105245_100514952 236
175 3300009147 Ga0114129_10007443 Ga0114129_100074439 236
176 3300009147 Ga0114129_10015516 Ga0114129_100155164 236
177 3300009147 Ga0114129_10331229 Ga0114129_103312292 236
178 3300009148 Ga0105243_10915615 Ga0105243_109156152 236
179 3300009176 Ga0105242_10002945 Ga0105242_1000294515 236
180 3300009553 Ga0105249_10102811 Ga0105249_101028112 236
181 3300010159 Ga0099796_10064994 Ga0099796_100649941 236
182 3300014326 Ga0157380_10092441 Ga0157380_100924412 236
183 3300014745 Ga0157377_10051344 Ga0157377_100513442 236
184 3300025917 Ga0207660_10064740 Ga0207660_100647402 236
185 3300025918 Ga0207662_10073492 Ga0207662_100734922 236
186 3300025918 Ga0207662_10111522 Ga0207662_101115222 236
187 3300025923 Ga0207681_10070992 Ga0207681_100709922 236
188 3300025926 Ga0207659_10018757 Ga0207659_100187573 236
189 3300025927 Ga0207687_10086483 Ga0207687_100864833 236
190 3300025934 Ga0207686_10013074 Ga0207686_100130742 236
191 3300025935 Ga0207709_10094648 Ga0207709_100946483 236
192 3300025935 Ga0207709_10536812 Ga0207709_105368121 236
193 3300025936 Ga0207670_10535351 Ga0207670_105353512 236
194 3300025938 Ga0207704_10000959 Ga0207704_1000095912 236
195 3300025939 Ga0207665_10002514 Ga0207665_100025149 236
196 3300025940 Ga0207691_10187331 Ga0207691_101873312 236
197 3300025942 Ga0207689_10066161 Ga0207689_100661612 236
198 3300025942 Ga0207689_10305431 Ga0207689_103054312 236
199 3300025961 Ga0207712_10014058 Ga0207712_100140584 236
200 3300025972 Ga0207668_10178096 Ga0207668_101780962 236
201 3300025981 Ga0207640_10421571 Ga0207640_104215712 236
202 3300026088 Ga0207641_10269131 Ga0207641_102691312 236
203 3300026089 Ga0207648_10004422 Ga0207648_100044224 236
204 3300026095 Ga0207676_10280300 Ga0207676_102803002 236
205 3300026116 Ga0207674_10071800 Ga0207674_100718002 236
206 3300026118 Ga0207675_100003929 Ga0207675_1000039294 236
207 3300027360 Ga0209969_1000217 Ga0209969_10002172 236
208 3300027471 Ga0209995_1017851 Ga0209995_10178512 236
209 3300027543 Ga0209999_1021022 Ga0209999_10210222 236
210 3300027682 Ga0209971_1016951 Ga0209971_10169512 236
211 3300027695 Ga0209966_1040200 Ga0209966_10402002 236
212 3300027695 Ga0209966_1041344 Ga0209966_10413442 236
213 3300027907 Ga0207428_10036411 Ga0207428_100364115 236
214 3300027907 Ga0207428_10062275 Ga0207428_100622751 236
215 3300027907 Ga0207428_10064629 Ga0207428_100646292 236
216 3300028380 Ga0268265_10003470 Ga0268265_1000347012 236
217 3300031548 Ga0307408_100158207 Ga0307408_1001582072 236
218 3300031665 Ga0316575_10004257 Ga0316575_100042573 236
219 3300031665 Ga0316575_10012111 Ga0316575_100121113 236
220 3300031691 Ga0316579_10005426 Ga0316579_100054262 236
221 3300031728 Ga0316578_10005156 Ga0316578_100051565 236
222 3300032133 Ga0316583_10039443 Ga0316583_100394432 236
223 3300035088 Ga0373940_0042687 Ga0373940_0042687_198_908 236
224 3300035117 Ga0373953_0058600 Ga0373953_0058600_612_1322 236
225 3300035170 Ga0373943_0157809 Ga0373943_0157809_143_853 236
226 3300035172 Ga0373955_0137289 Ga0373955_0137289_621_1331 236
227 3300035172 Ga0373955_0152859 Ga0373955_0152859_159_869 236
228 3300035398 Ga0316574_0006010 Ga0316574_0006010_5584_6294 236
229 3300035692 Ga0373935_0016858 Ga0373935_0016858_1837_2547 236
230 3300036401 Ga0373937_0028570 Ga0373937_0028570_4034_4744 236
231 3300036401 Ga0373937_0051673 Ga0373937_0051673_180_890 236
232 3300036401 Ga0373937_0481177 Ga0373937_0481177_295_1005 236
233 3300036647 Ga0316582_0007634 Ga0316582_0007634_4936_5646 236
234 3300037068 Ga0373925_0150090 Ga0373925_0150090_97_807 236
235 3300037588 Ga0316581_0010467 Ga0316581_0010467_1800_2510 236
236 3300041408 Ga0439453_0003181 Ga0439453_0003181_759_1469 236
237 3300042001 Ga0439441_021612 Ga0439441_021612_349_1059 236
238 3300042436 Ga0439435_0023098 Ga0439435_0023098_578_1288 236
239 3300042437 Ga0439444_0003193 Ga0439444_0003193_685_1395 236
240 3300045051 Ga0451576_0006891 Ga0451576_0006891_2510_3220 236
241 3300045051 Ga0451576_0455958 Ga0451576_0455958_259_969 236
242 3300045051 Ga0451576_0830180 Ga0451576_0830180_185_895 236
243 3300046454 Ga0495592_0001640 Ga0495592_0001640_8121_8831 236
244 3300046476 Ga0495662_0006212 Ga0495662_0006212_1839_2549 236
245 3300046511 Ga0495608_0001201 Ga0495608_0001201_2371_3081 236
246 3300046514 Ga0495618_0186598 Ga0495618_0186598_471_1181 236
247 3300046516 Ga0495628_0016307 Ga0495628_0016307_1386_2096 236
248 3300046517 Ga0495630_0006364 Ga0495630_0006364_4415_5125 236
249 3300046517 Ga0495630_0009974 Ga0495630_0009974_2916_3626 236
250 3300046525 Ga0495663_0034868 Ga0495663_0034868_163_873 236
251 3300046526 Ga0495666_0008813 Ga0495666_0008813_2325_3035 236
252 3300046529 Ga0495652_0114824 Ga0495652_0114824_361_1071 236
253 3300046533 Ga0495640_0074165 Ga0495640_0074165_892_1602 236
254 3300046535 Ga0495586_0001023 Ga0495586_0001023_5413_6123 236
255 3300046536 Ga0495587_0078496 Ga0495587_0078496_504_1214 236
256 3300046537 Ga0495598_0024753 Ga0495598_0024753_174_884 236
257 3300046539 Ga0495621_0035209 Ga0495621_0035209_213_923 236
258 3300046559 Ga0495667_0001209 Ga0495667_0001209_3896_4606 236
259 3300046642 Ga0495634_0009948 Ga0495634_0009948_3395_4105 236
260 3300046678 Ga0495599_0016727 Ga0495599_0016727_753_1463 236
261 3300046683 Ga0495658_0007232 Ga0495658_0007232_1666_2376 236
262 3300046684 Ga0495669_0080760 Ga0495669_0080760_618_1328 236
263 3300046689 Ga0495613_0001053 Ga0495613_0001053_18490_19200 236
264 3300047317 Ga0495604_0000790 Ga0495604_0000790_16080_16790 236
265 3300047322 Ga0495680_0005704 Ga0495680_0005704_6843_7553 236
266 3300047322 Ga0495680_0183593 Ga0495680_0183593_183_893 236
267 3300047445 Ga0495677_0038047 Ga0495677_0038047_910_1620 236
268 3300049522 Ga0501299_026584 Ga0501299_026584_183_893 236
269 3300049577 Ga0501041_0289415 Ga0501041_0289415_194_904 236
270 3300049583 Ga0501067_0041320 Ga0501067_0041320_293_1003 236
271 3300049584 Ga0501068_0211803 Ga0501068_0211803_365_1075 236
272 3300049588 Ga0501072_0363138 Ga0501072_0363138_54_764 236
273 3300049589 Ga0501073_0410484 Ga0501073_0410484_181_891 236
274 3300049590 Ga0501074_0265147 Ga0501074_0265147_156_866 236
275 3300049593 Ga0501077_0487755 Ga0501077_0487755_55_765 236
276 3300050507 nmdc:mga05p37_21838_c1 nmdc:mga05p37_21838_c1_3913_4623 236
277 3300050507 nmdc:mga05p37_980_c1 nmdc:mga05p37_980_c1_22900_23610 236
278 3300050508 nmdc:mga09592_136871_c1 nmdc:mga09592_136871_c1_1272_1982 236
279 3300050508 nmdc:mga09592_230500_c1 nmdc:mga09592_230500_c1_446_1156 236
280 3300050508 nmdc:mga09592_947_c1 nmdc:mga09592_947_c1_7562_8272 236
281 3300050509 nmdc:mga0qj67_705_c1 nmdc:mga0qj67_705_c1_20827_21537 236
282 3300050510 nmdc:mga06r32_133398_c1 nmdc:mga06r32_133398_c1_393_1103 236
283 3300050510 nmdc:mga06r32_2106_c1 nmdc:mga06r32_2106_c1_9202_9912 236
284 3300050510 nmdc:mga06r32_277909_c1 nmdc:mga06r32_277909_c1_516_1226 236
285 3300050510 nmdc:mga06r32_85802_c1 nmdc:mga06r32_85802_c1_1275_1985 236
286 3300050511 nmdc:mga08y16_186917_c1 nmdc:mga08y16_186917_c1_256_966 236
287 3300050511 nmdc:mga08y16_71819_c1 nmdc:mga08y16_71819_c1_137_847 236
288 3300050514 nmdc:mga08x19_13653_c1 nmdc:mga08x19_13653_c1_2566_3276 236
289 3300050515 nmdc:mga0a205_302074_c1 nmdc:mga0a205_302074_c1_636_1346 236
290 3300053077 Ga0495601_0008645 Ga0495601_0008645_1835_2545 236
291 3300053085 Ga0495619_0021394 Ga0495619_0021394_648_1358 236
292 3300059426 Ga0590077_011627 Ga0590077_011627_752_1462 236
293 3300005330 Ga0070690_100403703 Ga0070690_1004037032 237
294 3300005336 Ga0070680_100225876 Ga0070680_1002258761 237
295 3300005338 Ga0068868_100746633 Ga0068868_1007466332 237
296 3300005435 Ga0070714_100083363 Ga0070714_1000833632 237
297 3300005459 Ga0068867_100133791 Ga0068867_1001337912 237
298 3300005471 Ga0070698_100126373 Ga0070698_1001263733 237
299 3300005539 Ga0068853_100837283 Ga0068853_1008372831 237
300 3300005544 Ga0070686_100403804 Ga0070686_1004038041 237
301 3300005547 Ga0070693_100304747 Ga0070693_1003047471 237
302 3300005616 Ga0068852_100212763 Ga0068852_1002127631 237
303 3300005842 Ga0068858_100169363 Ga0068858_1001693632 237
304 3300005842 Ga0068858_100397499 Ga0068858_1003974992 237
305 3300005843 Ga0068860_100924395 Ga0068860_1009243952 237
306 3300005985 Ga0081539_10001857 Ga0081539_1000185719 237
307 3300006028 Ga0070717_10094835 Ga0070717_100948352 237
308 3300006038 Ga0075365_10017503 Ga0075365_100175033 237
309 3300006048 Ga0075363_100019885 Ga0075363_1000198853 237
310 3300006237 Ga0097621_100657924 Ga0097621_1006579242 237
311 3300006844 Ga0075428_100000390 Ga0075428_10000039038 237
312 3300006846 Ga0075430_100011416 Ga0075430_1000114168 237
313 3300006846 Ga0075430_100018097 Ga0075430_1000180974 237
314 3300006847 Ga0075431_100000003 Ga0075431_10000000363 237
315 3300006847 Ga0075431_100343858 Ga0075431_1003438582 237
316 3300006880 Ga0075429_100001974 Ga0075429_1000019744 237
317 3300006881 Ga0068865_100256893 Ga0068865_1002568932 237
318 3300006914 Ga0075436_100000638 Ga0075436_1000006389 237
319 3300009094 Ga0111539_10006444 Ga0111539_100064444 237
320 3300009094 Ga0111539_10006454 Ga0111539_100064543 237
321 3300009098 Ga0105245_10047244 Ga0105245_100472443 237
322 3300009098 Ga0105245_10082487 Ga0105245_100824874 237
323 3300009147 Ga0114129_10000104 Ga0114129_1000010457 237
324 3300009176 Ga0105242_10316876 Ga0105242_103168762 237
325 3300010375 Ga0105239_10280495 Ga0105239_102804952 237
326 3300011119 Ga0105246_10043687 Ga0105246_100436873 237
327 3300013306 Ga0163162_10667626 Ga0163162_106676261 237
328 3300014968 Ga0157379_10075107 Ga0157379_100751073 237
329 3300021384 Ga0213876_10240135 Ga0213876_102401352 237
330 3300025899 Ga0207642_10302671 Ga0207642_103026711 237
331 3300025934 Ga0207686_10073565 Ga0207686_100735652 237
332 3300025936 Ga0207670_10239309 Ga0207670_102393092 237
333 3300025936 Ga0207670_10348202 Ga0207670_103482022 237
334 3300026035 Ga0207703_10136337 Ga0207703_101363372 237
335 3300026067 Ga0207678_10115574 Ga0207678_101155743 237
336 3300026089 Ga0207648_10079880 Ga0207648_100798802 237
337 3300026089 Ga0207648_10148602 Ga0207648_101486022 237
338 3300026121 Ga0207683_10175359 Ga0207683_101753593 237
339 3300027695 Ga0209966_1004350 Ga0209966_10043502 237
340 3300027907 Ga0207428_10006513 Ga0207428_100065134 237
341 3300028379 Ga0268266_10132081 Ga0268266_101320812 237
342 3300028800 Ga0265338_10342619 Ga0265338_103426192 237
343 3300035111 Ga0373923_0099352 Ga0373923_0099352_384_1097 237
344 3300035119 Ga0373956_0037187 Ga0373956_0037187_1142_1855 237
345 3300035692 Ga0373935_0323187 Ga0373935_0323187_313_1026 237
346 3300035724 Ga0373933_0080313 Ga0373933_0080313_785_1498 237
347 3300036401 Ga0373937_0055460 Ga0373937_0055460_209_922 237
348 3300036401 Ga0373937_0805311 Ga0373937_0805311_114_827 237
349 3300038443 Ga0395901_0028082 Ga0395901_0028082_4334_5047 237
350 3300039437 Ga0436365_0852937 Ga0436365_0852937_37_753 237
351 3300042461 Ga0439460_0019517 Ga0439460_0019517_548_1264 237
352 3300044712 Ga0453684_0140881 Ga0453684_0140881_1981_2694 237
353 3300045051 Ga0451576_0031204 Ga0451576_0031204_2279_2992 237
354 3300046523 Ga0495644_0111715 Ga0495644_0111715_261_974 237
355 3300046537 Ga0495598_0019864 Ga0495598_0019864_817_1530 237
356 3300046537 Ga0495598_0124827 Ga0495598_0124827_151_864 237
357 3300046539 Ga0495621_0004599 Ga0495621_0004599_2492_3205 237
358 3300046539 Ga0495621_0032660 Ga0495621_0032660_502_1215 237
359 3300046615 Ga0495656_0033821 Ga0495656_0033821_1316_2029 237
360 3300047319 Ga0495674_0390948 Ga0495674_0390948_394_1107 237
361 3300048088 Ga0495602_0025774 Ga0495602_0025774_2759_3472 237
362 3300048905 Ga0496102_0308054 Ga0496102_0308054_188_901 237
363 3300048906 Ga0496103_0131709 Ga0496103_0131709_738_1451 237
364 3300048907 Ga0496104_0003573 Ga0496104_0003573_27_740 237
365 3300048912 Ga0496109_0151931 Ga0496109_0151931_809_1522 237
366 3300048913 Ga0496110_0124275 Ga0496110_0124275_1202_1915 237
367 3300048914 Ga0496111_0490910 Ga0496111_0490910_165_878 237
368 3300048915 Ga0496112_0222715 Ga0496112_0222715_429_1142 237
369 3300048916 Ga0496113_0159342 Ga0496113_0159342_739_1452 237
370 3300048917 Ga0496114_0170559 Ga0496114_0170559_828_1541 237
371 3300048918 Ga0496115_0173042 Ga0496115_0173042_705_1418 237
372 3300049576 Ga0501040_0297910 Ga0501040_0297910_80_793 237
373 3300049581 Ga0501047_0024991 Ga0501047_0024991_1691_2404 237
374 3300049581 Ga0501047_0236845 Ga0501047_0236845_260_973 237
375 3300049581 Ga0501047_0271401 Ga0501047_0271401_659_1372 237
376 3300049587 Ga0501071_0000638 Ga0501071_0000638_1487_2200 237
377 3300049589 Ga0501073_0337639 Ga0501073_0337639_296_1009 237
378 3300049591 Ga0501075_0051262 Ga0501075_0051262_107_820 237
379 3300049741 Ga0501079_0040802 Ga0501079_0040802_2758_3471 237
380 3300049742 Ga0501080_0175196 Ga0501080_0175196_379_1092 237
381 3300049744 Ga0501083_0020742 Ga0501083_0020742_946_1659 237
382 3300050489 nmdc:mga03683_116490_c1 nmdc:mga03683_116490_c1_355_1068 237
383 3300050495 nmdc:mga04h51_29931_c1 nmdc:mga04h51_29931_c1_211_924 237
384 3300050507 nmdc:mga05p37_215_c1 nmdc:mga05p37_215_c1_43201_43917 237
385 3300050509 nmdc:mga0qj67_3084_c1 nmdc:mga0qj67_3084_c1_8657_9370 237
386 3300050509 nmdc:mga0qj67_8082_c1 nmdc:mga0qj67_8082_c1_3082_3798 237
387 3300050510 nmdc:mga06r32_637_c1 nmdc:mga06r32_637_c1_12847_13563 237
388 3300050511 nmdc:mga08y16_176_c1 nmdc:mga08y16_176_c1_44557_45273 237
389 3300050511 nmdc:mga08y16_36382_c1 nmdc:mga08y16_36382_c1_1754_2467 237
390 3300050514 nmdc:mga08x19_2618_c1 nmdc:mga08x19_2618_c1_4537_5250 237
391 3300050514 nmdc:mga08x19_343420_c1 nmdc:mga08x19_343420_c1_48_761 237
392 3300050514 nmdc:mga08x19_4783_c1 nmdc:mga08x19_4783_c1_4671_5384 237
393 3300053077 Ga0495601_0026917 Ga0495601_0026917_1714_2427 237
394 3300053083 Ga0495655_0018690 Ga0495655_0018690_201_914 237
395 3300053085 Ga0495619_0232637 Ga0495619_0232637_130_843 237
396 3300054114 Ga0501084_0090115 Ga0501084_0090115_1740_2453 237
397 3300060353 Ga0501082_0202239 Ga0501082_0202239_582_1295 237
398 3300003784 Ga0055534_1000008 Ga0055534_100000839 238
399 3300003790 Ga0055528_1000831 Ga0055528_100083132 238
400 3300003794 Ga0055531_10001403 Ga0055531_1000140314 238
401 3300005327 Ga0070658_10055099 Ga0070658_100550991 238
402 3300005328 Ga0070676_10008106 Ga0070676_100081063 238
403 3300005330 Ga0070690_100005969 Ga0070690_1000059695 238
404 3300005330 Ga0070690_100060132 Ga0070690_1000601323 238
405 3300005333 Ga0070677_10002411 Ga0070677_100024113 238
406 3300005334 Ga0068869_100004332 Ga0068869_1000043325 238
407 3300005334 Ga0068869_100030088 Ga0068869_1000300884 238
408 3300005334 Ga0068869_100081702 Ga0068869_1000817022 238
409 3300005335 Ga0070666_10001889 Ga0070666_100018899 238
410 3300005338 Ga0068868_100038678 Ga0068868_1000386782 238
411 3300005340 Ga0070689_100011408 Ga0070689_1000114085 238
412 3300005343 Ga0070687_100011217 Ga0070687_1000112173 238
413 3300005343 Ga0070687_100116518 Ga0070687_1001165182 238
414 3300005345 Ga0070692_10168692 Ga0070692_101686922 238
415 3300005347 Ga0070668_100047700 Ga0070668_1000477002 238
416 3300005347 Ga0070668_100127885 Ga0070668_1001278853 238
417 3300005353 Ga0070669_100040122 Ga0070669_1000401223 238
418 3300005354 Ga0070675_100002630 Ga0070675_1000026309 238
419 3300005354 Ga0070675_100042071 Ga0070675_1000420712 238
420 3300005355 Ga0070671_100016816 Ga0070671_1000168166 238
421 3300005355 Ga0070671_100044385 Ga0070671_1000443853 238
422 3300005356 Ga0070674_100200041 Ga0070674_1002000412 238
423 3300005364 Ga0070673_100042648 Ga0070673_1000426483 238
424 3300005364 Ga0070673_100217654 Ga0070673_1002176542 238
425 3300005365 Ga0070688_100072006 Ga0070688_1000720062 238
426 3300005367 Ga0070667_100011577 Ga0070667_1000115771 238
427 3300005367 Ga0070667_100014472 Ga0070667_1000144724 238
428 3300005435 Ga0070714_100059530 Ga0070714_1000595303 238
429 3300005456 Ga0070678_100036514 Ga0070678_1000365144 238
430 3300005456 Ga0070678_100073025 Ga0070678_1000730252 238
431 3300005457 Ga0070662_100020143 Ga0070662_1000201433 238
432 3300005457 Ga0070662_100108122 Ga0070662_1001081222 238
433 3300005459 Ga0068867_100006301 Ga0068867_1000063017 238
434 3300005459 Ga0068867_100062804 Ga0068867_1000628043 238
435 3300005459 Ga0068867_100154201 Ga0068867_1001542012 238
436 3300005466 Ga0070685_10493892 Ga0070685_104938921 238
437 3300005518 Ga0070699_100055772 Ga0070699_1000557722 238
438 3300005535 Ga0070684_100008489 Ga0070684_1000084895 238
439 3300005543 Ga0070672_100004725 Ga0070672_1000047256 238
440 3300005543 Ga0070672_100077153 Ga0070672_1000771532 238
441 3300005543 Ga0070672_100139359 Ga0070672_1001393593 238
442 3300005564 Ga0070664_100462481 Ga0070664_1004624812 238
443 3300005578 Ga0068854_100378415 Ga0068854_1003784152 238
444 3300005614 Ga0068856_100493265 Ga0068856_1004932652 238
445 3300005615 Ga0070702_100093456 Ga0070702_1000934562 238
446 3300005616 Ga0068852_100012855 Ga0068852_1000128556 238
447 3300005616 Ga0068852_100255336 Ga0068852_1002553362 238
448 3300005617 Ga0068859_100307229 Ga0068859_1003072292 238
449 3300005618 Ga0068864_100001309 Ga0068864_10000130913 238
450 3300005618 Ga0068864_100067142 Ga0068864_1000671424 238
451 3300005719 Ga0068861_100006046 Ga0068861_1000060462 238
452 3300005841 Ga0068863_100009149 Ga0068863_1000091497 238
453 3300005841 Ga0068863_100013734 Ga0068863_1000137342 238
454 3300005842 Ga0068858_100002892 Ga0068858_10000289212 238
455 3300005842 Ga0068858_100006541 Ga0068858_1000065415 238
456 3300005842 Ga0068858_100407886 Ga0068858_1004078862 238
457 3300005843 Ga0068860_100000445 Ga0068860_10000044541 238
458 3300005843 Ga0068860_100310575 Ga0068860_1003105752 238
459 3300005844 Ga0068862_100010162 Ga0068862_1000101622 238
460 3300005937 Ga0081455_10244989 Ga0081455_102449892 238
461 3300006038 Ga0075365_10003967 Ga0075365_100039677 238
462 3300006051 Ga0075364_10154517 Ga0075364_101545172 238
463 3300006058 Ga0075432_10028785 Ga0075432_100287852 238
464 3300006177 Ga0075362_10004353 Ga0075362_100043534 238
465 3300006177 Ga0075362_10011152 Ga0075362_100111522 238
466 3300006237 Ga0097621_100048088 Ga0097621_1000480884 238
467 3300006237 Ga0097621_100056051 Ga0097621_1000560513 238
468 3300006358 Ga0068871_100010108 Ga0068871_1000101082 238
469 3300006358 Ga0068871_100111652 Ga0068871_1001116523 238
470 3300006844 Ga0075428_100296709 Ga0075428_1002967092 238
471 3300006846 Ga0075430_100598118 Ga0075430_1005981182 238
472 3300006847 Ga0075431_100341770 Ga0075431_1003417702 238
473 3300006881 Ga0068865_100002093 Ga0068865_1000020933 238
474 3300006881 Ga0068865_100207516 Ga0068865_1002075162 238
475 3300006914 Ga0075436_100059701 Ga0075436_1000597012 238
476 3300006931 Ga0097620_100307225 Ga0097620_1003072252 238
477 3300006948 Ga0099826_10034418 Ga0099826_100344182 238
478 3300007076 Ga0075435_100042487 Ga0075435_1000424873 238
479 3300009094 Ga0111539_10517323 Ga0111539_105173232 238
480 3300009098 Ga0105245_10060255 Ga0105245_100602553 238
481 3300009148 Ga0105243_10021971 Ga0105243_100219713 238
482 3300009176 Ga0105242_10099494 Ga0105242_100994943 238
483 3300009176 Ga0105242_10483246 Ga0105242_104832462 238
484 3300009177 Ga0105248_10000595 Ga0105248_1000059539 238
485 3300009177 Ga0105248_10075724 Ga0105248_100757243 238
486 3300009177 Ga0105248_10201416 Ga0105248_102014163 238
487 3300009553 Ga0105249_10059135 Ga0105249_100591353 238
488 3300009553 Ga0105249_10193064 Ga0105249_101930643 238
489 3300011119 Ga0105246_10063724 Ga0105246_100637242 238
490 3300013296 Ga0157374_10021499 Ga0157374_100214993 238
491 3300013297 Ga0157378_10296911 Ga0157378_102969112 238
492 3300013306 Ga0163162_10036523 Ga0163162_100365232 238
493 3300013306 Ga0163162_10054073 Ga0163162_100540732 238
494 3300013306 Ga0163162_10814830 Ga0163162_108148302 238
495 3300013308 Ga0157375_10012725 Ga0157375_100127253 238
496 3300013308 Ga0157375_10179321 Ga0157375_101793213 238
497 3300014325 Ga0163163_10001922 Ga0163163_1000192210 238
498 3300014326 Ga0157380_10156949 Ga0157380_101569493 238
499 3300014326 Ga0157380_10260290 Ga0157380_102602902 238
500 3300014326 Ga0157380_10685965 Ga0157380_106859652 238
501 3300014968 Ga0157379_10045614 Ga0157379_100456143 238
502 3300014969 Ga0157376_10126000 Ga0157376_101260003 238
503 3300014969 Ga0157376_10949251 Ga0157376_109492512 238
504 3300015261 Ga0182006_1040886 Ga0182006_10408862 238
505 3300015262 Ga0182007_10002631 Ga0182007_100026313 238
506 3300017792 Ga0163161_10020823 Ga0163161_100208234 238
507 3300017792 Ga0163161_10064799 Ga0163161_100647992 238
508 3300025263 Ga0209565_1000042 Ga0209565_100004239 238
509 3300025273 Ga0209673_1000071 Ga0209673_1000071188 238
510 3300025291 Ga0209675_1000041 Ga0209675_1000041187 238
511 3300025294 Ga0209025_1005622 Ga0209025_10056229 238
512 3300025295 Ga0209564_1040927 Ga0209564_10409272 238
513 3300025299 Ga0209256_1015779 Ga0209256_10157793 238
514 3300025303 Ga0209051_1000025 Ga0209051_1000025335 238
515 3300025303 Ga0209051_1015927 Ga0209051_10159272 238
516 3300025304 Ga0209257_1000039 Ga0209257_1000039273 238
517 3300025893 Ga0207682_10008973 Ga0207682_100089734 238
518 3300025893 Ga0207682_10112704 Ga0207682_101127041 238
519 3300025893 Ga0207682_10174702 Ga0207682_101747022 238
520 3300025899 Ga0207642_10341732 Ga0207642_103417321 238
521 3300025903 Ga0207680_10005090 Ga0207680_100050903 238
522 3300025903 Ga0207680_10238129 Ga0207680_102381291 238
523 3300025907 Ga0207645_10004582 Ga0207645_100045827 238
524 3300025908 Ga0207643_10200037 Ga0207643_102000371 238
525 3300025918 Ga0207662_10001475 Ga0207662_100014755 238
526 3300025918 Ga0207662_10310098 Ga0207662_103100981 238
527 3300025922 Ga0207646_10027895 Ga0207646_100278953 238
528 3300025923 Ga0207681_10108238 Ga0207681_101082381 238
529 3300025926 Ga0207659_10008930 Ga0207659_100089305 238
530 3300025926 Ga0207659_10057571 Ga0207659_100575713 238
531 3300025927 Ga0207687_10027356 Ga0207687_100273562 238
532 3300025928 Ga0207700_10046909 Ga0207700_100469093 238
533 3300025931 Ga0207644_10162562 Ga0207644_101625622 238
534 3300025933 Ga0207706_10043730 Ga0207706_100437302 238
535 3300025933 Ga0207706_10058604 Ga0207706_100586043 238
536 3300025934 Ga0207686_10077384 Ga0207686_100773842 238
537 3300025935 Ga0207709_10012814 Ga0207709_100128143 238
538 3300025936 Ga0207670_10232681 Ga0207670_102326812 238
539 3300025936 Ga0207670_10371853 Ga0207670_103718531 238
540 3300025937 Ga0207669_10019212 Ga0207669_100192122 238
541 3300025940 Ga0207691_10010762 Ga0207691_100107623 238
542 3300025940 Ga0207691_10013009 Ga0207691_100130094 238
543 3300025940 Ga0207691_10182815 Ga0207691_101828152 238
544 3300025941 Ga0207711_10014494 Ga0207711_100144944 238
545 3300025941 Ga0207711_10032992 Ga0207711_100329923 238
546 3300025941 Ga0207711_10044194 Ga0207711_100441943 238
547 3300025942 Ga0207689_10004853 Ga0207689_100048533 238
548 3300025942 Ga0207689_10130471 Ga0207689_101304712 238
549 3300025945 Ga0207679_10346775 Ga0207679_103467752 238
550 3300025960 Ga0207651_10055288 Ga0207651_100552882 238
551 3300025960 Ga0207651_10342988 Ga0207651_103429882 238
552 3300025961 Ga0207712_10011898 Ga0207712_100118982 238
553 3300025972 Ga0207668_10196102 Ga0207668_101961022 238
554 3300025972 Ga0207668_10387152 Ga0207668_103871522 238
555 3300025986 Ga0207658_10003494 Ga0207658_100034947 238
556 3300025986 Ga0207658_10017863 Ga0207658_100178634 238
557 3300026023 Ga0207677_10024617 Ga0207677_100246173 238
558 3300026023 Ga0207677_10040343 Ga0207677_100403432 238
559 3300026035 Ga0207703_10001799 Ga0207703_1000179911 238
560 3300026035 Ga0207703_10032151 Ga0207703_100321512 238
561 3300026078 Ga0207702_10012690 Ga0207702_100126903 238
562 3300026088 Ga0207641_10015255 Ga0207641_100152554 238
563 3300026088 Ga0207641_10020481 Ga0207641_100204813 238
564 3300026088 Ga0207641_10091584 Ga0207641_100915843 238
565 3300026089 Ga0207648_10004667 Ga0207648_1000466711 238
566 3300026089 Ga0207648_10021486 Ga0207648_100214864 238
567 3300026089 Ga0207648_10277875 Ga0207648_102778752 238
568 3300026095 Ga0207676_10005019 Ga0207676_100050192 238
569 3300026095 Ga0207676_10052933 Ga0207676_100529332 238
570 3300026118 Ga0207675_100007314 Ga0207675_1000073143 238
571 3300026118 Ga0207675_100034843 Ga0207675_1000348432 238
572 3300026121 Ga0207683_10007125 Ga0207683_100071258 238
573 3300026121 Ga0207683_10054461 Ga0207683_100544612 238
574 3300026121 Ga0207683_10087574 Ga0207683_100875742 238
575 3300026142 Ga0207698_10013120 Ga0207698_100131205 238
576 3300027907 Ga0207428_10130805 Ga0207428_101308052 238
577 3300028380 Ga0268265_10004016 Ga0268265_100040165 238
578 3300028381 Ga0268264_10009491 Ga0268264_100094912 238
579 3300028794 Ga0307515_10000014 Ga0307515_10000014312 238
580 3300031548 Ga0307408_100111218 Ga0307408_1001112183 238
581 3300031548 Ga0307408_100204454 Ga0307408_1002044542 238
582 3300031731 Ga0307405_10003735 Ga0307405_100037352 238
583 3300031731 Ga0307405_10471017 Ga0307405_104710172 238
584 3300031824 Ga0307413_10026207 Ga0307413_100262072 238
585 3300031852 Ga0307410_10014455 Ga0307410_100144552 238
586 3300031901 Ga0307406_10005448 Ga0307406_100054485 238
587 3300031901 Ga0307406_10060538 Ga0307406_100605382 238
588 3300031903 Ga0307407_10002451 Ga0307407_100024512 238
589 3300031911 Ga0307412_10009014 Ga0307412_100090145 238
590 3300031911 Ga0307412_10131568 Ga0307412_101315682 238
591 3300031911 Ga0307412_10475281 Ga0307412_104752812 238
592 3300031995 Ga0307409_100022174 Ga0307409_1000221742 238
593 3300031995 Ga0307409_100060900 Ga0307409_1000609001 238
594 3300032002 Ga0307416_100000708 Ga0307416_10000070810 238
595 3300032002 Ga0307416_100001584 Ga0307416_10000158410 238
596 3300032004 Ga0307414_10031261 Ga0307414_100312612 238
597 3300032004 Ga0307414_10348942 Ga0307414_103489422 238
598 3300032005 Ga0307411_10002419 Ga0307411_100024194 238
599 3300032005 Ga0307411_10501255 Ga0307411_105012551 238
600 3300032126 Ga0307415_100000614 Ga0307415_1000006148 238
601 3300032126 Ga0307415_100011692 Ga0307415_1000116923 238
602 3300035117 Ga0373953_0073036 Ga0373953_0073036_544_1269 238
603 3300035118 Ga0373954_0076756 Ga0373954_0076756_525_1250 238
604 3300035121 Ga0373960_0088817 Ga0373960_0088817_57_776 238
605 3300035170 Ga0373943_0029685 Ga0373943_0029685_1703_2419 238
606 3300035172 Ga0373955_0144799 Ga0373955_0144799_540_1265 238
607 3300035695 Ga0373927_0266369 Ga0373927_0266369_213_929 238
608 3300036401 Ga0373937_0003134 Ga0373937_0003134_3807_4532 238
609 3300037312 Ga0395899_0006613 Ga0395899_0006613_868_1584 238
610 3300037418 Ga0395900_0036357 Ga0395900_0036357_4238_4954 238
611 3300037418 Ga0395900_0187454 Ga0395900_0187454_1156_1872 238
612 3300037418 Ga0395900_0347057 Ga0395900_0347057_228_944 238
613 3300037466 Ga0395898_0062414 Ga0395898_0062414_315_1031 238
614 3300037466 Ga0395898_0138897 Ga0395898_0138897_330_1046 238
615 3300037471 Ga0395905_0017834 Ga0395905_0017834_658_1374 238
616 3300038443 Ga0395901_0274049 Ga0395901_0274049_555_1271 238
617 3300038443 Ga0395901_0295082 Ga0395901_0295082_528_1244 238
618 3300041404 Ga0439436_0060856 Ga0439436_0060856_169_894 238
619 3300041411 Ga0439466_0036387 Ga0439466_0036387_829_1554 238
620 3300041413 Ga0439465_0052638 Ga0439465_0052638_528_1253 238
621 3300041999 Ga0439433_0007425 Ga0439433_0007425_1196_1921 238
622 3300042000 Ga0439437_003681 Ga0439437_003681_88_813 238
623 3300042002 Ga0439442_015691 Ga0439442_015691_728_1453 238
624 3300042006 Ga0439432_020405 Ga0439432_020405_825_1550 238
625 3300042008 Ga0439450_004026 Ga0439450_004026_324_1046 238
626 3300042010 Ga0439452_009876 Ga0439452_009876_341_1066 238
627 3300042115 Ga0450911_000599 Ga0450911_000599_10067_10783 238
628 3300042123 Ga0450921_000584 Ga0450921_000584_387_1112 238
629 3300042125 Ga0450923_001005 Ga0450923_001005_1765_2490 238
630 3300042128 Ga0450897_002588 Ga0450897_002588_207_932 238
631 3300042130 Ga0450892_005129 Ga0450892_005129_81_803 238
632 3300042131 Ga0450894_005256 Ga0450894_005256_565_1290 238
633 3300042146 Ga0450907_018092 Ga0450907_018092_193_918 238
634 3300042157 Ga0439458_0012922 Ga0439458_0012922_648_1373 238
635 3300042185 Ga0450909_006969 Ga0450909_006969_369_1094 238
636 3300042435 Ga0439434_0002341 Ga0439434_0002341_2620_3345 238
637 3300042439 Ga0439464_0002254 Ga0439464_0002254_3258_3980 238
638 3300042439 Ga0439464_0019192 Ga0439464_0019192_903_1628 238
639 3300042461 Ga0439460_0027746 Ga0439460_0027746_47_769 238
640 3300042532 Ga0450893_0016014 Ga0450893_0016014_355_1080 238
641 3300044673 Ga0453683_0172369 Ga0453683_0172369_248_964 238
642 3300044842 Ga0466957_0432766 Ga0466957_0432766_110_826 238
643 3300045051 Ga0451576_0183272 Ga0451576_0183272_812_1537 238
644 3300045051 Ga0451576_0476451 Ga0451576_0476451_174_890 238
645 3300046455 Ga0495603_0110883 Ga0495603_0110883_797_1513 238
646 3300046528 Ga0495642_0038531 Ga0495642_0038531_420_1136 238
647 3300046529 Ga0495652_0254727 Ga0495652_0254727_234_959 238
648 3300046615 Ga0495656_0121859 Ga0495656_0121859_138_860 238
649 3300047315 Ga0495581_0309169 Ga0495581_0309169_63_779 238
650 3300048904 Ga0496101_0234287 Ga0496101_0234287_51_767 238
651 3300048907 Ga0496104_0009110 Ga0496104_0009110_189_905 238
652 3300048907 Ga0496104_0087772 Ga0496104_0087772_649_1371 238
653 3300048907 Ga0496104_0784792 Ga0496104_0784792_29_745 238
654 3300048908 Ga0496105_0045498 Ga0496105_0045498_225_941 238
655 3300048908 Ga0496105_0051490 Ga0496105_0051490_298_1014 238
656 3300048908 Ga0496105_0364248 Ga0496105_0364248_288_1004 238
657 3300048909 Ga0496106_0020051 Ga0496106_0020051_4203_4919 238
658 3300048911 Ga0496108_0229768 Ga0496108_0229768_676_1392 238
659 3300048911 Ga0496108_0521588 Ga0496108_0521588_82_798 238
660 3300048912 Ga0496109_0059341 Ga0496109_0059341_1854_2570 238
661 3300048912 Ga0496109_0113962 Ga0496109_0113962_1625_2341 238
662 3300048913 Ga0496110_0121428 Ga0496110_0121428_1148_1864 238
663 3300048914 Ga0496111_0116578 Ga0496111_0116578_832_1548 238
664 3300048914 Ga0496111_0180781 Ga0496111_0180781_498_1220 238
665 3300048914 Ga0496111_0575958 Ga0496111_0575958_52_768 238
666 3300048915 Ga0496112_0005345 Ga0496112_0005345_9659_10375 238
667 3300048917 Ga0496114_0194934 Ga0496114_0194934_397_1113 238
668 3300048924 Ga0496121_0002968 Ga0496121_0002968_21286_22002 238
669 3300048928 Ga0496125_0026075 Ga0496125_0026075_1261_1977 238
670 3300049517 Ga0501294_004268 Ga0501294_004268_465_1202 238
671 3300049686 Ga0501257_019873 Ga0501257_019873_160_897 238
672 3300050489 nmdc:mga03683_1540_c1 nmdc:mga03683_1540_c1_998_1723 238
673 3300050490 nmdc:mga03n38_6527_c1 nmdc:mga03n38_6527_c1_84_809 238
674 3300050491 nmdc:mga00v17_9302_c1 nmdc:mga00v17_9302_c1_1312_2037 238
675 3300050492 nmdc:mga0yw44_1966_c1 nmdc:mga0yw44_1966_c1_2867_3592 238
676 3300050493 nmdc:mga0k408_33541_c1 nmdc:mga0k408_33541_c1_830_1555 238
677 3300050496 nmdc:mga07m45_33632_c1 nmdc:mga07m45_33632_c1_1067_1792 238
678 3300050513 nmdc:mga0rr50_38273_c1 nmdc:mga0rr50_38273_c1_2732_3454 238
679 3300050514 nmdc:mga08x19_30171_c1 nmdc:mga08x19_30171_c1_1874_2596 238
680 3300053178 Ga0500637_0308513 Ga0500637_0308513_33_749 238
681 3300003781 Ga0055536_1000313 Ga0055536_10003132 239
682 3300003784 Ga0055534_1003181 Ga0055534_10031813 239
683 3300003792 Ga0055540_1001615 Ga0055540_10016155 239
684 3300009148 Ga0105243_10000293 Ga0105243_1000029311 239
685 3300017792 Ga0163161_10104436 Ga0163161_101044363 239
686 3300025284 Ga0209130_1001720 Ga0209130_100172012 239
687 3300025291 Ga0209675_1002415 Ga0209675_10024154 239
688 3300025292 Ga0209676_1000267 Ga0209676_100026734 239
689 3300025292 Ga0209676_1006250 Ga0209676_10062502 239
690 3300025298 Ga0209050_1009624 Ga0209050_10096243 239
691 3300025298 Ga0209050_1015410 Ga0209050_10154102 239
692 3300025303 Ga0209051_1000230 Ga0209051_100023059 239
693 3300025303 Ga0209051_1005092 Ga0209051_10050925 239
694 3300025304 Ga0209257_1004695 Ga0209257_10046953 239
695 3300025304 Ga0209257_1005713 Ga0209257_10057133 239
696 3300025935 Ga0207709_10000076 Ga0207709_1000007672 239
697 3300032002 Ga0307416_100644672 Ga0307416_1006446722 239
698 3300032005 Ga0307411_10043524 Ga0307411_100435243 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

26

156

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9465 1 239
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9426 1 239
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9269 6 226
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9189 3 228
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9177 3 228
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9712 6 234 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9687 1 239 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 1 239 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 1 239 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9388 6 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W1N4U0-F1-model_v4 ABC transporter ATP-binding protein 0.9859 3 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7T2SAA5-F1-model_v4 ABC transporter ATP-binding protein 0.9778 3 239 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7W1N4U0-F1-model_v4 ABC transporter ATP-binding protein 0.9776 3 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A6G6K803-F1-model_v4 ABC transporter ATP-binding protein 0.9774 6 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A4R9AIB0-F1-model_v4 ABC transporter ATP-binding protein 0.9757 6 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.7 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map