F475968

General Info

Members Datasets Scaffolds Average Seq Length
698 443 1396 234

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0000144|Ga0373927_0000144_35377_36171
Length 264
Sequence MIAVETILGLFLSHALSAGKLDRADTEVFMDKTIQSAAEAVAGIGDGATVMIGGFGGSGAPIELIHALIDKGPKNLTVINNNAGNGRIGIAAMIDAGLVRKMICSFPRSSDPRAFTDRYLAGEIELELVPQGTLAERIRAGGAGIPAFYTPTAYGTELANGKVIAEFDGRHYVQERWLKADFAIVKAHIGDIQGNLTYNKAGRNFNPLMCMAAARTIAQVSKIVPPGGIDPEQVITPGIFVNGVVEIANPQQEEELIKAGVAYI

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
52 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
53 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
82 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
83 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
90 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
103 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
104 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
105 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
106 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
194 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
195 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
196 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
197 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
198 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
199 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
200 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
201 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
202 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
203 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
204 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
205 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
206 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
207 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
208 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
209 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
210 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
211 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
212 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
213 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
214 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
215 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
216 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
217 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
218 2534681786 Brucella suis 92/29 Isolate Unclassified
219 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
220 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
221 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
222 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
223 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
224 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
225 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
226 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
227 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
228 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
229 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
230 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
231 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
232 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
233 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
234 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
235 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
236 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
237 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
238 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
239 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
240 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
241 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
242 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
243 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
244 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
245 2643221582 Rhizobium sp. Root651 Isolate Unclassified
246 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
247 2643221693 Rhizobium sp. Root491 Isolate Unclassified
248 2643221719 Rhizobium sp. Root274 Isolate Unclassified
249 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
250 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
251 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
252 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
253 2738541293 Rhizobium sp. GV031 Isolate Unclassified
254 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
255 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
256 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
257 2791355261 Rhizobium sp. J15 Isolate Nodule
258 2791355263 Rhizobium chutanense C5 Isolate Nodule
259 2791355267 Rhizobium sp. L18 Isolate Nodule
260 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
261 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
262 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
263 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
264 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
265 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
266 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
267 2802429633 Rhizobium anhuiense J3 Isolate Nodule
268 2802429634 Rhizobium anhuiense S10 Isolate Nodule
269 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
270 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
271 2802429637 Rhizobium anhuiense C15 Isolate Nodule
272 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
273 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
274 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
275 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
276 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
277 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
278 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
279 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
280 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
281 2838048938 Rhizobium pisi 27/80 Isolate Nodule
282 2838061910 Rhizobium phaseoli L15 Isolate Nodule
283 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
284 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
285 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
286 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
287 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
288 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
289 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
290 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
291 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
292 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
293 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
294 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
295 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
296 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
297 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
298 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
299 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
300 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
301 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
302 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
303 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
304 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
305 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
306 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
307 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
308 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
309 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
310 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
311 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
312 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
313 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
314 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
315 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
316 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
317 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
318 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
319 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
320 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
321 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
322 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
323 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
324 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
325 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
326 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
327 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
328 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
329 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
330 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
331 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
332 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
333 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
334 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
335 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
336 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
337 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
338 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
339 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
340 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
341 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
342 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
343 2854911287 Brucella lupini LUP21 Isolate Unclassified
344 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
345 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
346 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
347 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
348 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
349 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
350 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
351 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
352 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
353 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
354 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
355 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
356 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
357 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
358 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
359 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
360 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
361 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
362 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
363 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
364 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
365 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
366 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
367 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
368 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
369 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
370 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
371 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
372 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
373 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
374 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
375 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
376 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
377 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
378 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
379 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
380 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
381 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
382 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
383 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
384 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
385 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
386 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
387 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
388 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
389 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
390 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
391 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
392 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
393 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
394 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
395 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
396 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
397 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
398 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
399 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
400 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
401 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
402 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
403 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
404 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
405 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
406 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
407 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
408 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
409 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
410 2996887358 Rhizobium sp. R711 Isolate Nodule
411 2996893221 Rhizobium sp. R635 Isolate Nodule
412 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
413 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
414 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
415 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
416 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
417 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
418 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
419 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
420 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
421 8005258706 Rhizobium sp. R693 Isolate Nodule
422 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
423 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
424 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
425 8005321885 Rhizobium sp. R72 Isolate Nodule
426 8005382845 Rhizobium sp. R634 Isolate Nodule
427 8005395548 Rhizobium sp. R339 Isolate Nodule
428 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
429 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
430 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
431 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
432 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
433 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
434 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
435 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
436 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
437 8024501048 Rhizobium sp. H4 Isolate Nodule
438 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
439 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
440 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
441 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
442 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
443 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.32
Metatranscriptomes 0.14
Isolates 36.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 21.35
Nodule 25.64
Rhizoplane 2.72
Rhizosphere 29.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0000144 3300035695 Bacteria 55726
2 JGI24740J21852_10001244 3300001979 Bacteria 11527
3 JGI25155J39150_1000226 3300002704 Bacteria 22197
4 JGI25156J39149_1000523 3300002705 Bacteria 22196
5 JGI25162J39368_1000643 3300002737 Bacteria 24740
6 JGI25154J39366_1000435 3300002738 Bacteria 22198
7 JGI25157J39369_1000562 3300002741 Bacteria 22196
8 JGI25152J39213_1000009 3300002773 Bacteria 138285
9 JGI25152J39213_1008711 3300002773 Bacteria 2489
10 JGI25152J39213_1009380 3300002773 Bacteria 2329
11 JGI25152J39213_1014774 3300002773 Bacteria 1568
12 JGI25152J39213_1015361 3300002773 Bacteria 1512
13 JGI25150J39212_1000016 3300002774 Bacteria 153945
14 JGI25150J39212_1005997 3300002774 Bacteria 2548
15 JGI25150J39212_1011588 3300002774 Bacteria 1591
16 JGI25159J45721_1000259 3300002987 Bacteria 24699
17 JGI25151J46595_10000073 3300003187 Bacteria 136684
18 JGI25151J46595_10000450 3300003187 Bacteria 39793
19 JGI25151J46595_10001434 3300003187 Bacteria 16205
20 JGI25151J46595_10025744 3300003187 Bacteria 2387
21 JGI25151J46595_10050188 3300003187 Bacteria 1424
22 JGI25151J46595_10054489 3300003187 Bacteria 1325
23 JGI25165J46597_1000018 3300003214 Bacteria 374701
24 JGI25153J46596_10003932 3300003215 Bacteria 8149
25 JGI25153J46596_10008815 3300003215 Bacteria 4773
26 JGI25153J46596_10024670 3300003215 Bacteria 2163
27 JGI25153J46596_10041356 3300003215 Bacteria 1418
28 rootL2_10016841 3300003322 Bacteria 4498
29 rootH1_10098563 3300003323 Bacteria 2005
30 JGI25160J50197_1000364 3300003354 Bacteria 29646
31 JGI25160J50197_1016250 3300003354 Bacteria 2405
32 JGI25161J50226_1006152 3300003374 Bacteria 2214
33 Ga0006562J51391_1027838 3300003578 Bacteria 2501
34 Ga0055526_1009616 3300003771 Bacteria 4622
35 Ga0055526_1014607 3300003771 Bacteria 3215
36 Ga0055526_1015707 3300003771 Bacteria 3020
37 Ga0055524_1004472 3300003775 Bacteria 6453
38 Ga0055524_1012855 3300003775 Bacteria 3191
39 Ga0055524_1031158 3300003775 Bacteria 1539
40 Ga0055528_1001290 3300003790 Bacteria 15735
41 Ga0055528_1001322 3300003790 Bacteria 15487
42 Ga0055528_1012995 3300003790 Bacteria 3191
43 Ga0055528_1027432 3300003790 Bacteria 1602
44 Ga0055528_1050765 3300003790 Bacteria 841
45 Ga0055540_1001625 3300003792 Bacteria 13070
46 Ga0055540_1019472 3300003792 Bacteria 1825
47 Ga0058692_1005506 3300003856 Bacteria 3604
48 Ga0055543_1000651 3300004625 Bacteria 18441
49 Ga0065165_1005129 3300005262 Bacteria 7584
50 Ga0065165_1014429 3300005262 Bacteria 3067
51 Ga0070670_100000287 3300005331 Bacteria 44454
52 Ga0070668_100107213 3300005347 Bacteria 2221
53 Ga0070671_100031183 3300005355 Bacteria 4403
54 Ga0070665_100010868 3300005548 Bacteria 9208
55 Ga0068856_100027127 3300005614 Bacteria 5588
56 Ga0075365_10005711 3300006038 Bacteria 6746
57 Ga0075368_10067649 3300006042 Bacteria 1438
58 Ga0075363_100016811 3300006048 Bacteria 3617
59 Ga0075364_10000583 3300006051 Bacteria 18780
60 Ga0075364_10050795 3300006051 Bacteria 2707
61 Ga0075362_10005537 3300006177 Bacteria 4630
62 Ga0075362_10026588 3300006177 Bacteria 2473
63 Ga0075367_10016961 3300006178 Bacteria 3987
64 Ga0075367_10156144 3300006178 Bacteria 1418
65 Ga0075367_10217670 3300006178 Bacteria 1195
66 Ga0075367_10234347 3300006178 Bacteria 1150
67 Ga0075369_10030550 3300006186 Bacteria 2270
68 Ga0075369_10050769 3300006186 Bacteria 1795
69 Ga0075369_10082583 3300006186 Bacteria 1426
70 Ga0075369_10166983 3300006186 Bacteria 1010
71 Ga0075366_10008700 3300006195 Bacteria 5652
72 Ga0075370_10017116 3300006353 Bacteria 3912
73 Ga0075430_100205450 3300006846 Bacteria 1635
74 Ga0079104_1000014 3300006946 Bacteria 337362
75 Ga0099826_10000053 3300006948 Bacteria 72398
76 Ga0099826_10005883 3300006948 Bacteria 8855
77 Ga0099826_10153541 3300006948 Bacteria 1314
78 Ga0105251_10040255 3300009011 Bacteria 2279
79 Ga0105248_10849350 3300009177 Bacteria 1030
80 Ga0105249_10394621 3300009553 Bacteria 1413
81 Ga0105246_10004159 3300011119 Bacteria 8794
82 Ga0157373_10015004 3300013100 Bacteria 5666
83 Ga0157371_10000005 3300013102 Bacteria 416456
84 Ga0157370_10000036 3300013104 Bacteria 136933
85 Ga0157372_10680746 3300013307 Bacteria 1197
86 Ga0228711_1023082 3300022739 Bacteria 4718
87 Ga0228710_1016272 3300022740 Bacteria 7828
88 Ga0209435_100025 3300025206 Bacteria 198776
89 Ga0209436_100044 3300025208 Bacteria 70547
90 Ga0209437_100022 3300025233 Bacteria 625694
91 Ga0207425_1000054 3300025245 Bacteria 153997
92 Ga0207425_1000563 3300025245 Bacteria 21840
93 Ga0207425_1024755 3300025245 Bacteria 1243
94 Ga0207425_1046709 3300025245 Bacteria 805
95 Ga0209646_1000083 3300025246 Bacteria 198777
96 Ga0209646_1011741 3300025246 Bacteria 1352
97 Ga0209026_1000078 3300025250 Bacteria 198777
98 Ga0209759_1000060 3300025256 Bacteria 198777
99 Ga0209129_1000016 3300025258 Bacteria 485491
100 Ga0209129_1000108 3300025258 Bacteria 153997
101 Ga0209129_1000153 3300025258 Bacteria 110699
102 Ga0209129_1001041 3300025258 Bacteria 16395
103 Ga0209129_1002193 3300025258 Bacteria 9813
104 Ga0209129_1004085 3300025258 Bacteria 5948
105 Ga0209129_1009206 3300025258 Bacteria 2637
106 Ga0209233_1000031 3300025261 Bacteria 624646
107 Ga0209673_1000005 3300025273 Bacteria 692788
108 Ga0209673_1000023 3300025273 Bacteria 411385
109 Ga0209673_1001431 3300025273 Bacteria 22751
110 Ga0209673_1001452 3300025273 Bacteria 22431
111 Ga0209673_1005673 3300025273 Bacteria 6232
112 Ga0209673_1007097 3300025273 Bacteria 5249
113 Ga0209130_1000001 3300025284 Bacteria 831557
114 Ga0209130_1016616 3300025284 Bacteria 1776
115 Ga0209130_1025554 3300025284 Bacteria 1277
116 Ga0209676_1013264 3300025292 Bacteria 3180
117 Ga0209025_1000072 3300025294 Bacteria 283452
118 Ga0209025_1000126 3300025294 Bacteria 200866
119 Ga0209025_1000189 3300025294 Bacteria 153997
120 Ga0209025_1000227 3300025294 Bacteria 132244
121 Ga0209025_1000954 3300025294 Bacteria 43693
122 Ga0209025_1009630 3300025294 Bacteria 6693
123 Ga0209025_1010879 3300025294 Bacteria 6094
124 Ga0209025_1026912 3300025294 Bacteria 2869
125 Ga0209025_1036759 3300025294 Bacteria 2186
126 Ga0209025_1090814 3300025294 Bacteria 999
127 Ga0209564_1000100 3300025295 Bacteria 224016
128 Ga0209564_1001312 3300025295 Bacteria 26661
129 Ga0209564_1003600 3300025295 Bacteria 10319
130 Ga0209564_1005523 3300025295 Bacteria 7167
131 Ga0209564_1010874 3300025295 Bacteria 4142
132 Ga0209758_1000053 3300025297 Bacteria 337751
133 Ga0209758_1000162 3300025297 Bacteria 153997
134 Ga0209758_1002167 3300025297 Bacteria 20638
135 Ga0209758_1011606 3300025297 Bacteria 5072
136 Ga0209758_1013079 3300025297 Bacteria 4564
137 Ga0209758_1027442 3300025297 Bacteria 2433
138 Ga0209758_1032215 3300025297 Bacteria 2132
139 Ga0209758_1045185 3300025297 Bacteria 1601
140 Ga0209050_1010932 3300025298 Bacteria 4388
141 Ga0209256_1000956 3300025299 Bacteria 34976
142 Ga0209256_1001713 3300025299 Bacteria 21052
143 Ga0209256_1006645 3300025299 Bacteria 6031
144 Ga0209256_1018136 3300025299 Bacteria 2303
145 Ga0209256_1021660 3300025299 Bacteria 1965
146 Ga0207426_1000005 3300025302 Bacteria 1037188
147 Ga0207426_1000035 3300025302 Bacteria 448327
148 Ga0207426_1002644 3300025302 Bacteria 11044
149 Ga0209051_1000062 3300025303 Bacteria 251081
150 Ga0209051_1000630 3300025303 Bacteria 40553
151 Ga0209051_1044105 3300025303 Bacteria 1557
152 Ga0209051_1060829 3300025303 Bacteria 1190
153 Ga0209257_1011782 3300025304 Bacteria 4152
154 Ga0207681_10023362 3300025923 Bacteria 3954
155 Ga0207650_10001289 3300025925 Bacteria 18184
156 Ga0207644_10261875 3300025931 Bacteria 1383
157 Ga0207702_10009256 3300026078 Bacteria 8278
158 Ga0209281_1000032 3300027111 Bacteria 401727
159 Ga0209281_1000554 3300027111 Bacteria 45927
160 Ga0209281_1007528 3300027111 Bacteria 2726
161 Ga0209371_1000003 3300027312 Bacteria 1122971
162 Ga0209371_1001207 3300027312 Bacteria 18681
163 Ga0209371_1012366 3300027312 Bacteria 2474
164 Ga0209282_1000060 3300027666 Bacteria 97673
165 Ga0209282_1001174 3300027666 Bacteria 14074
166 Ga0268266_10010600 3300028379 Bacteria 8035
167 Ga0268256_1000004 3300030500 Bacteria 1122967
168 Ga0268256_1030576 3300030500 Bacteria 1302
169 Ga0316181_1079939 3300030744 Bacteria 986
170 Ga0316182_1428536 3300030745 Bacteria 2994
171 Ga0307513_10043500 3300031456 Bacteria 4931
172 Ga0307513_10108796 3300031456 Bacteria 2771
173 Ga0307406_10008039 3300031901 Bacteria 5873
174 Ga0307406_10067389 3300031901 Bacteria 2333
175 Ga0307412_10039559 3300031911 Bacteria 3045
176 Ga0307412_10403309 3300031911 Bacteria 1114
177 Ga0307412_10517421 3300031911 Bacteria 996
178 Ga0315914_1000005 3300031967 Bacteria 242195
179 Ga0315914_1030781 3300031967 Bacteria 2726
180 Ga0307409_100084234 3300031995 Bacteria 2581
181 Ga0307409_100793380 3300031995 Bacteria 954
182 Ga0315913_1001354 3300033430 Bacteria 26738
183 Ga0315915_1000004 3300033464 Bacteria 403083
184 Ga0315915_1035715 3300033464 Bacteria 2726
185 Ga0373955_0185960 3300035172 Bacteria 1234
186 Ga0316584_0156876 3300036712 Bacteria 1692
187 Ga0373925_0000481 3300037068 Bacteria 39959
188 Ga0395905_0013777 3300037471 Bacteria 7740
189 Ga0439436_0001082 3300041404 Bacteria 7677
190 Ga0439439_0019167 3300041406 Bacteria 1696
191 Ga0439461_0034509 3300041410 Bacteria 1069
192 Ga0439466_0034095 3300041411 Bacteria 1727
193 Ga0439465_0000386 3300041413 Bacteria 12739
194 Ga0439465_0003987 3300041413 Bacteria 4813
195 Ga0439465_0105511 3300041413 Bacteria 976
196 Ga0451835_0302878 3300041492 Bacteria 4736
197 Ga0451839_0549133 3300041496 Bacteria 1565
198 Ga0451841_0526586 3300041498 Bacteria 2041
199 Ga0451845_0115605 3300041501 Bacteria 1510
200 Ga0451845_0358306 3300041501 Bacteria 1153
201 Ga0451851_0140896 3300041507 Bacteria 1032
202 Ga0451855_0979557 3300041511 Bacteria 1150
203 Ga0439432_051566 3300042006 Bacteria 1282
204 Ga0439432_077752 3300042006 Bacteria 1007
205 Ga0439449_0033267 3300042007 Bacteria 1921
206 Ga0439449_0037625 3300042007 Bacteria 1800
207 Ga0450906_020476 3300042145 Bacteria 1183
208 Ga0450918_017146 3300042531 Bacteria 1260
209 Ga0466965_0049964 3300044683 Bacteria 2073
210 Ga0466968_0086232 3300044735 Bacteria 1386
211 Ga0495650_0047131 3300046471 Bacteria 1804
212 Ga0495585_0036491 3300046492 Bacteria 2771
213 Ga0495606_0004576 3300046507 Bacteria 13720
214 Ga0495606_0018676 3300046507 Bacteria 5189
215 Ga0495606_0093923 3300046507 Bacteria 1839
216 Ga0495643_0092216 3300046522 Bacteria 1561
217 Ga0495643_0118616 3300046522 Bacteria 1339
218 Ga0495654_0000140 3300046530 Bacteria 75508
219 Ga0495597_0070166 3300046542 Bacteria 1511
220 Ga0495633_0119056 3300046558 Bacteria 1223
221 Ga0495656_0104992 3300046615 Bacteria 1313
222 Ga0495625_0003110 3300046660 Bacteria 16956
223 Ga0495625_0018939 3300046660 Bacteria 5357
224 Ga0495661_0327799 3300046665 Bacteria 759
225 Ga0495588_0008240 3300046674 Bacteria 4773
226 Ga0495671_0041131 3300046692 Bacteria 2329
227 Ga0495649_0025746 3300046694 Bacteria 3276
228 Ga0495649_0179541 3300046694 Bacteria 1105
229 Ga0495660_0036074 3300046810 Bacteria 2759
230 Ga0495683_0082448 3300047323 Bacteria 1567
231 Ga0495681_0016697 3300047470 Bacteria 4103
232 Ga0495686_0000247 3300047472 Bacteria 97327
233 Ga0495686_0040644 3300047472 Bacteria 2965
234 Ga0495686_0060194 3300047472 Bacteria 2361
235 Ga0496101_0075561 3300048904 Bacteria 2480
236 Ga0496101_0081350 3300048904 Bacteria 2395
237 Ga0496103_0145236 3300048906 Bacteria 1518
238 Ga0496104_0039384 3300048907 Bacteria 4426
239 Ga0496104_0129961 3300048907 Bacteria 2419
240 Ga0496106_0000275 3300048909 Bacteria 36354
241 Ga0496110_0012841 3300048913 Bacteria 6901
242 Ga0496110_0781863 3300048913 Bacteria 858
243 Ga0496111_0001401 3300048914 Bacteria 13702
244 Ga0496111_0042218 3300048914 Bacteria 3274
245 Ga0496113_0060840 3300048916 Bacteria 2848
246 Ga0496113_0187334 3300048916 Bacteria 1642
247 Ga0496116_0000540 3300048919 Bacteria 50890
248 Ga0496116_0003416 3300048919 Bacteria 15704
249 Ga0496116_0025286 3300048919 Bacteria 4368
250 Ga0496116_0029441 3300048919 Bacteria 3959
251 Ga0496116_0155399 3300048919 Bacteria 1263
252 Ga0496116_0185273 3300048919 Bacteria 1109
253 Ga0496116_0192106 3300048919 Bacteria 1079
254 Ga0496117_0000030 3300048920 Bacteria 389141
255 Ga0496117_0001006 3300048920 Bacteria 43135
256 Ga0496117_0011462 3300048920 Bacteria 7941
257 Ga0496117_0057991 3300048920 Bacteria 2684
258 Ga0496117_0176958 3300048920 Bacteria 1231
259 Ga0496118_0002190 3300048921 Bacteria 27152
260 Ga0496118_0002306 3300048921 Bacteria 25910
261 Ga0496118_0003748 3300048921 Bacteria 18793
262 Ga0496118_0010870 3300048921 Bacteria 8957
263 Ga0496118_0011605 3300048921 Bacteria 8578
264 Ga0496118_0017443 3300048921 Bacteria 6535
265 Ga0496118_0023636 3300048921 Bacteria 5331
266 Ga0496118_0030457 3300048921 Bacteria 4502
267 Ga0496118_0057602 3300048921 Bacteria 2911
268 Ga0496119_0008555 3300048922 Bacteria 8975
269 Ga0496119_0020971 3300048922 Bacteria 4738
270 Ga0496119_0050238 3300048922 Bacteria 2572
271 Ga0496119_0263082 3300048922 Bacteria 865
272 Ga0496119_0369202 3300048922 Bacteria 691
273 Ga0496120_0000148 3300048923 Bacteria 116605
274 Ga0496120_0011016 3300048923 Bacteria 6245
275 Ga0496120_0068230 3300048923 Bacteria 1962
276 Ga0496121_0000174 3300048924 Bacteria 143186
277 Ga0496121_0004111 3300048924 Bacteria 19953
278 Ga0496121_0008832 3300048924 Bacteria 11736
279 Ga0496121_0021827 3300048924 Bacteria 6251
280 Ga0496121_0080657 3300048924 Bacteria 2579
281 Ga0496121_0110594 3300048924 Bacteria 2096
282 Ga0496121_0149829 3300048924 Bacteria 1718
283 Ga0496121_0187297 3300048924 Bacteria 1487
284 Ga0496122_0000024 3300048925 Bacteria 372400
285 Ga0496122_0000050 3300048925 Bacteria 267874
286 Ga0496122_0000185 3300048925 Bacteria 144350
287 Ga0496122_0002162 3300048925 Bacteria 28814
288 Ga0496122_0004155 3300048925 Bacteria 18276
289 Ga0496122_0022313 3300048925 Bacteria 5631
290 Ga0496122_0037419 3300048925 Bacteria 3906
291 Ga0496123_0000023 3300048926 Bacteria 346894
292 Ga0496123_0000105 3300048926 Bacteria 167806
293 Ga0496123_0000926 3300048926 Bacteria 45845
294 Ga0496123_0006469 3300048926 Bacteria 11336
295 Ga0496123_0022230 3300048926 Bacteria 4895
296 Ga0496123_0049273 3300048926 Bacteria 2826
297 Ga0496123_0084825 3300048926 Bacteria 1908
298 Ga0496123_0097870 3300048926 Bacteria 1717
299 Ga0496123_0121116 3300048926 Bacteria 1471
300 Ga0496123_0154901 3300048926 Bacteria 1230
301 Ga0496124_0000094 3300048927 Bacteria 189147
302 Ga0496124_0000111 3300048927 Bacteria 166285
303 Ga0496124_0000200 3300048927 Bacteria 117910
304 Ga0496124_0001598 3300048927 Bacteria 32591
305 Ga0496124_0001736 3300048927 Bacteria 30598
306 Ga0496124_0013394 3300048927 Bacteria 8007
307 Ga0496124_0016824 3300048927 Bacteria 6932
308 Ga0496124_0042659 3300048927 Bacteria 3905
309 Ga0496124_0052587 3300048927 Bacteria 3459
310 Ga0496124_0107353 3300048927 Bacteria 2252
311 Ga0496124_0288584 3300048927 Bacteria 1192
312 Ga0496124_0370792 3300048927 Bacteria 1005
313 Ga0496125_0000617 3300048928 Bacteria 60041
314 Ga0496125_0000982 3300048928 Bacteria 44569
315 Ga0496125_0002851 3300048928 Bacteria 21764
316 Ga0496125_0022315 3300048928 Bacteria 5881
317 Ga0496125_0055100 3300048928 Bacteria 3243
318 Ga0496125_0151040 3300048928 Bacteria 1595
319 Ga0496125_0174015 3300048928 Bacteria 1443
320 Ga0496126_0000808 3300048929 Bacteria 56013
321 Ga0496126_0045668 3300048929 Bacteria 4024
322 Ga0496126_0148176 3300048929 Bacteria 2013
323 Ga0496126_0182078 3300048929 Bacteria 1784
324 Ga0496126_0586892 3300048929 Bacteria 879
325 Ga0501031_0054615 3300049568 Bacteria 2602
326 Ga0501031_0131255 3300049568 Bacteria 1637
327 Ga0501031_0183212 3300049568 Bacteria 1368
328 Ga0501032_0005297 3300049569 Bacteria 9593
329 Ga0501032_0183065 3300049569 Bacteria 1371
330 Ga0501032_0220990 3300049569 Bacteria 1233
331 Ga0501032_0267021 3300049569 Bacteria 1109
332 Ga0501033_0000660 3300049570 Bacteria 31872
333 Ga0501033_0001575 3300049570 Bacteria 20086
334 Ga0501033_0022222 3300049570 Bacteria 4786
335 Ga0501034_0071996 3300049571 Bacteria 3465
336 Ga0501034_0091868 3300049571 Bacteria 3033
337 Ga0501034_0206255 3300049571 Bacteria 1922
338 Ga0501034_0356986 3300049571 Bacteria 1389
339 Ga0501036_0067580 3300049572 Bacteria 3024
340 Ga0501036_0397020 3300049572 Bacteria 1150
341 Ga0501037_0000105 3300049573 Bacteria 79431
342 Ga0501037_0120247 3300049573 Bacteria 1889
343 Ga0501037_0183948 3300049573 Bacteria 1482
344 Ga0501037_0383042 3300049573 Bacteria 966
345 Ga0501038_0039069 3300049574 Bacteria 4153
346 Ga0501038_0059957 3300049574 Bacteria 3258
347 Ga0501038_0069505 3300049574 Bacteria 2991
348 Ga0501038_0199017 3300049574 Bacteria 1609
349 Ga0501038_0496216 3300049574 Bacteria 934
350 Ga0501043_0000055 3300049579 Bacteria 105522
351 Ga0501043_0104852 3300049579 Bacteria 2222
352 Ga0501043_0497314 3300049579 Bacteria 911
353 Ga0501046_0174330 3300049580 Bacteria 1612
354 Ga0501046_0318423 3300049580 Bacteria 1134
355 Ga0501047_0023470 3300049581 Bacteria 5921
356 Ga0501047_0071714 3300049581 Bacteria 3334
357 Ga0501047_0107587 3300049581 Bacteria 2670
358 Ga0501047_0156463 3300049581 Bacteria 2153
359 Ga0501047_0167786 3300049581 Bacteria 2065
360 Ga0501048_0109571 3300049582 Bacteria 1950
361 Ga0501067_0017282 3300049583 Bacteria 3987
362 Ga0501067_0054120 3300049583 Bacteria 2223
363 Ga0501067_0123069 3300049583 Bacteria 1444
364 Ga0501068_0009194 3300049584 Bacteria 5521
365 Ga0501068_0070969 3300049584 Bacteria 2126
366 Ga0501068_0516459 3300049584 Bacteria 775
367 Ga0501069_0000106 3300049585 Bacteria 38605
368 Ga0501069_0112675 3300049585 Bacteria 1550
369 Ga0501070_0000781 3300049586 Bacteria 28933
370 Ga0501070_0001320 3300049586 Bacteria 22173
371 Ga0501070_0142531 3300049586 Bacteria 1978
372 Ga0501070_0152900 3300049586 Bacteria 1903
373 Ga0501070_0238007 3300049586 Bacteria 1490
374 Ga0501070_0266115 3300049586 Bacteria 1401
375 Ga0501070_0394049 3300049586 Bacteria 1121
376 Ga0501071_0001762 3300049587 Bacteria 12758
377 Ga0501071_0193866 3300049587 Bacteria 1525
378 Ga0501072_0097151 3300049588 Bacteria 2341
379 Ga0501073_0023715 3300049589 Bacteria 4405
380 Ga0501073_0024175 3300049589 Bacteria 4362
381 Ga0501073_0025307 3300049589 Bacteria 4258
382 Ga0501073_0096109 3300049589 Bacteria 2057
383 Ga0501073_0176258 3300049589 Bacteria 1480
384 Ga0501073_0319877 3300049589 Bacteria 1071
385 Ga0501074_0000072 3300049590 Bacteria 48714
386 Ga0501080_0000168 3300049742 Bacteria 47595
387 Ga0501080_0000878 3300049742 Bacteria 24606
388 Ga0501080_0008305 3300049742 Bacteria 9406
389 Ga0501080_0035396 3300049742 Bacteria 4660
390 Ga0501080_0267537 3300049742 Bacteria 1556
391 Ga0501080_0488566 3300049742 Bacteria 1101
392 Ga0501080_0722347 3300049742 Bacteria 878
393 Ga0501083_0000484 3300049744 Bacteria 25530
394 Ga0501083_0079445 3300049744 Bacteria 2175
395 Ga0501083_0169681 3300049744 Bacteria 1426
396 Ga0501035_0000183 3300049822 Bacteria 76563
397 Ga0501035_0001424 3300049822 Bacteria 24501
398 Ga0501035_0005434 3300049822 Bacteria 12047
399 Ga0501035_0006107 3300049822 Bacteria 11338
400 Ga0501035_0039921 3300049822 Bacteria 4244
401 Ga0501035_0114580 3300049822 Bacteria 2360
402 Ga0501035_0167227 3300049822 Bacteria 1901
403 Ga0501044_0000009 3300049823 Bacteria 270072
404 Ga0501044_0135965 3300049823 Bacteria 2449
405 Ga0501044_0157562 3300049823 Bacteria 2249
406 Ga0501044_0183787 3300049823 Bacteria 2056
407 Ga0501044_0360423 3300049823 Bacteria 1372
408 Ga0501044_0820209 3300049823 Bacteria 808
409 nmdc:mga00v17_21_c1 3300050491 Bacteria 55853
410 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
411 nmdc:mga00v17_82643_c1 3300050491 Bacteria 2008
412 nmdc:mga0yw44_295177_c1 3300050492 Bacteria 1085
413 nmdc:mga0yw44_60711_c1 3300050492 Bacteria 2317
414 nmdc:mga0yw44_66335_c1 3300050492 Bacteria 2227
415 nmdc:mga0k408_97687_c1 3300050493 Bacteria 1730
416 nmdc:mga06z11_12959_c1 3300050494 Bacteria 3643
417 nmdc:mga04h51_117122_c1 3300050495 Bacteria 989
418 nmdc:mga07m45_214226_c1 3300050496 Bacteria 1120
419 nmdc:mga07m45_26282_c1 3300050496 Bacteria 3199
420 nmdc:mga0qj67_180062_c1 3300050509 Bacteria 1716
421 nmdc:mga0sz30_32490_c1 3300050516 Bacteria 2165
422 Ga0500578_0043993 3300053086 Bacteria 2866
423 Ga0500644_0026631 3300053088 Bacteria 1791
424 Ga0500560_000117 3300053107 Bacteria 8346
425 Ga0500594_0020130 3300053118 Bacteria 1661
426 Ga0500608_114103 3300053122 Bacteria 1235
427 Ga0500618_000008 3300053125 Bacteria 214678
428 Ga0500618_000249 3300053125 Bacteria 42747
429 Ga0500618_003707 3300053125 Bacteria 5137
430 Ga0500658_0000229 3300053134 Bacteria 26848
431 Ga0500658_0024221 3300053134 Bacteria 2324
432 Ga0500559_0002561 3300053136 Bacteria 9324
433 Ga0500561_0000067 3300053137 Bacteria 20534
434 Ga0500568_0001013 3300053139 Bacteria 19244
435 Ga0500604_0008820 3300053151 Bacteria 2678
436 Ga0500622_0000185 3300053156 Bacteria 66073
437 Ga0500622_0002549 3300053156 Bacteria 13052
438 Ga0500633_0001027 3300053160 Bacteria 4960
439 Ga0500636_0000038 3300053177 Bacteria 70653
440 Ga0500636_0000888 3300053177 Bacteria 16050
441 Ga0501082_0040730 3300060353 Bacteria 4006
442 Ga0501082_0106712 3300060353 Bacteria 2423
443 Ga0501082_0779776 3300060353 Bacteria 836
444 2509385459 2509276021 Bacteria 7634384
445 2509448493 2509276033 Bacteria 7180565
446 2510307680 2510065057 Bacteria 6649661
447 2510840794 2510461069 Bacteria 5505000
448 2510900263 2510461076 Bacteria 8618824
449 2511132880 2510917022 Bacteria 6504556
450 2511197606 2510917030 Bacteria 7460662
451 2512974811 2512875026 Bacteria 6861065
452 2513569675 2513237084 Bacteria 7231967
453 2513576508 2513237085 Bacteria 7695351
454 2513603854 2513237089 Bacteria 6553624
455 2513709731 2513237103 Bacteria 7647401
456 2513911724 2513237144 Bacteria 7530820
457 2513927697 2513237146 Bacteria 7166346
458 2513984759 2513237156 Bacteria 6402557
459 2514001172 2513237159 Bacteria 6810126
460 2514001373 2513237159 Bacteria 6810126
461 2514004190 2513237160 Bacteria 6650282
462 2514018731 2513237162 Bacteria 7468464
463 2515658412 2515154116 Bacteria 7552979
464 2515741890 2515154134 Bacteria 7220242
465 2516897915 2516653046 Bacteria 6989037
466 2517080971 2516653085 Bacteria 7346596
467 2517567458 2517487022 Bacteria 7227575
468 2524453185 2524023207 Bacteria 6813453
469 2524457150 2524023209 Bacteria 6679728
470 2535486598 2534681786 Bacteria 3308809
471 2537873124 2537561587 Bacteria 5425293
472 2554244471 2554235003 Bacteria 5877155
473 2559297684 2558860242 Bacteria 5568029
474 2561467716 2558860983 Bacteria 4133860
475 2585202807 2582581294 Bacteria 6626667
476 2585221670 2582581298 Bacteria 7315509
477 2585255829 2582581304 Bacteria 5831370
478 2585272405 2582581307 Bacteria 6597605
479 2585397586 2582581866 Bacteria 6859583
480 2585524141 2585427526 Bacteria 7258840
481 2585539177 2585427528 Bacteria 6842387
482 2585544160 2585427529 Bacteria 7395659
483 2585561532 2585427531 Bacteria 6992870
484 2585837129 2585427593 Bacteria 7141551
485 2585847625 2585427594 Bacteria 6180594
486 2585899380 2585427608 Bacteria 6544331
487 2585906760 2585427609 Bacteria 6667127
488 2587982181 2585428125 Bacteria 6662905
489 2599335933 2599185156 Bacteria 5403036
490 2599414625 2599185170 Bacteria 7295545
491 2599603749 2599185210 Bacteria 5624189
492 2599720500 2599185236 Bacteria 6875203
493 2601612478 2600255279 Bacteria 5605316
494 2601749019 2600255308 Bacteria 5611129
495 2616295165 2615840624 Bacteria 6557588
496 2616552563 2615840698 Bacteria 7319877
497 2643917487 2643221582 Bacteria 5804683
498 2644299458 2643221653 Bacteria 4569637
499 2644522661 2643221693 Bacteria 5513853
500 2644657686 2643221719 Bacteria 4568197
501 2671112980 2667528174 Bacteria 6435400
502 2723029348 2721755556 Bacteria 6745503
503 2724107714 2721755823 Bacteria 6752556
504 2730105662 2728369352 Bacteria 6745171
505 2738803967 2738541293 Bacteria 7065685
506 2738805716 2738541293 Bacteria 7065685
507 2738946743 2738541317 Bacteria 5340176
508 2739033625 2738541333 Bacteria 7106503
509 2793317237 2791355259 Bacteria 7254731
510 2793325993 2791355261 Bacteria 6661293
511 2793340156 2791355263 Bacteria 6872478
512 2793366565 2791355267 Bacteria 7222458
513 2802718347 2802428858 Bacteria 6636079
514 2802725859 2802428859 Bacteria 6667919
515 2802731433 2802428860 Bacteria 6525526
516 2802736376 2802428861 Bacteria 6534206
517 2802744350 2802428862 Bacteria 6633353
518 2802750060 2802428863 Bacteria 6410669
519 2805928052 2802429605 Bacteria 6875453
520 2806044876 2802429633 Bacteria 7341974
521 2806053965 2802429634 Bacteria 7083200
522 2806059943 2802429635 Bacteria 7650140
523 2806066002 2802429636 Bacteria 7597525
524 2806075533 2802429637 Bacteria 7067217
525 2808874732 2808606365 Bacteria 4301966
526 2808989195 2808606387 Bacteria 5697198
527 2819244034 2818991272 Bacteria 4622173
528 2819557731 2818991439 Bacteria 6907412
529 2819610272 2818991448 Bacteria 6772224
530 2819682542 2818991461 Bacteria 7026071
531 2821128940 2821123053 Bacteria 7836056
532 2838033825 2838029111 Bacteria 6603031
533 2838036986 2838035591 Bacteria 7166484
534 2838050513 2838048938 Bacteria 6044578
535 2838063211 2838061910 Bacteria 6794874
536 2838661969 2838661181 Bacteria 7385261
537 2838671442 2838668709 Bacteria 6671819
538 2838679882 2838675328 Bacteria 4909118
539 2838694055 2838686498 Bacteria 7807632
540 2838704291 2838701080 Bacteria 6669771
541 2838717679 2838714209 Bacteria 5525906
542 2838724453 2838719591 Bacteria 5523910
543 2838729605 2838724970 Bacteria 4908691
544 2838734713 2838729681 Bacteria 7400765
545 2838742255 2838736955 Bacteria 5760694
546 2838749521 2838742623 Bacteria 7396178
547 2840882656 2840878972 Bacteria 5483153
548 2841846111 2841840854 Bacteria 5761912
549 2841850044 2841846520 Bacteria 5345850
550 2841858822 2841851746 Bacteria 7532261
551 2841861171 2841859092 Bacteria 5436171
552 2841869719 2841864319 Bacteria 6742987
553 2842117573 2842110456 Bacteria 7656360
554 2842128516 2842124991 Bacteria 5346824
555 2842134564 2842130223 Bacteria 4909145
556 2842145815 2842140634 Bacteria 5759631
557 2842149091 2842146304 Bacteria 5957337
558 2842156604 2842152218 Bacteria 4908957
559 2842163019 2842156927 Bacteria 6894975
560 2842167002 2842163707 Bacteria 6916235
561 2842173924 2842170452 Bacteria 5525737
562 2842180225 2842175837 Bacteria 4908771
563 2842186628 2842180545 Bacteria 6888678
564 2842192224 2842187318 Bacteria 5524014
565 2842195209 2842192696 Bacteria 6147454
566 2842216496 2842211629 Bacteria 5523832
567 2842229260 2842224351 Bacteria 5524473
568 2842236835 2842229732 Bacteria 7475766
569 2842250478 2842243621 Bacteria 7421798
570 2842253742 2842250916 Bacteria 6579627
571 2842260952 2842257432 Bacteria 7401195
572 2842267973 2842264693 Bacteria 6472963
573 2842276243 2842271015 Bacteria 7807131
574 2842299296 2842298080 Bacteria 6123127
575 2842311822 2842311132 Bacteria 6616990
576 2842318949 2842317721 Bacteria 6793725
577 2842343958 2842341865 Bacteria 7003929
578 2842358763 2842357229 Bacteria 6485165
579 2842369731 2842363717 Bacteria 6844742
580 2842432136 2842428310 Bacteria 6767288
581 2842438248 2842434925 Bacteria 6502746
582 2842443944 2842441272 Bacteria 6769273
583 2842454015 2842447887 Bacteria 6754142
584 2842466234 2842462802 Bacteria 6588055
585 2842472782 2842469257 Bacteria 6752936
586 2842480572 2842475841 Bacteria 6603183
587 2842491861 2842489311 Bacteria 6620893
588 2842499468 2842495871 Bacteria 6820686
589 2842507147 2842502639 Bacteria 6604161
590 2842512194 2842509118 Bacteria 6850950
591 2842518562 2842515876 Bacteria 5436280
592 2842526851 2842521101 Bacteria 6569494
593 2842527001 2842521101 Bacteria 6569494
594 2842926913 2842922631 Bacteria 5824079
595 2844461180 2844454524 Bacteria 7952546
596 2854899817 2854896431 Bacteria 5869725
597 2854916464 2854911287 Bacteria 5582813
598 2854920963 2854916844 Bacteria 5725939
599 2857536403 2857531043 Bacteria 6754041
600 2891374601 2891373044 Bacteria 5202277
601 2899793077 2899792073 Bacteria 4926588
602 2899808282 2899803654 Bacteria 5577784
603 2899849721 2899845264 Bacteria 5672268
604 2913311899 2913308742 Bacteria 5350706
605 2915652644 2915650412 Bacteria 4288180
606 2915981002 2915980308 Bacteria 6624279
607 2916026323 2916021584 Bacteria 6854472
608 2916053787 2916048683 Bacteria 6543552
609 2916064530 2916061851 Bacteria 6737736
610 2916081010 2916076590 Bacteria 6596108
611 2919103390 2919100787 Bacteria 7710546
612 2919117959 2919114240 Bacteria 5700270
613 2919412769 2919408235 Bacteria 6149349
614 2919455086 2919450847 Bacteria 5631160
615 2921251342 2921250672 Bacteria 6677771
616 2921263300 2921257292 Bacteria 6808382
617 2926757728 2926754445 Bacteria 5964435
618 2926764647 2926760298 Bacteria 5505990
619 2929143808 2929138655 Bacteria 5810547
620 2933010343 2933006813 Bacteria 4912075
621 2933014188 2933011516 Bacteria 5439334
622 2933017445 2933016740 Bacteria 6355406
623 2933591819 2933586486 Bacteria 7667493
624 2933597212 2933594066 Bacteria 5594265
625 2935905714 2935901341 Bacteria 7341747
626 2936370605 2936367885 Bacteria 7324495
627 2936377831 2936375103 Bacteria 6652732
628 2937024426 2937023124 Bacteria 6815156
629 2937035932 2937029754 Bacteria 6424026
630 2937036398 2937036028 Bacteria 6846469
631 2937084783 2937078374 Bacteria 6610289
632 2937089170 2937084907 Bacteria 6618516
633 2945945396 2945941187 Bacteria 4682474
634 2957376038 2957375807 Bacteria 6425588
635 2957385887 2957382221 Bacteria 6737050
636 2957400610 2957395598 Bacteria 6822399
637 2957406082 2957402308 Bacteria 6741770
638 2957439626 2957437181 Bacteria 6568994
639 2960592508 2960591022 Bacteria 6622873
640 2960636107 2960631154 Bacteria 6732508
641 2960681145 2960680706 Bacteria 6624464
642 2960694064 2960693952 Bacteria 6749742
643 2964620966 2964615318 Bacteria 6809089
644 2967691992 2967686174 Bacteria 6678622
645 2967733384 2967728569 Bacteria 6641507
646 2967756058 2967755722 Bacteria 6814706
647 2970029675 2970026789 Bacteria 6785236
648 2970103830 2970102677 Bacteria 6812532
649 2970124191 2970122695 Bacteria 6625855
650 2970144915 2970143518 Bacteria 6446480
651 2977537266 2977530762 Bacteria 6951399
652 2977550117 2977544691 Bacteria 6875412
653 2979090242 2979089926 Bacteria 5670289
654 2979095772 2979095461 Bacteria 5669583
655 2979102771 2979100975 Bacteria 5423623
656 2984509340 2984509177 Bacteria 5274802
657 2984519960 2984518228 Bacteria 5277463
658 2984537670 2984537506 Bacteria 5277481
659 2984604418 2984601300 Bacteria 5455244
660 2989351871 2989349275 Bacteria 6349068
661 2989776348 2989771324 Bacteria 5605128
662 2989780570 2989776772 Bacteria 4843317
663 2995397141 2995392953 Bacteria 4539380
664 2996891425 2996887358 Bacteria 5795980
665 2996896983 2996893221 Bacteria 5823108
666 3005413990 3005409236 Bacteria 7188837
667 3005421040 3005416602 Bacteria 7064308
668 3005451512 3005445848 Bacteria 6906074
669 639651635 639633055 Bacteria 7751309
670 650844129 650716007 Bacteria 5573770
671 8001847062 8001845381 Bacteria 5804942
672 8003573317 8003570095 Bacteria 5747666
673 8003575219 8003570095 Bacteria 5747666
674 8004006176 8003999396 Bacteria 7063185
675 8005250278 8005246636 Bacteria 4933972
676 8005263976 8005258706 Bacteria 6184835
677 8005305074 8005301065 Bacteria 6614431
678 8005313158 8005307578 Bacteria 7395396
679 8005319225 8005314921 Bacteria 7072929
680 8005325952 8005321885 Bacteria 5795980
681 8005388504 8005382845 Bacteria 6732062
682 8005397674 8005395548 Bacteria 6806915
683 8005489442 8005484373 Bacteria 6297373
684 8005562080 8005556819 Bacteria 6908598
685 8005576261 8005570704 Bacteria 6957481
686 8005648046 8005645114 Bacteria 6950293
687 8005662109 8005658619 Bacteria 4500593
688 8005683981 8005682033 Bacteria 6726518
689 8005689382 8005688590 Bacteria 6610080
690 8018165876 8018163183 Bacteria 7277977
691 8023682335 8023680758 Bacteria 7729763
692 8024505529 8024501048 Bacteria 6427847
693 8046774614 8046767195 Bacteria 7547379
694 8054465380 8054460903 Bacteria 4872905
695 8054561614 8054558443 Bacteria 5204801
696 8055435457 8055431914 Bacteria 4551896
697 8056375228 8056375014 Bacteria 7006639
698 8057581386 8057575449 Bacteria 7367519
699 Ga0373927_0000144
700 JGI24740J21852_10001244
701 JGI25155J39150_1000226
702 JGI25156J39149_1000523
703 JGI25162J39368_1000643
704 JGI25154J39366_1000435
705 JGI25157J39369_1000562
706 JGI25152J39213_1000009
707 JGI25152J39213_1008711
708 JGI25152J39213_1009380
709 JGI25152J39213_1014774
710 JGI25152J39213_1015361
711 JGI25150J39212_1000016
712 JGI25150J39212_1005997
713 JGI25150J39212_1011588
714 JGI25159J45721_1000259
715 JGI25151J46595_10000073
716 JGI25151J46595_10000450
717 JGI25151J46595_10001434
718 JGI25151J46595_10025744
719 JGI25151J46595_10050188
720 JGI25151J46595_10054489
721 JGI25165J46597_1000018
722 JGI25153J46596_10003932
723 JGI25153J46596_10008815
724 JGI25153J46596_10024670
725 JGI25153J46596_10041356
726 rootL2_10016841
727 rootH1_10098563
728 JGI25160J50197_1000364
729 JGI25160J50197_1016250
730 JGI25161J50226_1006152
731 Ga0006562J51391_1027838
732 Ga0055526_1009616
733 Ga0055526_1014607
734 Ga0055526_1015707
735 Ga0055524_1004472
736 Ga0055524_1012855
737 Ga0055524_1031158
738 Ga0055528_1001290
739 Ga0055528_1001322
740 Ga0055528_1012995
741 Ga0055528_1027432
742 Ga0055528_1050765
743 Ga0055540_1001625
744 Ga0055540_1019472
745 Ga0058692_1005506
746 Ga0055543_1000651
747 Ga0065165_1005129
748 Ga0065165_1014429
749 Ga0070670_100000287
750 Ga0070668_100107213
751 Ga0070671_100031183
752 Ga0070665_100010868
753 Ga0068856_100027127
754 Ga0075365_10005711
755 Ga0075368_10067649
756 Ga0075363_100016811
757 Ga0075364_10000583
758 Ga0075364_10050795
759 Ga0075362_10005537
760 Ga0075362_10026588
761 Ga0075367_10016961
762 Ga0075367_10156144
763 Ga0075367_10217670
764 Ga0075367_10234347
765 Ga0075369_10030550
766 Ga0075369_10050769
767 Ga0075369_10082583
768 Ga0075369_10166983
769 Ga0075366_10008700
770 Ga0075370_10017116
771 Ga0075430_100205450
772 Ga0079104_1000014
773 Ga0099826_10000053
774 Ga0099826_10005883
775 Ga0099826_10153541
776 Ga0105251_10040255
777 Ga0105248_10849350
778 Ga0105249_10394621
779 Ga0105246_10004159
780 Ga0157373_10015004
781 Ga0157371_10000005
782 Ga0157370_10000036
783 Ga0157372_10680746
784 Ga0228711_1023082
785 Ga0228710_1016272
786 Ga0209435_100025
787 Ga0209436_100044
788 Ga0209437_100022
789 Ga0207425_1000054
790 Ga0207425_1000563
791 Ga0207425_1024755
792 Ga0207425_1046709
793 Ga0209646_1000083
794 Ga0209646_1011741
795 Ga0209026_1000078
796 Ga0209759_1000060
797 Ga0209129_1000016
798 Ga0209129_1000108
799 Ga0209129_1000153
800 Ga0209129_1001041
801 Ga0209129_1002193
802 Ga0209129_1004085
803 Ga0209129_1009206
804 Ga0209233_1000031
805 Ga0209673_1000005
806 Ga0209673_1000023
807 Ga0209673_1001431
808 Ga0209673_1001452
809 Ga0209673_1005673
810 Ga0209673_1007097
811 Ga0209130_1000001
812 Ga0209130_1016616
813 Ga0209130_1025554
814 Ga0209676_1013264
815 Ga0209025_1000072
816 Ga0209025_1000126
817 Ga0209025_1000189
818 Ga0209025_1000227
819 Ga0209025_1000954
820 Ga0209025_1009630
821 Ga0209025_1010879
822 Ga0209025_1026912
823 Ga0209025_1036759
824 Ga0209025_1090814
825 Ga0209564_1000100
826 Ga0209564_1001312
827 Ga0209564_1003600
828 Ga0209564_1005523
829 Ga0209564_1010874
830 Ga0209758_1000053
831 Ga0209758_1000162
832 Ga0209758_1002167
833 Ga0209758_1011606
834 Ga0209758_1013079
835 Ga0209758_1027442
836 Ga0209758_1032215
837 Ga0209758_1045185
838 Ga0209050_1010932
839 Ga0209256_1000956
840 Ga0209256_1001713
841 Ga0209256_1006645
842 Ga0209256_1018136
843 Ga0209256_1021660
844 Ga0207426_1000005
845 Ga0207426_1000035
846 Ga0207426_1002644
847 Ga0209051_1000062
848 Ga0209051_1000630
849 Ga0209051_1044105
850 Ga0209051_1060829
851 Ga0209257_1011782
852 Ga0207681_10023362
853 Ga0207650_10001289
854 Ga0207644_10261875
855 Ga0207702_10009256
856 Ga0209281_1000032
857 Ga0209281_1000554
858 Ga0209281_1007528
859 Ga0209371_1000003
860 Ga0209371_1001207
861 Ga0209371_1012366
862 Ga0209282_1000060
863 Ga0209282_1001174
864 Ga0268266_10010600
865 Ga0268256_1000004
866 Ga0268256_1030576
867 Ga0316181_1079939
868 Ga0316182_1428536
869 Ga0307513_10043500
870 Ga0307513_10108796
871 Ga0307406_10008039
872 Ga0307406_10067389
873 Ga0307412_10039559
874 Ga0307412_10403309
875 Ga0307412_10517421
876 Ga0315914_1000005
877 Ga0315914_1030781
878 Ga0307409_100084234
879 Ga0307409_100793380
880 Ga0315913_1001354
881 Ga0315915_1000004
882 Ga0315915_1035715
883 Ga0373955_0185960
884 Ga0316584_0156876
885 Ga0373925_0000481
886 Ga0395905_0013777
887 Ga0439436_0001082
888 Ga0439439_0019167
889 Ga0439461_0034509
890 Ga0439466_0034095
891 Ga0439465_0000386
892 Ga0439465_0003987
893 Ga0439465_0105511
894 Ga0451835_0302878
895 Ga0451839_0549133
896 Ga0451841_0526586
897 Ga0451845_0115605
898 Ga0451845_0358306
899 Ga0451851_0140896
900 Ga0451855_0979557
901 Ga0439432_051566
902 Ga0439432_077752
903 Ga0439449_0033267
904 Ga0439449_0037625
905 Ga0450906_020476
906 Ga0450918_017146
907 Ga0466965_0049964
908 Ga0466968_0086232
909 Ga0495650_0047131
910 Ga0495585_0036491
911 Ga0495606_0004576
912 Ga0495606_0018676
913 Ga0495606_0093923
914 Ga0495643_0092216
915 Ga0495643_0118616
916 Ga0495654_0000140
917 Ga0495597_0070166
918 Ga0495633_0119056
919 Ga0495656_0104992
920 Ga0495625_0003110
921 Ga0495625_0018939
922 Ga0495661_0327799
923 Ga0495588_0008240
924 Ga0495671_0041131
925 Ga0495649_0025746
926 Ga0495649_0179541
927 Ga0495660_0036074
928 Ga0495683_0082448
929 Ga0495681_0016697
930 Ga0495686_0000247
931 Ga0495686_0040644
932 Ga0495686_0060194
933 Ga0496101_0075561
934 Ga0496101_0081350
935 Ga0496103_0145236
936 Ga0496104_0039384
937 Ga0496104_0129961
938 Ga0496106_0000275
939 Ga0496110_0012841
940 Ga0496110_0781863
941 Ga0496111_0001401
942 Ga0496111_0042218
943 Ga0496113_0060840
944 Ga0496113_0187334
945 Ga0496116_0000540
946 Ga0496116_0003416
947 Ga0496116_0025286
948 Ga0496116_0029441
949 Ga0496116_0155399
950 Ga0496116_0185273
951 Ga0496116_0192106
952 Ga0496117_0000030
953 Ga0496117_0001006
954 Ga0496117_0011462
955 Ga0496117_0057991
956 Ga0496117_0176958
957 Ga0496118_0002190
958 Ga0496118_0002306
959 Ga0496118_0003748
960 Ga0496118_0010870
961 Ga0496118_0011605
962 Ga0496118_0017443
963 Ga0496118_0023636
964 Ga0496118_0030457
965 Ga0496118_0057602
966 Ga0496119_0008555
967 Ga0496119_0020971
968 Ga0496119_0050238
969 Ga0496119_0263082
970 Ga0496119_0369202
971 Ga0496120_0000148
972 Ga0496120_0011016
973 Ga0496120_0068230
974 Ga0496121_0000174
975 Ga0496121_0004111
976 Ga0496121_0008832
977 Ga0496121_0021827
978 Ga0496121_0080657
979 Ga0496121_0110594
980 Ga0496121_0149829
981 Ga0496121_0187297
982 Ga0496122_0000024
983 Ga0496122_0000050
984 Ga0496122_0000185
985 Ga0496122_0002162
986 Ga0496122_0004155
987 Ga0496122_0022313
988 Ga0496122_0037419
989 Ga0496123_0000023
990 Ga0496123_0000105
991 Ga0496123_0000926
992 Ga0496123_0006469
993 Ga0496123_0022230
994 Ga0496123_0049273
995 Ga0496123_0084825
996 Ga0496123_0097870
997 Ga0496123_0121116
998 Ga0496123_0154901
999 Ga0496124_0000094
1000 Ga0496124_0000111
1001 Ga0496124_0000200
1002 Ga0496124_0001598
1003 Ga0496124_0001736
1004 Ga0496124_0013394
1005 Ga0496124_0016824
1006 Ga0496124_0042659
1007 Ga0496124_0052587
1008 Ga0496124_0107353
1009 Ga0496124_0288584
1010 Ga0496124_0370792
1011 Ga0496125_0000617
1012 Ga0496125_0000982
1013 Ga0496125_0002851
1014 Ga0496125_0022315
1015 Ga0496125_0055100
1016 Ga0496125_0151040
1017 Ga0496125_0174015
1018 Ga0496126_0000808
1019 Ga0496126_0045668
1020 Ga0496126_0148176
1021 Ga0496126_0182078
1022 Ga0496126_0586892
1023 Ga0501031_0054615
1024 Ga0501031_0131255
1025 Ga0501031_0183212
1026 Ga0501032_0005297
1027 Ga0501032_0183065
1028 Ga0501032_0220990
1029 Ga0501032_0267021
1030 Ga0501033_0000660
1031 Ga0501033_0001575
1032 Ga0501033_0022222
1033 Ga0501034_0071996
1034 Ga0501034_0091868
1035 Ga0501034_0206255
1036 Ga0501034_0356986
1037 Ga0501036_0067580
1038 Ga0501036_0397020
1039 Ga0501037_0000105
1040 Ga0501037_0120247
1041 Ga0501037_0183948
1042 Ga0501037_0383042
1043 Ga0501038_0039069
1044 Ga0501038_0059957
1045 Ga0501038_0069505
1046 Ga0501038_0199017
1047 Ga0501038_0496216
1048 Ga0501043_0000055
1049 Ga0501043_0104852
1050 Ga0501043_0497314
1051 Ga0501046_0174330
1052 Ga0501046_0318423
1053 Ga0501047_0023470
1054 Ga0501047_0071714
1055 Ga0501047_0107587
1056 Ga0501047_0156463
1057 Ga0501047_0167786
1058 Ga0501048_0109571
1059 Ga0501067_0017282
1060 Ga0501067_0054120
1061 Ga0501067_0123069
1062 Ga0501068_0009194
1063 Ga0501068_0070969
1064 Ga0501068_0516459
1065 Ga0501069_0000106
1066 Ga0501069_0112675
1067 Ga0501070_0000781
1068 Ga0501070_0001320
1069 Ga0501070_0142531
1070 Ga0501070_0152900
1071 Ga0501070_0238007
1072 Ga0501070_0266115
1073 Ga0501070_0394049
1074 Ga0501071_0001762
1075 Ga0501071_0193866
1076 Ga0501072_0097151
1077 Ga0501073_0023715
1078 Ga0501073_0024175
1079 Ga0501073_0025307
1080 Ga0501073_0096109
1081 Ga0501073_0176258
1082 Ga0501073_0319877
1083 Ga0501074_0000072
1084 Ga0501080_0000168
1085 Ga0501080_0000878
1086 Ga0501080_0008305
1087 Ga0501080_0035396
1088 Ga0501080_0267537
1089 Ga0501080_0488566
1090 Ga0501080_0722347
1091 Ga0501083_0000484
1092 Ga0501083_0079445
1093 Ga0501083_0169681
1094 Ga0501035_0000183
1095 Ga0501035_0001424
1096 Ga0501035_0005434
1097 Ga0501035_0006107
1098 Ga0501035_0039921
1099 Ga0501035_0114580
1100 Ga0501035_0167227
1101 Ga0501044_0000009
1102 Ga0501044_0135965
1103 Ga0501044_0157562
1104 Ga0501044_0183787
1105 Ga0501044_0360423
1106 Ga0501044_0820209
1107 nmdc:mga00v17_21_c1
1108 nmdc:mga00v17_34_c1
1109 nmdc:mga00v17_82643_c1
1110 nmdc:mga0yw44_295177_c1
1111 nmdc:mga0yw44_60711_c1
1112 nmdc:mga0yw44_66335_c1
1113 nmdc:mga0k408_97687_c1
1114 nmdc:mga06z11_12959_c1
1115 nmdc:mga04h51_117122_c1
1116 nmdc:mga07m45_214226_c1
1117 nmdc:mga07m45_26282_c1
1118 nmdc:mga0qj67_180062_c1
1119 nmdc:mga0sz30_32490_c1
1120 Ga0500578_0043993
1121 Ga0500644_0026631
1122 Ga0500560_000117
1123 Ga0500594_0020130
1124 Ga0500608_114103
1125 Ga0500618_000008
1126 Ga0500618_000249
1127 Ga0500618_003707
1128 Ga0500658_0000229
1129 Ga0500658_0024221
1130 Ga0500559_0002561
1131 Ga0500561_0000067
1132 Ga0500568_0001013
1133 Ga0500604_0008820
1134 Ga0500622_0000185
1135 Ga0500622_0002549
1136 Ga0500633_0001027
1137 Ga0500636_0000038
1138 Ga0500636_0000888
1139 Ga0501082_0040730
1140 Ga0501082_0106712
1141 Ga0501082_0779776
1142 2509385459
1143 2509448493
1144 2510307680
1145 2510840794
1146 2510900263
1147 2511132880
1148 2511197606
1149 2512974811
1150 2513569675
1151 2513576508
1152 2513603854
1153 2513709731
1154 2513911724
1155 2513927697
1156 2513984759
1157 2514001172
1158 2514001373
1159 2514004190
1160 2514018731
1161 2515658412
1162 2515741890
1163 2516897915
1164 2517080971
1165 2517567458
1166 2524453185
1167 2524457150
1168 2535486598
1169 2537873124
1170 2554244471
1171 2559297684
1172 2561467716
1173 2585202807
1174 2585221670
1175 2585255829
1176 2585272405
1177 2585397586
1178 2585524141
1179 2585539177
1180 2585544160
1181 2585561532
1182 2585837129
1183 2585847625
1184 2585899380
1185 2585906760
1186 2587982181
1187 2599335933
1188 2599414625
1189 2599603749
1190 2599720500
1191 2601612478
1192 2601749019
1193 2616295165
1194 2616552563
1195 2643917487
1196 2644299458
1197 2644522661
1198 2644657686
1199 2671112980
1200 2723029348
1201 2724107714
1202 2730105662
1203 2738803967
1204 2738805716
1205 2738946743
1206 2739033625
1207 2793317237
1208 2793325993
1209 2793340156
1210 2793366565
1211 2802718347
1212 2802725859
1213 2802731433
1214 2802736376
1215 2802744350
1216 2802750060
1217 2805928052
1218 2806044876
1219 2806053965
1220 2806059943
1221 2806066002
1222 2806075533
1223 2808874732
1224 2808989195
1225 2819244034
1226 2819557731
1227 2819610272
1228 2819682542
1229 2821128940
1230 2838033825
1231 2838036986
1232 2838050513
1233 2838063211
1234 2838661969
1235 2838671442
1236 2838679882
1237 2838694055
1238 2838704291
1239 2838717679
1240 2838724453
1241 2838729605
1242 2838734713
1243 2838742255
1244 2838749521
1245 2840882656
1246 2841846111
1247 2841850044
1248 2841858822
1249 2841861171
1250 2841869719
1251 2842117573
1252 2842128516
1253 2842134564
1254 2842145815
1255 2842149091
1256 2842156604
1257 2842163019
1258 2842167002
1259 2842173924
1260 2842180225
1261 2842186628
1262 2842192224
1263 2842195209
1264 2842216496
1265 2842229260
1266 2842236835
1267 2842250478
1268 2842253742
1269 2842260952
1270 2842267973
1271 2842276243
1272 2842299296
1273 2842311822
1274 2842318949
1275 2842343958
1276 2842358763
1277 2842369731
1278 2842432136
1279 2842438248
1280 2842443944
1281 2842454015
1282 2842466234
1283 2842472782
1284 2842480572
1285 2842491861
1286 2842499468
1287 2842507147
1288 2842512194
1289 2842518562
1290 2842526851
1291 2842527001
1292 2842926913
1293 2844461180
1294 2854899817
1295 2854916464
1296 2854920963
1297 2857536403
1298 2891374601
1299 2899793077
1300 2899808282
1301 2899849721
1302 2913311899
1303 2915652644
1304 2915981002
1305 2916026323
1306 2916053787
1307 2916064530
1308 2916081010
1309 2919103390
1310 2919117959
1311 2919412769
1312 2919455086
1313 2921251342
1314 2921263300
1315 2926757728
1316 2926764647
1317 2929143808
1318 2933010343
1319 2933014188
1320 2933017445
1321 2933591819
1322 2933597212
1323 2935905714
1324 2936370605
1325 2936377831
1326 2937024426
1327 2937035932
1328 2937036398
1329 2937084783
1330 2937089170
1331 2945945396
1332 2957376038
1333 2957385887
1334 2957400610
1335 2957406082
1336 2957439626
1337 2960592508
1338 2960636107
1339 2960681145
1340 2960694064
1341 2964620966
1342 2967691992
1343 2967733384
1344 2967756058
1345 2970029675
1346 2970103830
1347 2970124191
1348 2970144915
1349 2977537266
1350 2977550117
1351 2979090242
1352 2979095772
1353 2979102771
1354 2984509340
1355 2984519960
1356 2984537670
1357 2984604418
1358 2989351871
1359 2989776348
1360 2989780570
1361 2995397141
1362 2996891425
1363 2996896983
1364 3005413990
1365 3005421040
1366 3005451512
1367 639651635
1368 650844129
1369 8001847062
1370 8003573317
1371 8003575219
1372 8004006176
1373 8005250278
1374 8005263976
1375 8005305074
1376 8005313158
1377 8005319225
1378 8005325952
1379 8005388504
1380 8005397674
1381 8005489442
1382 8005562080
1383 8005576261
1384 8005648046
1385 8005662109
1386 8005683981
1387 8005689382
1388 8018165876
1389 8023682335
1390 8024505529
1391 8046774614
1392 8054465380
1393 8054561614
1394 8055435457
1395 8056375228
1396 8057581386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

34

247

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cdk-assembly1.cif.gz_C crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.9689 1 220
4kgb-assembly1.cif.gz_A structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.9648 3 220
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.9639 3 220
3dlx-assembly1.cif.gz_B crystal structure of human 3-oxoacid coa transferase 1 0.9626 3 217
1o9l-assembly2.cif.gz_C succinate:coenzyme-a transferase (pig heart) 0.9623 3 217
ID Description Score Start End Superfamily
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9594 2 223 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9567 3 218 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9565 1 223 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9484 3 218 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9481 3 218 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A1Y3LAV9-F1-model_v4 3-oxoadipate CoA-transferase (EC 2.8.3.6) 0.9918 1 218 GO:0042952
GO:0047569
AF-K0Q5N2-F1-model_v4 3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6) 0.9917 1 234 GO:0047569
AF-D4GN25-F1-model_v4 PcaI 0.9917 2 223 GO:0008410
AF-A0A0H4W6H8-F1-model_v4 deleted 0.9906 1 222
AF-A0A372LFN4-F1-model_v4 3-oxoacid CoA-transferase subunit A 0.9905 1 218 GO:0008410

Map