F475969

General Info

Members Datasets Scaffolds Average Seq Length
698 334 687 379

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0033507|Ga0436364_0033507_98_1483
Length 461
Sequence MAGHVPGHVLFYCAVPHSRDLTFSIVGNGGRIAIGWSNERRTSNLGVTDYLAAVPSIRRLNLTRFRSYRSAAIGTSANLVVLTGPNGAGKTNLLEAISFLSPGRGLRRARLDDVGYRDRGRHGCKHRGEDAGIGGGVRSWAVSAEVDGALGLANLGTGLEPASFLGPAGAGEAVLSRACRIDREPVGSAAAFADHLRLVWLVPEMDGLFLGSASERRRFLDRLVLAVDAAHAARVAGLERALRSRNRLLEQLAEHRDHDPRWLDAAEQEASTLAVVVAAARAETVRRLAGALAARPAKQNSFPSAEVAVDGWLENLVVTGPAIEAEDRYRAVLRDNRARDAAAGRTLVGPHLSDFAVVYREKALPAGDASTGEQKALLIALVLAHAGLVTAMTGMAPVVLLDEVVAHLDPARRAALFDALEAIGAQVWMTGADPATFVDLGQRADMFDVRDLSCDVPAAMG

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
5 2909042592 Labrys sp. LIt4 Isolate Nodule
6 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
7 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
322 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
331 641522639 Methylobacterium sp. 4-46 Isolate Nodule
332 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
333 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
334 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 1
Rhizoplane 5.73
Rhizosphere 84.1
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007117 3300003203 Bacteria 5125
2 JGI25153J46596_10002083 3300003215 Bacteria 11762
3 JGI25153J46596_10003147 3300003215 Bacteria 9308
4 JGI25153J46596_10006762 3300003215 Bacteria 5750
5 Ga0070676_10043602 3300005328 Bacteria 2608
6 Ga0070690_100129472 3300005330 Bacteria 1703
7 Ga0070670_100056259 3300005331 Bacteria 3376
8 Ga0070670_100075627 3300005331 Bacteria 2893
9 Ga0070677_10006415 3300005333 Bacteria 3907
10 Ga0070677_10033564 3300005333 Bacteria 1977
11 Ga0070680_100003784 3300005336 Bacteria 11309
12 Ga0070682_100031186 3300005337 Bacteria 3223
13 Ga0068868_100002623 3300005338 Bacteria 12471
14 Ga0070689_100011341 3300005340 Bacteria 6380
15 Ga0070689_100015423 3300005340 Bacteria 5571
16 Ga0070687_100021537 3300005343 Bacteria 3032
17 Ga0070661_100129529 3300005344 Bacteria 1894
18 Ga0070675_100124035 3300005354 Bacteria 2197
19 Ga0070671_100002901 3300005355 Bacteria 13344
20 Ga0070674_100005761 3300005356 Bacteria 7189
21 Ga0070673_100056398 3300005364 Bacteria 3100
22 Ga0070688_100008590 3300005365 Bacteria 5555
23 Ga0070688_100090839 3300005365 Bacteria 1995
24 Ga0070688_100101294 3300005365 Bacteria 1899
25 Ga0070659_100007423 3300005366 Bacteria 7963
26 Ga0070667_100024338 3300005367 Bacteria 5029
27 Ga0070667_100124451 3300005367 Bacteria 2246
28 Ga0070709_10004047 3300005434 Bacteria 7909
29 Ga0070709_10023880 3300005434 Bacteria 3595
30 Ga0070714_100028556 3300005435 Bacteria 4630
31 Ga0070714_100091746 3300005435 Bacteria 2662
32 Ga0070714_100097321 3300005435 Bacteria 2587
33 Ga0070713_100018647 3300005436 Bacteria 5275
34 Ga0070713_100034533 3300005436 Bacteria 4064
35 Ga0070713_100146154 3300005436 Bacteria 2099
36 Ga0070713_100192177 3300005436 Bacteria 1840
37 Ga0070710_10012502 3300005437 Bacteria 4217
38 Ga0070711_100032154 3300005439 Bacteria 3487
39 Ga0070711_100038994 3300005439 Bacteria 3197
40 Ga0070711_100068347 3300005439 Bacteria 2496
41 Ga0070711_100227183 3300005439 Unclassified 1454
42 Ga0070700_100137114 3300005441 Bacteria 1658
43 Ga0070678_100040542 3300005456 Bacteria 3295
44 Ga0070662_100020173 3300005457 Bacteria 4536
45 Ga0070681_10001010 3300005458 Bacteria 23785
46 Ga0070681_10007499 3300005458 Bacteria 10662
47 Ga0068867_100019168 3300005459 Bacteria 4873
48 Ga0070685_10105051 3300005466 Bacteria 1730
49 Ga0070698_100048964 3300005471 Bacteria 4316
50 Ga0070679_100010240 3300005530 Bacteria 8891
51 Ga0070679_100066634 3300005530 Bacteria 3589
52 Ga0070679_100182565 3300005530 Bacteria 2070
53 Ga0070679_100289343 3300005530 Bacteria 1590
54 Ga0070697_100014105 3300005536 Bacteria 6276
55 Ga0070697_100103146 3300005536 Bacteria 2371
56 Ga0068853_100005846 3300005539 Bacteria 9691
57 Ga0070672_100003393 3300005543 Bacteria 10322
58 Ga0070695_100003310 3300005545 Bacteria 9419
59 Ga0070704_100001522 3300005549 Bacteria 12496
60 Ga0068855_100003400 3300005563 Bacteria 19482
61 Ga0070664_100026016 3300005564 Bacteria 4852
62 Ga0068857_100130343 3300005577 Bacteria 2268
63 Ga0068857_100308193 3300005577 Bacteria 1460
64 Ga0070702_100058593 3300005615 Bacteria 2232
65 Ga0068859_100049426 3300005617 Bacteria 4223
66 Ga0068859_100181268 3300005617 Bacteria 2189
67 Ga0068859_100408670 3300005617 Bacteria 1453
68 Ga0068864_100109424 3300005618 Bacteria 2460
69 Ga0068864_100172550 3300005618 Bacteria 1973
70 Ga0068864_100225319 3300005618 Bacteria 1731
71 Ga0068863_100094543 3300005841 Bacteria 2837
72 Ga0068858_100208551 3300005842 Bacteria 1849
73 Ga0081455_10003898 3300005937 Bacteria 16987
74 Ga0081455_10024342 3300005937 Bacteria 5608
75 Ga0081538_10004768 3300005981 Bacteria 12398
76 Ga0081538_10051010 3300005981 Bacteria 2490
77 Ga0081540_1000105 3300005983 Bacteria 89863
78 Ga0081540_1001881 3300005983 Bacteria 17573
79 Ga0081540_1007650 3300005983 Bacteria 7667
80 Ga0081539_10000891 3300005985 Bacteria 57129
81 Ga0070717_10048077 3300006028 Bacteria 3498
82 Ga0070717_10178156 3300006028 Bacteria 1852
83 Ga0070717_10182202 3300006028 Bacteria 1831
84 Ga0075368_10021774 3300006042 Bacteria 2436
85 Ga0075363_100060200 3300006048 Bacteria 2044
86 Ga0075363_100116589 3300006048 Bacteria 1488
87 Ga0075364_10020580 3300006051 Bacteria 4151
88 Ga0075364_10112960 3300006051 Bacteria 1814
89 Ga0070715_10005445 3300006163 Bacteria 4243
90 Ga0070716_100014992 3300006173 Bacteria 3976
91 Ga0070712_100004767 3300006175 Bacteria 8382
92 Ga0070712_100005000 3300006175 Bacteria 8206
93 Ga0070712_100052359 3300006175 Bacteria 2846
94 Ga0075362_10003097 3300006177 Bacteria 5733
95 Ga0075362_10044379 3300006177 Bacteria 1971
96 Ga0075367_10012078 3300006178 Bacteria 4591
97 Ga0075367_10026837 3300006178 Bacteria 3270
98 Ga0075367_10065950 3300006178 Bacteria 2169
99 Ga0075367_10100456 3300006178 Bacteria 1768
100 Ga0075369_10054202 3300006186 Bacteria 1741
101 Ga0075366_10001179 3300006195 Bacteria 12962
102 Ga0097621_100081999 3300006237 Bacteria 2685
103 Ga0075370_10066134 3300006353 Bacteria 2062
104 Ga0075428_100000690 3300006844 Bacteria 34808
105 Ga0075428_100019356 3300006844 Bacteria 7533
106 Ga0075428_100159494 3300006844 Bacteria 2449
107 Ga0075430_100001644 3300006846 Bacteria 18255
108 Ga0075430_100013482 3300006846 Bacteria 6968
109 Ga0075430_100185337 3300006846 Bacteria 1731
110 Ga0075431_100000098 3300006847 Bacteria 54303
111 Ga0075431_100005461 3300006847 Bacteria 12556
112 Ga0075431_100097396 3300006847 Bacteria 3038
113 Ga0075431_100276217 3300006847 Bacteria 1702
114 Ga0075431_100343066 3300006847 Bacteria 1503
115 Ga0075434_100106958 3300006871 Bacteria 2807
116 Ga0075429_100009106 3300006880 Bacteria 8621
117 Ga0075436_100002664 3300006914 Bacteria 12272
118 Ga0075436_100051103 3300006914 Bacteria 2853
119 Ga0075436_100217860 3300006914 Bacteria 1354
120 Ga0097620_100049426 3300006931 Bacteria 4223
121 Ga0097620_100181273 3300006931 Bacteria 2189
122 Ga0097620_100408691 3300006931 Bacteria 1453
123 Ga0075435_100026824 3300007076 Bacteria 4499
124 Ga0075435_100047016 3300007076 Bacteria 3464
125 Ga0099794_10027936 3300007265 Bacteria 2620
126 Ga0099794_10074803 3300007265 Bacteria 1664
127 Ga0099795_10035914 3300007788 Bacteria 1736
128 Ga0105240_10004682 3300009093 Bacteria 20685
129 Ga0111539_10000703 3300009094 Bacteria 43347
130 Ga0111539_10068500 3300009094 Bacteria 4190
131 Ga0111539_10138857 3300009094 Bacteria 2846
132 Ga0111539_10171707 3300009094 Bacteria 2533
133 Ga0105245_10000898 3300009098 Bacteria 27086
134 Ga0105245_10053403 3300009098 Bacteria 3627
135 Ga0105245_10276091 3300009098 Bacteria 1641
136 Ga0114129_10000057 3300009147 Bacteria 99258
137 Ga0114129_10003135 3300009147 Bacteria 23199
138 Ga0114129_10119075 3300009147 Bacteria 3637
139 Ga0105243_10062299 3300009148 Bacteria 2986
140 Ga0105243_10118081 3300009148 Bacteria 2231
141 Ga0105248_10083721 3300009177 Bacteria 3588
142 Ga0105238_10027483 3300009551 Bacteria 5799
143 Ga0105249_10000366 3300009553 Bacteria 44857
144 Ga0105249_10128236 3300009553 Bacteria 2418
145 Ga0099796_10001780 3300010159 Bacteria 4500
146 Ga0157373_10066627 3300013100 Bacteria 2547
147 Ga0157373_10074325 3300013100 Bacteria 2398
148 Ga0157370_10007752 3300013104 Bacteria 11636
149 Ga0157374_10295070 3300013296 Bacteria 1603
150 Ga0157378_10099275 3300013297 Bacteria 2656
151 Ga0157372_10001212 3300013307 Bacteria 27905
152 Ga0157375_10236355 3300013308 Bacteria 1987
153 Ga0163163_10205249 3300014325 Bacteria 2019
154 Ga0157380_10248157 3300014326 Bacteria 1609
155 Ga0157376_10089692 3300014969 Bacteria 2659
156 Ga0163161_10131273 3300017792 Bacteria 1890
157 Ga0213874_10048999 3300021377 Bacteria 1290
158 Ga0213876_10012097 3300021384 Bacteria 4597
159 Ga0213876_10096307 3300021384 Bacteria 1568
160 Ga0213875_10000031 3300021388 Bacteria 176367
161 Ga0224572_1000034 3300024225 Bacteria 7758
162 Ga0228598_1011336 3300024227 Bacteria 1773
163 Ga0228598_1020122 3300024227 Bacteria 1314
164 Ga0209758_1000308 3300025297 Bacteria 94851
165 Ga0209758_1000312 3300025297 Bacteria 94114
166 Ga0209758_1028725 3300025297 Bacteria 2344
167 Ga0207682_10001973 3300025893 Bacteria 9298
168 Ga0207682_10059186 3300025893 Bacteria 1600
169 Ga0207692_10007136 3300025898 Bacteria 4566
170 Ga0207688_10025459 3300025901 Bacteria 3249
171 Ga0207680_10166839 3300025903 Bacteria 1480
172 Ga0207685_10017067 3300025905 Bacteria 2338
173 Ga0207699_10021051 3300025906 Bacteria 3507
174 Ga0207699_10052503 3300025906 Bacteria 2413
175 Ga0207645_10037589 3300025907 Bacteria 3106
176 Ga0207643_10107794 3300025908 Bacteria 1638
177 Ga0207705_10102483 3300025909 Bacteria 2107
178 Ga0207707_10005935 3300025912 Bacteria 10688
179 Ga0207707_10189204 3300025912 Bacteria 1796
180 Ga0207695_10000107 3300025913 Bacteria 252606
181 Ga0207693_10008563 3300025915 Bacteria 8374
182 Ga0207693_10010902 3300025915 Bacteria 7371
183 Ga0207693_10021913 3300025915 Bacteria 5080
184 Ga0207693_10176339 3300025915 Bacteria 1682
185 Ga0207663_10127641 3300025916 Bacteria 1752
186 Ga0207660_10104513 3300025917 Bacteria 2121
187 Ga0207660_10120633 3300025917 Bacteria 1985
188 Ga0207662_10005064 3300025918 Bacteria 6983
189 Ga0207662_10038601 3300025918 Bacteria 2798
190 Ga0207649_10074669 3300025920 Bacteria 2176
191 Ga0207652_10005989 3300025921 Bacteria 9836
192 Ga0207652_10050604 3300025921 Bacteria 3560
193 Ga0207652_10165212 3300025921 Bacteria 1985
194 Ga0207681_10019099 3300025923 Bacteria 4328
195 Ga0207650_10013257 3300025925 Bacteria 5703
196 Ga0207659_10017877 3300025926 Bacteria 4639
197 Ga0207687_10070089 3300025927 Bacteria 2502
198 Ga0207687_10309102 3300025927 Bacteria 1276
199 Ga0207700_10034853 3300025928 Bacteria 3618
200 Ga0207700_10145823 3300025928 Bacteria 1951
201 Ga0207700_10148972 3300025928 Bacteria 1932
202 Ga0207700_10161802 3300025928 Bacteria 1859
203 Ga0207664_10006820 3300025929 Bacteria 7891
204 Ga0207664_10028136 3300025929 Bacteria 4269
205 Ga0207664_10032181 3300025929 Bacteria 4018
206 Ga0207664_10061831 3300025929 Bacteria 2989
207 Ga0207664_10092307 3300025929 Bacteria 2485
208 Ga0207644_10229240 3300025931 Bacteria 1475
209 Ga0207690_10044356 3300025932 Bacteria 2931
210 Ga0207706_10047931 3300025933 Bacteria 3779
211 Ga0207670_10013413 3300025936 Bacteria 4831
212 Ga0207670_10017840 3300025936 Bacteria 4299
213 Ga0207670_10019375 3300025936 Bacteria 4156
214 Ga0207670_10054094 3300025936 Bacteria 2707
215 Ga0207669_10008682 3300025937 Bacteria 4786
216 Ga0207665_10001716 3300025939 Bacteria 14730
217 Ga0207665_10149648 3300025939 Bacteria 1671
218 Ga0207691_10002047 3300025940 Bacteria 19715
219 Ga0207691_10095637 3300025940 Bacteria 2657
220 Ga0207691_10138170 3300025940 Bacteria 2148
221 Ga0207711_10064329 3300025941 Bacteria 3168
222 Ga0207661_10015374 3300025944 Bacteria 5631
223 Ga0207679_10030219 3300025945 Bacteria 3781
224 Ga0207651_10002803 3300025960 Bacteria 8381
225 Ga0207651_10026194 3300025960 Bacteria 3638
226 Ga0207651_10168876 3300025960 Bacteria 1723
227 Ga0207712_10002501 3300025961 Bacteria 11828
228 Ga0207712_10093383 3300025961 Bacteria 2220
229 Ga0207668_10227145 3300025972 Bacteria 1503
230 Ga0207658_10153659 3300025986 Bacteria 1878
231 Ga0207677_10025711 3300026023 Bacteria 3677
232 Ga0207703_10168976 3300026035 Bacteria 1922
233 Ga0207703_10245897 3300026035 Bacteria 1610
234 Ga0207639_10005685 3300026041 Bacteria 8438
235 Ga0207639_10242315 3300026041 Bacteria 1568
236 Ga0207641_10049115 3300026088 Bacteria 3564
237 Ga0207648_10016126 3300026089 Bacteria 6841
238 Ga0207676_10022380 3300026095 Bacteria 4647
239 Ga0207676_10035276 3300026095 Bacteria 3795
240 Ga0207674_10035866 3300026116 Bacteria 5173
241 Ga0207674_10173314 3300026116 Bacteria 2110
242 Ga0207675_100241923 3300026118 Bacteria 1744
243 Ga0207675_100269956 3300026118 Bacteria 1651
244 Ga0207683_10001331 3300026121 Bacteria 22269
245 Ga0207683_10042766 3300026121 Bacteria 3957
246 Ga0207683_10298291 3300026121 Bacteria 1474
247 Ga0207698_10007221 3300026142 Bacteria 6959
248 Ga0209179_1005067 3300027512 Bacteria 2035
249 Ga0207428_10008746 3300027907 Bacteria 9132
250 Ga0207428_10066812 3300027907 Bacteria 2832
251 Ga0268264_10054902 3300028381 Bacteria 3328
252 Ga0265337_1007585 3300028556 Bacteria 4045
253 Ga0265338_10013547 3300028800 Bacteria 9192
254 Ga0265330_10012094 3300031235 Bacteria 4036
255 Ga0265330_10015445 3300031235 Bacteria 3532
256 Ga0265332_10001857 3300031238 Bacteria 11220
257 Ga0265325_10003766 3300031241 Bacteria 9786
258 Ga0265325_10011638 3300031241 Bacteria 5053
259 Ga0265325_10012217 3300031241 Bacteria 4913
260 Ga0265325_10078671 3300031241 Bacteria 1642
261 Ga0265329_10004050 3300031242 Bacteria 6227
262 Ga0265329_10023902 3300031242 Bacteria 2031
263 Ga0265340_10006014 3300031247 Bacteria 6702
264 Ga0265340_10008344 3300031247 Bacteria 5596
265 Ga0265340_10010587 3300031247 Bacteria 4930
266 Ga0265339_10000054 3300031249 Bacteria 100374
267 Ga0265339_10002624 3300031249 Bacteria 12823
268 Ga0265339_10005140 3300031249 Bacteria 8777
269 Ga0265339_10016311 3300031249 Bacteria 4431
270 Ga0265331_10007501 3300031250 Bacteria 6306
271 Ga0265331_10016215 3300031250 Bacteria 3915
272 Ga0265316_10111529 3300031344 Bacteria 2071
273 Ga0265316_10221080 3300031344 Bacteria 1397
274 Ga0265313_10001832 3300031595 Bacteria 19396
275 Ga0265313_10001996 3300031595 Bacteria 18368
276 Ga0265313_10005086 3300031595 Bacteria 9795
277 Ga0265314_10008808 3300031711 Bacteria 8621
278 Ga0265342_10000092 3300031712 Bacteria 99040
279 Ga0265342_10004949 3300031712 Bacteria 10288
280 Ga0265342_10006461 3300031712 Bacteria 8727
281 Ga0316576_10248913 3300031727 Bacteria 1334
282 Ga0307416_100259201 3300032002 Bacteria 1698
283 Ga0373934_0004863 3300035086 Bacteria 4970
284 Ga0373934_0027427 3300035086 Bacteria 2213
285 Ga0373923_0034646 3300035111 Bacteria 2050
286 Ga0373936_0027130 3300035113 Bacteria 2246
287 Ga0373939_0019841 3300035114 Bacteria 1818
288 Ga0373941_0053487 3300035115 Bacteria 1291
289 Ga0373945_0025365 3300035116 Bacteria 2059
290 Ga0373953_0002026 3300035117 Bacteria 6028
291 Ga0373953_0015305 3300035117 Bacteria 2776
292 Ga0373953_0022405 3300035117 Bacteria 2382
293 Ga0373954_0001810 3300035118 Bacteria 8810
294 Ga0373954_0003140 3300035118 Bacteria 6983
295 Ga0373956_0012138 3300035119 Bacteria 3564
296 Ga0373957_0008145 3300035120 Bacteria 3384
297 Ga0373957_0053391 3300035120 Bacteria 1550
298 Ga0373943_0000261 3300035170 Bacteria 21642
299 Ga0373943_0054003 3300035170 Bacteria 1986
300 Ga0373943_0054365 3300035170 Bacteria 1980
301 Ga0373946_0009016 3300035171 Bacteria 3670
302 Ga0373946_0024627 3300035171 Bacteria 2360
303 Ga0373946_0095198 3300035171 Bacteria 1326
304 Ga0373955_0000294 3300035172 Bacteria 20614
305 Ga0373955_0000357 3300035172 Bacteria 19267
306 Ga0373955_0025780 3300035172 Bacteria 3022
307 Ga0373955_0081238 3300035172 Bacteria 1832
308 Ga0316574_0003414 3300035398 Bacteria 8185
309 Ga0373924_0002287 3300035410 Bacteria 6434
310 Ga0373924_0003415 3300035410 Bacteria 5462
311 Ga0373924_0053719 3300035410 Bacteria 1674
312 Ga0373924_0134536 3300035410 Bacteria 1076
313 Ga0373931_0008332 3300035691 Bacteria 4910
314 Ga0373935_0000298 3300035692 Bacteria 24560
315 Ga0373935_0057105 3300035692 Bacteria 2490
316 Ga0373935_0066253 3300035692 Bacteria 2319
317 Ga0373935_0074012 3300035692 Bacteria 2201
318 Ga0373935_0168033 3300035692 Bacteria 1499
319 Ga0373927_0003788 3300035695 Bacteria 10729
320 Ga0373927_0004430 3300035695 Bacteria 9837
321 Ga0373927_0005686 3300035695 Bacteria 8559
322 Ga0373927_0020166 3300035695 Bacteria 4371
323 Ga0373927_0059904 3300035695 Bacteria 2462
324 Ga0373927_0171522 3300035695 Bacteria 1422
325 Ga0373933_0000325 3300035724 Bacteria 30685
326 Ga0373933_0004421 3300035724 Bacteria 7714
327 Ga0373933_0028802 3300035724 Bacteria 3206
328 Ga0373947_0000391 3300035725 Bacteria 24724
329 Ga0373947_0025548 3300035725 Bacteria 3446
330 Ga0373947_0033218 3300035725 Bacteria 3044
331 Ga0373947_0038909 3300035725 Bacteria 2828
332 Ga0373947_0050684 3300035725 Bacteria 2496
333 Ga0373947_0061242 3300035725 Bacteria 2287
334 Ga0373937_0000081 3300036401 Bacteria 88009
335 Ga0373937_0001589 3300036401 Bacteria 19103
336 Ga0373937_0002429 3300036401 Bacteria 15499
337 Ga0373937_0004812 3300036401 Bacteria 11473
338 Ga0373937_0237558 3300036401 Bacteria 1716
339 Ga0316582_0213509 3300036647 Bacteria 1319
340 Ga0316584_0099682 3300036712 Bacteria 2175
341 Ga0373925_0000425 3300037068 Bacteria 42725
342 Ga0373925_0028146 3300037068 Bacteria 4117
343 Ga0373925_0040551 3300037068 Bacteria 3447
344 Ga0373925_0071882 3300037068 Bacteria 2617
345 Ga0373925_0139038 3300037068 Bacteria 1900
346 Ga0373925_0148109 3300037068 Bacteria 1841
347 Ga0395900_0226783 3300037418 Bacteria 1881
348 Ga0395898_0014622 3300037466 Bacteria 8061
349 Ga0395898_0063937 3300037466 Bacteria 3570
350 Ga0436364_0033507 3300037853 Bacteria 2498
351 Ga0436364_0793438 3300037853 Bacteria 64960
352 Ga0436365_0085454 3300039437 Bacteria 2136
353 Ga0436365_0311840 3300039437 Bacteria 2476
354 Ga0436365_0505017 3300039437 Bacteria 4658
355 Ga0436365_0657686 3300039437 Bacteria 27042
356 Ga0436365_0878170 3300039437 Bacteria 3969
357 Ga0436365_0903140 3300039437 Bacteria 3075
358 Ga0436365_1369522 3300039437 Bacteria 1209
359 Ga0436365_1489713 3300039437 Bacteria 3522
360 Ga0436360_1257472 3300039438 Bacteria 1409
361 Ga0436361_0112327 3300039447 Bacteria 4381
362 Ga0436363_0225098 3300039450 Bacteria 4259
363 Ga0436363_0640332 3300039450 Bacteria 3068
364 Ga0439453_0003561 3300041408 Bacteria 2248
365 Ga0439465_0033510 3300041413 Bacteria 1643
366 Ga0450923_006355 3300042125 Bacteria 1954
367 Ga0439435_0001109 3300042436 Bacteria 4794
368 Ga0466966_0045849 3300044684 Bacteria 2794
369 Ga0466963_0132010 3300044694 Bacteria 1726
370 Ga0495592_0002862 3300046454 Bacteria 12266
371 Ga0495592_0010291 3300046454 Bacteria 7052
372 Ga0495592_0027438 3300046454 Bacteria 4317
373 Ga0495603_0016472 3300046455 Bacteria 4472
374 Ga0495603_0073678 3300046455 Bacteria 2006
375 Ga0495603_0085819 3300046455 Bacteria 1843
376 Ga0495590_0055695 3300046457 Bacteria 1382
377 Ga0495629_0005277 3300046459 Bacteria 9659
378 Ga0495629_0011442 3300046459 Bacteria 6446
379 Ga0495629_0180675 3300046459 Bacteria 1462
380 Ga0495638_0023817 3300046460 Bacteria 3999
381 Ga0495651_0000541 3300046462 Bacteria 29187
382 Ga0495651_0002748 3300046462 Bacteria 13649
383 Ga0495651_0007674 3300046462 Bacteria 8247
384 Ga0495651_0194257 3300046462 Bacteria 1426
385 Ga0495653_0000054 3300046463 Bacteria 102885
386 Ga0495653_0004652 3300046463 Bacteria 11104
387 Ga0495653_0012932 3300046463 Bacteria 6810
388 Ga0495653_0137502 3300046463 Bacteria 1722
389 Ga0495580_0037671 3300046472 Bacteria 3468
390 Ga0495605_0123784 3300046474 Bacteria 1171
391 Ga0495662_0013700 3300046476 Bacteria 3949
392 Ga0495662_0037470 3300046476 Bacteria 2342
393 Ga0495664_0000020 3300046477 Bacteria 150749
394 Ga0495664_0000385 3300046477 Bacteria 21527
395 Ga0495608_0000024 3300046511 Bacteria 159429
396 Ga0495608_0005565 3300046511 Bacteria 8999
397 Ga0495608_0006299 3300046511 Bacteria 8417
398 Ga0495608_0045485 3300046511 Bacteria 2925
399 Ga0495618_0000020 3300046514 Bacteria 130661
400 Ga0495618_0001885 3300046514 Bacteria 13809
401 Ga0495618_0021032 3300046514 Bacteria 4020
402 Ga0495618_0059854 3300046514 Bacteria 2414
403 Ga0495618_0139032 3300046514 Bacteria 1553
404 Ga0495628_0000015 3300046516 Bacteria 198912
405 Ga0495628_0014732 3300046516 Bacteria 6545
406 Ga0495628_0050220 3300046516 Bacteria 3299
407 Ga0495628_0167126 3300046516 Bacteria 1669
408 Ga0495630_0001403 3300046517 Bacteria 16663
409 Ga0495630_0031144 3300046517 Bacteria 3970
410 Ga0495630_0042715 3300046517 Bacteria 3385
411 Ga0495666_0087671 3300046526 Bacteria 1470
412 Ga0495652_0000006 3300046529 Bacteria 459709
413 Ga0495652_0020776 3300046529 Bacteria 5834
414 Ga0495652_0027961 3300046529 Bacteria 4966
415 Ga0495665_0027276 3300046531 Bacteria 3066
416 Ga0495665_0065481 3300046531 Bacteria 1918
417 Ga0495640_0000002 3300046533 Bacteria 646434
418 Ga0495640_0003282 3300046533 Bacteria 13013
419 Ga0495640_0022826 3300046533 Bacteria 4568
420 Ga0495640_0112404 3300046533 Bacteria 1778
421 Ga0495587_0000001 3300046536 Bacteria 724132
422 Ga0495587_0000568 3300046536 Bacteria 25456
423 Ga0495621_0043207 3300046539 Bacteria 1589
424 Ga0495645_0000013 3300046543 Bacteria 186399
425 Ga0495645_0024674 3300046543 Bacteria 4363
426 Ga0495645_0027819 3300046543 Bacteria 4108
427 Ga0495667_0000030 3300046559 Bacteria 147898
428 Ga0495667_0002169 3300046559 Bacteria 13096
429 Ga0495667_0002715 3300046559 Bacteria 11835
430 Ga0495634_0000117 3300046642 Bacteria 67216
431 Ga0495634_0007759 3300046642 Bacteria 8028
432 Ga0495634_0021991 3300046642 Bacteria 4497
433 Ga0495635_0000001 3300046663 Bacteria 704901
434 Ga0495635_0000800 3300046663 Bacteria 20534
435 Ga0495635_0007564 3300046663 Bacteria 7579
436 Ga0495635_0024285 3300046663 Bacteria 4225
437 Ga0495635_0048578 3300046663 Bacteria 2925
438 Ga0495588_0079273 3300046674 Bacteria 1714
439 Ga0495657_0000028 3300046675 Bacteria 131008
440 Ga0495657_0015592 3300046675 Bacteria 5554
441 Ga0495599_0000050 3300046678 Bacteria 82601
442 Ga0495599_0008026 3300046678 Bacteria 6408
443 Ga0495599_0008520 3300046678 Bacteria 6239
444 Ga0495623_0000013 3300046679 Bacteria 119870
445 Ga0495623_0001240 3300046679 Bacteria 17330
446 Ga0495623_0006690 3300046679 Bacteria 7499
447 Ga0495623_0018525 3300046679 Bacteria 4497
448 Ga0495646_0000003 3300046680 Bacteria 287773
449 Ga0495646_0004537 3300046680 Bacteria 8742
450 Ga0495646_0055013 3300046680 Bacteria 2392
451 Ga0495658_0217094 3300046683 Bacteria 1196
452 Ga0495613_0011001 3300046689 Bacteria 6721
453 Ga0495613_0013543 3300046689 Bacteria 6054
454 Ga0495613_0041659 3300046689 Bacteria 3400
455 Ga0495613_0048411 3300046689 Bacteria 3139
456 Ga0495613_0097432 3300046689 Bacteria 2126
457 Ga0495613_0108269 3300046689 Bacteria 2004
458 Ga0495624_0003637 3300046690 Bacteria 11404
459 Ga0495624_0029449 3300046690 Bacteria 3582
460 Ga0495624_0109282 3300046690 Bacteria 1701
461 Ga0495600_0000002 3300046809 Bacteria 186597
462 Ga0495600_0001425 3300046809 Bacteria 13226
463 Ga0495600_0003096 3300046809 Bacteria 9724
464 Ga0495581_0218873 3300047315 Bacteria 1113
465 Ga0495604_0000001 3300047317 Bacteria 708627
466 Ga0495604_0000168 3300047317 Bacteria 57429
467 Ga0495604_0016356 3300047317 Bacteria 5929
468 Ga0495604_0147070 3300047317 Bacteria 1678
469 Ga0495674_0000018 3300047319 Bacteria 204024
470 Ga0495674_0001787 3300047319 Bacteria 21202
471 Ga0495674_0004591 3300047319 Bacteria 13281
472 Ga0495674_0260471 3300047319 Bacteria 1425
473 Ga0495672_0124407 3300047320 Bacteria 1366
474 Ga0495676_0059014 3300047321 Bacteria 3016
475 Ga0495676_0159333 3300047321 Bacteria 1598
476 Ga0495680_0000159 3300047322 Bacteria 68873
477 Ga0495680_0000415 3300047322 Bacteria 47694
478 Ga0495680_0011266 3300047322 Bacteria 7927
479 Ga0495680_0179150 3300047322 Bacteria 1531
480 Ga0495675_0000238 3300047444 Bacteria 39857
481 Ga0495675_0006869 3300047444 Bacteria 6987
482 Ga0495675_0242738 3300047444 Bacteria 1084
483 Ga0495685_021510 3300047447 Bacteria 2219
484 Ga0495684_0000010 3300047471 Bacteria 198915
485 Ga0495684_0004699 3300047471 Bacteria 10659
486 Ga0495684_0048571 3300047471 Bacteria 3244
487 Ga0495684_0075131 3300047471 Bacteria 2567
488 Ga0495684_0076363 3300047471 Bacteria 2544
489 Ga0495684_0116072 3300047471 Bacteria 2018
490 Ga0495593_0002081 3300047673 Bacteria 11959
491 Ga0495593_0038636 3300047673 Bacteria 2577
492 Ga0495593_0057331 3300047673 Bacteria 2046
493 Ga0495602_0000016 3300048088 Bacteria 190311
494 Ga0495602_0001302 3300048088 Bacteria 24603
495 Ga0495615_0003085 3300048090 Bacteria 2756
496 Ga0496100_0011897 3300048903 Bacteria 4969
497 Ga0496100_0063474 3300048903 Bacteria 2441
498 Ga0496101_0002084 3300048904 Bacteria 12181
499 Ga0496101_0100185 3300048904 Bacteria 2167
500 Ga0496102_0029733 3300048905 Bacteria 4889
501 Ga0496103_0013488 3300048906 Bacteria 4849
502 Ga0496104_0006456 3300048907 Bacteria 10309
503 Ga0496104_0036217 3300048907 Bacteria 4612
504 Ga0496104_0301833 3300048907 Bacteria 1513
505 Ga0496105_0032246 3300048908 Bacteria 4298
506 Ga0496105_0099697 3300048908 Bacteria 2399
507 Ga0496106_0035173 3300048909 Bacteria 3745
508 Ga0496106_0085211 3300048909 Bacteria 2433
509 Ga0496106_0193608 3300048909 Bacteria 1617
510 Ga0496107_0012023 3300048910 Bacteria 6036
511 Ga0496107_0085708 3300048910 Bacteria 2299
512 Ga0496108_0008123 3300048911 Bacteria 8512
513 Ga0496108_0014550 3300048911 Bacteria 6423
514 Ga0496108_0105696 3300048911 Bacteria 2404
515 Ga0496108_0176356 3300048911 Bacteria 1850
516 Ga0496108_0222345 3300048911 Bacteria 1641
517 Ga0496109_0008742 3300048912 Bacteria 8623
518 Ga0496110_0006704 3300048913 Bacteria 9155
519 Ga0496110_0053328 3300048913 Bacteria 3555
520 Ga0496110_0059599 3300048913 Bacteria 3365
521 Ga0496110_0105767 3300048913 Bacteria 2525
522 Ga0496111_0018672 3300048914 Bacteria 4806
523 Ga0496111_0041816 3300048914 Bacteria 3290
524 Ga0496112_0017515 3300048915 Bacteria 6732
525 Ga0496112_0106012 3300048915 Bacteria 2780
526 Ga0496113_0061077 3300048916 Bacteria 2843
527 Ga0496113_0127457 3300048916 Bacteria 1994
528 Ga0496114_0089694 3300048917 Bacteria 2609
529 Ga0496114_0137178 3300048917 Bacteria 2116
530 Ga0496114_0144390 3300048917 Bacteria 2062
531 Ga0496114_0204612 3300048917 Bacteria 1730
532 Ga0496115_0023653 3300048918 Bacteria 4768
533 Ga0496115_0031238 3300048918 Bacteria 4195
534 Ga0496115_0161066 3300048918 Bacteria 1854
535 Ga0496115_0182037 3300048918 Bacteria 1737
536 Ga0496116_0002755 3300048919 Bacteria 18052
537 Ga0496117_0048428 3300048920 Bacteria 3036
538 Ga0496119_0006427 3300048922 Bacteria 10897
539 Ga0496122_0013338 3300048925 Bacteria 8050
540 Ga0496123_0020995 3300048926 Bacteria 5089
541 Ga0496126_0026035 3300048929 Bacteria 5616
542 Ga0496126_0052219 3300048929 Bacteria 3716
543 Ga0501031_0019583 3300049568 Bacteria 4408
544 Ga0501032_0088695 3300049569 Bacteria 2053
545 Ga0501033_0040664 3300049570 Bacteria 3471
546 Ga0501033_0059678 3300049570 Bacteria 2816
547 Ga0501033_0060430 3300049570 Bacteria 2796
548 Ga0501033_0083339 3300049570 Bacteria 2344
549 Ga0501033_0096076 3300049570 Bacteria 2165
550 Ga0501034_0028861 3300049571 Bacteria 5643
551 Ga0501034_0078354 3300049571 Bacteria 3309
552 Ga0501034_0084059 3300049571 Bacteria 3185
553 Ga0501034_0134166 3300049571 Bacteria 2457
554 Ga0501034_0275389 3300049571 Bacteria 1623
555 Ga0501034_0318911 3300049571 Bacteria 1487
556 Ga0501036_0049226 3300049572 Bacteria 3568
557 Ga0501036_0120535 3300049572 Bacteria 2215
558 Ga0501036_0122485 3300049572 Bacteria 2196
559 Ga0501037_0067159 3300049573 Bacteria 2611
560 Ga0501037_0120523 3300049573 Bacteria 1886
561 Ga0501038_0002943 3300049574 Bacteria 15884
562 Ga0501038_0014878 3300049574 Bacteria 7084
563 Ga0501038_0017952 3300049574 Bacteria 6391
564 Ga0501039_0030956 3300049575 Bacteria 4126
565 Ga0501039_0189868 3300049575 Bacteria 1616
566 Ga0501039_0203043 3300049575 Bacteria 1558
567 Ga0501042_0055181 3300049578 Bacteria 2835
568 Ga0501043_0119338 3300049579 Bacteria 2068
569 Ga0501043_0150154 3300049579 Bacteria 1823
570 Ga0501043_0197854 3300049579 Bacteria 1561
571 Ga0501047_0010604 3300049581 Bacteria 8714
572 Ga0501047_0034600 3300049581 Bacteria 4878
573 Ga0501047_0046121 3300049581 Bacteria 4213
574 Ga0501047_0243819 3300049581 Bacteria 1647
575 Ga0501048_0001047 3300049582 Bacteria 20704
576 Ga0501067_0036049 3300049583 Bacteria 2747
577 Ga0501067_0051045 3300049583 Bacteria 2293
578 Ga0501067_0113005 3300049583 Bacteria 1510
579 Ga0501070_0047057 3300049586 Bacteria 3587
580 Ga0501070_0066001 3300049586 Bacteria 2996
581 Ga0501071_0077009 3300049587 Bacteria 2436
582 Ga0501071_0100043 3300049587 Bacteria 2137
583 Ga0501072_0002322 3300049588 Bacteria 14269
584 Ga0501072_0005296 3300049588 Bacteria 9820
585 Ga0501072_0108720 3300049588 Bacteria 2206
586 Ga0501073_0121462 3300049589 Bacteria 1810
587 Ga0501073_0134401 3300049589 Bacteria 1714
588 Ga0501073_0149721 3300049589 Bacteria 1617
589 Ga0501074_0013077 3300049590 Bacteria 6033
590 Ga0501074_0239948 3300049590 Bacteria 1289
591 Ga0501075_0113910 3300049591 Bacteria 2056
592 Ga0501075_0123896 3300049591 Bacteria 1967
593 Ga0501076_0026991 3300049592 Bacteria 4453
594 Ga0501076_0045805 3300049592 Bacteria 3454
595 Ga0501076_0047928 3300049592 Bacteria 3378
596 Ga0501077_0003493 3300049593 Bacteria 9437
597 Ga0501079_0014464 3300049741 Bacteria 6017
598 Ga0501080_0018950 3300049742 Bacteria 6375
599 Ga0501080_0084856 3300049742 Bacteria 2942
600 Ga0501080_0121301 3300049742 Bacteria 2422
601 Ga0501080_0248477 3300049742 Bacteria 1622
602 Ga0501081_0002149 3300049743 Bacteria 12350
603 Ga0501083_0016513 3300049744 Bacteria 5165
604 Ga0501083_0054594 3300049744 Bacteria 2681
605 Ga0501083_0057189 3300049744 Bacteria 2612
606 Ga0501083_0102997 3300049744 Bacteria 1881
607 Ga0501083_0118716 3300049744 Bacteria 1735
608 Ga0501083_0144294 3300049744 Bacteria 1558
609 Ga0501083_0290457 3300049744 Bacteria 1063
610 Ga0501035_0017022 3300049822 Bacteria 6699
611 Ga0501044_0000509 3300049823 Bacteria 47320
612 Ga0501044_0008635 3300049823 Bacteria 11156
613 Ga0501044_0097349 3300049823 Bacteria 2964
614 Ga0501044_0154290 3300049823 Bacteria 2276
615 Ga0501044_0340242 3300049823 Bacteria 1421
616 nmdc:mga03683_25739_c1 3300050489 Bacteria 1785
617 nmdc:mga03683_3554_c1 3300050489 Bacteria 5050
618 nmdc:mga00v17_9760_c1 3300050491 Bacteria 5212
619 nmdc:mga0k408_66566_c1 3300050493 Bacteria 2099
620 nmdc:mga06z11_73017_c1 3300050494 Bacteria 1821
621 nmdc:mga06z11_84607_c1 3300050494 Bacteria 1709
622 nmdc:mga05p37_2362_c1 3300050507 Bacteria 21952
623 nmdc:mga05p37_29385_c1 3300050507 Bacteria 6708
624 nmdc:mga05p37_45624_c1 3300050507 Bacteria 4011
625 nmdc:mga09592_16449_c1 3300050508 Bacteria 6051
626 nmdc:mga09592_269632_c1 3300050508 Bacteria 1476
627 nmdc:mga0qj67_471_c1 3300050509 Bacteria 27479
628 nmdc:mga0qj67_7709_c1 3300050509 Bacteria 6175
629 nmdc:mga06r32_1530_c1 3300050510 Bacteria 20800
630 nmdc:mga06r32_231467_c1 3300050510 Bacteria 1836
631 nmdc:mga06r32_318279_c1 3300050510 Bacteria 1541
632 nmdc:mga06r32_6629_c1 3300050510 Bacteria 10406
633 nmdc:mga08y16_1107_c1 3300050511 Bacteria 26547
634 nmdc:mga08y16_114383_c1 3300050511 Bacteria 2809
635 nmdc:mga0n895_20390_c1 3300050512 Bacteria 6182
636 nmdc:mga0n895_21450_c1 3300050512 Bacteria 6041
637 nmdc:mga0n895_94093_c1 3300050512 Bacteria 3000
638 nmdc:mga0rr50_104447_c1 3300050513 Bacteria 2232
639 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
640 nmdc:mga08x19_47330_c1 3300050514 Bacteria 2752
641 nmdc:mga08x19_59405_c1 3300050514 Bacteria 2475
642 nmdc:mga0a205_23199_c1 3300050515 Bacteria 5885
643 nmdc:mga0a205_70803_c1 3300050515 Bacteria 3367
644 nmdc:mga0sz30_75785_c1 3300050516 Bacteria 1452
645 Ga0495601_0000021 3300053077 Bacteria 159355
646 Ga0495601_0001764 3300053077 Bacteria 11978
647 Ga0495601_0007869 3300053077 Bacteria 6276
648 Ga0495601_0031433 3300053077 Bacteria 3299
649 Ga0495601_0048473 3300053077 Bacteria 2675
650 Ga0495601_0128438 3300053077 Bacteria 1650
651 Ga0495612_0000018 3300053078 Bacteria 150870
652 Ga0495612_0000774 3300053078 Bacteria 12984
653 Ga0495612_0006049 3300053078 Bacteria 4984
654 Ga0495612_0047593 3300053078 Bacteria 1757
655 Ga0495595_0000028 3300053084 Bacteria 97682
656 Ga0495595_0000265 3300053084 Bacteria 20703
657 Ga0495595_0021713 3300053084 Bacteria 2808
658 Ga0495619_0000006 3300053085 Bacteria 384835
659 Ga0495619_0000354 3300053085 Bacteria 32055
660 Ga0495619_0003889 3300053085 Bacteria 9601
661 Ga0495619_0070070 3300053085 Bacteria 2344
662 Ga0495619_0082451 3300053085 Bacteria 2167
663 Ga0495619_0083293 3300053085 Bacteria 2157
664 Ga0495619_0090413 3300053085 Bacteria 2072
665 Ga0495619_0103126 3300053085 Bacteria 1943
666 Ga0495619_0173034 3300053085 Bacteria 1493
667 Ga0500566_0000383 3300053094 Bacteria 24452
668 Ga0500556_0000124 3300053104 Bacteria 67080
669 Ga0500593_000134 3300053117 Bacteria 29394
670 Ga0500595_018756 3300053119 Bacteria 2524
671 Ga0500595_027905 3300053119 Bacteria 1929
672 Ga0500652_000043 3300053131 Bacteria 64726
673 Ga0500658_0091701 3300053134 Bacteria 1315
674 Ga0500568_0000005 3300053139 Bacteria 614296
675 Ga0500616_0000038 3300053153 Bacteria 386801
676 Ga0500616_0016164 3300053153 Bacteria 4254
677 Ga0500616_0018268 3300053153 Bacteria 3966
678 Ga0500616_0111902 3300053153 Bacteria 1317
679 Ga0501084_0042118 3300054114 Bacteria 3819
680 Ga0501084_0097600 3300054114 Bacteria 2467
681 Ga0501084_0315008 3300054114 Bacteria 1321
682 Ga0501082_0004415 3300060353 Bacteria 12281
683 Ga0501082_0026070 3300060353 Bacteria 5039
684 Ga0501082_0063753 3300060353 Bacteria 3173
685 Ga0501082_0088234 3300060353 Bacteria 2676
686 Ga0501082_0269318 3300060353 Bacteria 1482
687 Ga0530510_0144869 3300061734 Bacteria 1752

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0218873 Ga0495581_0218873_138_1058 304
2 3300035410 Ga0373924_0134536 Ga0373924_0134536_142_1062 305
3 3300049744 Ga0501083_0290457 Ga0501083_0290457_58_978 306
4 3300047444 Ga0495675_0242738 Ga0495675_0242738_64_1056 309
5 3300049744 Ga0501083_0054594 Ga0501083_0054594_23_1000 317
6 3300050508 nmdc:mga09592_269632_c1 nmdc:mga09592_269632_c1_436_1452 337
7 3300049587 Ga0501071_0100043 Ga0501071_0100043_102_1154 350
8 3300049590 Ga0501074_0239948 Ga0501074_0239948_24_1076 350
9 3300049592 Ga0501076_0047928 Ga0501076_0047928_1792_2844 350
10 3300049593 Ga0501077_0003493 Ga0501077_0003493_7017_8069 350
11 3300049741 Ga0501079_0014464 Ga0501079_0014464_1831_2883 350
12 3300049743 Ga0501081_0002149 Ga0501081_0002149_1879_2931 350
13 3300054114 Ga0501084_0042118 Ga0501084_0042118_2319_3371 350
14 3300060353 Ga0501082_0088234 Ga0501082_0088234_1090_2142 350
15 3300061734 Ga0530510_0144869 Ga0530510_0144869_241_1293 350
16 3300039450 Ga0436363_0225098 Ga0436363_0225098_2040_3182 354
17 3300005337 Ga0070682_100031186 Ga0070682_1000311862 356
18 3300005530 Ga0070679_100066634 Ga0070679_1000666342 356
19 3300005539 Ga0068853_100005846 Ga0068853_1000058468 356
20 3300047319 Ga0495674_0260471 Ga0495674_0260471_163_1305 358
21 3300053085 Ga0495619_0070070 Ga0495619_0070070_1056_2198 358
22 3300035116 Ga0373945_0025365 Ga0373945_0025365_594_1754 360
23 3300006175 Ga0070712_100005000 Ga0070712_1000050007 362
24 3300025915 Ga0207693_10008563 Ga0207693_100085633 362
25 3300035695 Ga0373927_0004430 Ga0373927_0004430_7147_8286 362
26 3300035725 Ga0373947_0050684 Ga0373947_0050684_1219_2358 362
27 3300046689 Ga0495613_0108269 Ga0495613_0108269_446_1585 362
28 3300047471 Ga0495684_0048571 Ga0495684_0048571_944_2092 362
29 3300005435 Ga0070714_100028556 Ga0070714_1000285562 364
30 3300005439 Ga0070711_100068347 Ga0070711_1000683472 364
31 3300035117 Ga0373953_0002026 Ga0373953_0002026_1160_2338 364
32 3300035118 Ga0373954_0003140 Ga0373954_0003140_3262_4440 364
33 3300035171 Ga0373946_0009016 Ga0373946_0009016_1256_2434 364
34 3300035172 Ga0373955_0000294 Ga0373955_0000294_4942_6120 364
35 3300035410 Ga0373924_0003415 Ga0373924_0003415_384_1562 364
36 3300035692 Ga0373935_0000298 Ga0373935_0000298_7473_8651 364
37 3300035695 Ga0373927_0005686 Ga0373927_0005686_7145_8323 364
38 3300035725 Ga0373947_0000391 Ga0373947_0000391_773_1951 364
39 3300036401 Ga0373937_0000081 Ga0373937_0000081_68665_69843 364
40 3300037068 Ga0373925_0000425 Ga0373925_0000425_30676_31854 364
41 3300046454 Ga0495592_0002862 Ga0495592_0002862_3906_5084 364
42 3300046462 Ga0495651_0000541 Ga0495651_0000541_3385_4563 364
43 3300046463 Ga0495653_0000054 Ga0495653_0000054_23351_24529 364
44 3300046476 Ga0495662_0013700 Ga0495662_0013700_302_1480 364
45 3300046477 Ga0495664_0000020 Ga0495664_0000020_71304_72482 364
46 3300046511 Ga0495608_0000024 Ga0495608_0000024_79887_81065 364
47 3300046514 Ga0495618_0000020 Ga0495618_0000020_78268_79446 364
48 3300046516 Ga0495628_0000015 Ga0495628_0000015_119459_120637 364
49 3300046517 Ga0495630_0001403 Ga0495630_0001403_4888_6066 364
50 3300046529 Ga0495652_0000006 Ga0495652_0000006_380252_381430 364
51 3300046533 Ga0495640_0000002 Ga0495640_0000002_566993_568171 364
52 3300046536 Ga0495587_0000001 Ga0495587_0000001_639449_640627 364
53 3300046543 Ga0495645_0000013 Ga0495645_0000013_78260_79438 364
54 3300046559 Ga0495667_0000030 Ga0495667_0000030_83304_84482 364
55 3300046642 Ga0495634_0000117 Ga0495634_0000117_63382_64560 364
56 3300046663 Ga0495635_0000001 Ga0495635_0000001_625260_626438 364
57 3300046675 Ga0495657_0000028 Ga0495657_0000028_66436_67614 364
58 3300046678 Ga0495599_0000050 Ga0495599_0000050_1493_2671 364
59 3300046679 Ga0495623_0000013 Ga0495623_0000013_56138_57316 364
60 3300046680 Ga0495646_0000003 Ga0495646_0000003_203248_204426 364
61 3300046689 Ga0495613_0048411 Ga0495613_0048411_1171_2349 364
62 3300046690 Ga0495624_0029449 Ga0495624_0029449_153_1331 364
63 3300046809 Ga0495600_0000002 Ga0495600_0000002_66036_67214 364
64 3300047317 Ga0495604_0000001 Ga0495604_0000001_588092_589270 364
65 3300047319 Ga0495674_0000018 Ga0495674_0000018_83472_84650 364
66 3300047321 Ga0495676_0159333 Ga0495676_0159333_88_1266 364
67 3300047322 Ga0495680_0000159 Ga0495680_0000159_27887_29065 364
68 3300047444 Ga0495675_0000238 Ga0495675_0000238_13796_14974 364
69 3300047471 Ga0495684_0000010 Ga0495684_0000010_78368_79546 364
70 3300047673 Ga0495593_0002081 Ga0495593_0002081_4918_6096 364
71 3300048088 Ga0495602_0000016 Ga0495602_0000016_78170_79348 364
72 3300053077 Ga0495601_0000021 Ga0495601_0000021_78250_79428 364
73 3300053078 Ga0495612_0000018 Ga0495612_0000018_78261_79439 364
74 3300053084 Ga0495595_0000028 Ga0495595_0000028_11198_12376 364
75 3300053085 Ga0495619_0000006 Ga0495619_0000006_303715_304893 364
76 3300006175 Ga0070712_100052359 Ga0070712_1000523591 365
77 3300025915 Ga0207693_10176339 Ga0207693_101763392 365
78 3300035113 Ga0373936_0027130 Ga0373936_0027130_782_1918 365
79 3300035170 Ga0373943_0000261 Ga0373943_0000261_20425_21561 365
80 3300035170 Ga0373943_0054365 Ga0373943_0054365_561_1697 365
81 3300035171 Ga0373946_0024627 Ga0373946_0024627_256_1392 365
82 3300035692 Ga0373935_0066253 Ga0373935_0066253_281_1417 365
83 3300035695 Ga0373927_0003788 Ga0373927_0003788_297_1433 365
84 3300035695 Ga0373927_0059904 Ga0373927_0059904_309_1445 365
85 3300035725 Ga0373947_0033218 Ga0373947_0033218_732_1868 365
86 3300035725 Ga0373947_0038909 Ga0373947_0038909_1225_2361 365
87 3300036647 Ga0316582_0213509 Ga0316582_0213509_11_1168 365
88 3300037068 Ga0373925_0040551 Ga0373925_0040551_1114_2250 365
89 3300039447 Ga0436361_0112327 Ga0436361_0112327_288_1424 365
90 3300046462 Ga0495651_0194257 Ga0495651_0194257_130_1266 365
91 3300046463 Ga0495653_0137502 Ga0495653_0137502_249_1397 365
92 3300046477 Ga0495664_0000385 Ga0495664_0000385_4972_6108 365
93 3300046514 Ga0495618_0139032 Ga0495618_0139032_212_1348 365
94 3300046517 Ga0495630_0031144 Ga0495630_0031144_2566_3702 365
95 3300046517 Ga0495630_0042715 Ga0495630_0042715_744_1880 365
96 3300046531 Ga0495665_0027276 Ga0495665_0027276_279_1427 365
97 3300046531 Ga0495665_0065481 Ga0495665_0065481_106_1242 365
98 3300046642 Ga0495634_0007759 Ga0495634_0007759_5670_6806 365
99 3300046663 Ga0495635_0000800 Ga0495635_0000800_1202_2338 365
100 3300046689 Ga0495613_0041659 Ga0495613_0041659_1022_2158 365
101 3300046690 Ga0495624_0003637 Ga0495624_0003637_1396_2532 365
102 3300047319 Ga0495674_0001787 Ga0495674_0001787_6021_7157 365
103 3300047471 Ga0495684_0075131 Ga0495684_0075131_980_2116 365
104 3300047471 Ga0495684_0076363 Ga0495684_0076363_295_1431 365
105 3300047673 Ga0495593_0038636 Ga0495593_0038636_705_1841 365
106 3300053078 Ga0495612_0006049 Ga0495612_0006049_1408_2544 365
107 3300053085 Ga0495619_0082451 Ga0495619_0082451_996_2132 365
108 3300053085 Ga0495619_0103126 Ga0495619_0103126_738_1874 365
109 3300021384 Ga0213876_10012097 Ga0213876_100120973 368
110 3300039437 Ga0436365_0657686 Ga0436365_0657686_22848_23993 368
111 3300049570 Ga0501033_0060430 Ga0501033_0060430_1126_2262 368
112 3300049571 Ga0501034_0275389 Ga0501034_0275389_266_1402 368
113 3300049572 Ga0501036_0122485 Ga0501036_0122485_12_1148 368
114 3300049579 Ga0501043_0150154 Ga0501043_0150154_212_1348 368
115 3300049581 Ga0501047_0046121 Ga0501047_0046121_476_1612 368
116 3300005530 Ga0070679_100289343 Ga0070679_1002893431 369
117 3300025912 Ga0207707_10189204 Ga0207707_101892042 369
118 3300025917 Ga0207660_10104513 Ga0207660_101045132 369
119 3300025921 Ga0207652_10165212 Ga0207652_101652122 369
120 3300049586 Ga0501070_0047057 Ga0501070_0047057_952_2094 369
121 3300049589 Ga0501073_0134401 Ga0501073_0134401_306_1448 369
122 iso_pu_bacteria 2909042592 2909047749 369
123 3300005434 Ga0070709_10023880 Ga0070709_100238802 370
124 3300025906 Ga0207699_10021051 Ga0207699_100210512 370
125 3300025929 Ga0207664_10006820 Ga0207664_100068202 370
126 3300047447 Ga0495685_021510 Ga0495685_021510_869_2026 370
127 3300053078 Ga0495612_0047593 Ga0495612_0047593_614_1732 370
128 3300005435 Ga0070714_100097321 Ga0070714_1000973212 371
129 3300025929 Ga0207664_10092307 Ga0207664_100923073 371
130 3300031241 Ga0265325_10003766 Ga0265325_100037665 371
131 3300031249 Ga0265339_10002624 Ga0265339_100026248 371
132 3300031344 Ga0265316_10111529 Ga0265316_101115292 371
133 3300031595 Ga0265313_10001996 Ga0265313_100019969 371
134 3300037068 Ga0373925_0139038 Ga0373925_0139038_526_1677 371
135 3300007265 Ga0099794_10074803 Ga0099794_100748032 372
136 3300009148 Ga0105243_10062299 Ga0105243_100622993 372
137 3300009551 Ga0105238_10027483 Ga0105238_100274834 372
138 3300025944 Ga0207661_10015374 Ga0207661_100153741 372
139 3300039438 Ga0436360_1257472 Ga0436360_1257472_33_1181 372
140 3300048909 Ga0496106_0193608 Ga0496106_0193608_20_1162 372
141 3300048911 Ga0496108_0176356 Ga0496108_0176356_492_1634 372
142 3300048917 Ga0496114_0144390 Ga0496114_0144390_36_1196 372
143 3300005439 Ga0070711_100032154 Ga0070711_1000321543 373
144 3300006186 Ga0075369_10054202 Ga0075369_100542022 373
145 3300028556 Ga0265337_1007585 Ga0265337_10075852 373
146 3300048907 Ga0496104_0301833 Ga0496104_0301833_23_1183 373
147 3300005331 Ga0070670_100056259 Ga0070670_1000562593 374
148 3300005338 Ga0068868_100002623 Ga0068868_10000262310 374
149 3300005355 Ga0070671_100002901 Ga0070671_1000029018 374
150 3300005364 Ga0070673_100056398 Ga0070673_1000563984 374
151 3300005367 Ga0070667_100024338 Ga0070667_1000243382 374
152 3300005617 Ga0068859_100181268 Ga0068859_1001812682 374
153 3300005618 Ga0068864_100109424 Ga0068864_1001094242 374
154 3300006237 Ga0097621_100081999 Ga0097621_1000819993 374
155 3300006931 Ga0097620_100181273 Ga0097620_1001812732 374
156 3300009098 Ga0105245_10000898 Ga0105245_100008982 374
157 3300009177 Ga0105248_10083721 Ga0105248_100837214 374
158 3300013100 Ga0157373_10066627 Ga0157373_100666273 374
159 3300013296 Ga0157374_10295070 Ga0157374_102950702 374
160 3300014325 Ga0163163_10205249 Ga0163163_102052491 374
161 3300021388 Ga0213875_10000031 Ga0213875_1000003153 374
162 3300024225 Ga0224572_1000034 Ga0224572_10000343 374
163 3300024227 Ga0228598_1011336 Ga0228598_10113362 374
164 3300024227 Ga0228598_1020122 Ga0228598_10201221 374
165 3300025925 Ga0207650_10013257 Ga0207650_100132573 374
166 3300025926 Ga0207659_10017877 Ga0207659_100178772 374
167 3300025928 Ga0207700_10145823 Ga0207700_101458232 374
168 3300025936 Ga0207670_10017840 Ga0207670_100178402 374
169 3300025940 Ga0207691_10095637 Ga0207691_100956373 374
170 3300025941 Ga0207711_10064329 Ga0207711_100643292 374
171 3300025960 Ga0207651_10002803 Ga0207651_100028036 374
172 3300025960 Ga0207651_10026194 Ga0207651_100261942 374
173 3300025986 Ga0207658_10153659 Ga0207658_101536591 374
174 3300026023 Ga0207677_10025711 Ga0207677_100257114 374
175 3300035117 Ga0373953_0022405 Ga0373953_0022405_1215_2342 374
176 3300035410 Ga0373924_0053719 Ga0373924_0053719_504_1631 374
177 3300035692 Ga0373935_0168033 Ga0373935_0168033_340_1467 374
178 3300036401 Ga0373937_0237558 Ga0373937_0237558_579_1706 374
179 3300037853 Ga0436364_0793438 Ga0436364_0793438_19249_20397 374
180 3300039437 Ga0436365_0085454 Ga0436365_0085454_666_1898 374
181 3300046455 Ga0495603_0085819 Ga0495603_0085819_228_1355 374
182 3300046459 Ga0495629_0180675 Ga0495629_0180675_160_1287 374
183 3300046511 Ga0495608_0045485 Ga0495608_0045485_1574_2701 374
184 3300046514 Ga0495618_0059854 Ga0495618_0059854_66_1193 374
185 3300046516 Ga0495628_0050220 Ga0495628_0050220_145_1272 374
186 3300046679 Ga0495623_0018525 Ga0495623_0018525_2153_3280 374
187 3300047317 Ga0495604_0147070 Ga0495604_0147070_334_1461 374
188 3300048911 Ga0496108_0222345 Ga0496108_0222345_134_1258 374
189 3300048915 Ga0496112_0017515 Ga0496112_0017515_3627_4751 374
190 3300049588 Ga0501072_0002322 Ga0501072_0002322_191_1330 374
191 3300049744 Ga0501083_0102997 Ga0501083_0102997_137_1276 374
192 3300053085 Ga0495619_0090413 Ga0495619_0090413_771_1898 374
193 iso_pu_bacteria 2524023210 2524467289 374
194 iso_pu_bacteria 8056681323 8056687601 374
195 3300006178 Ga0075367_10012078 Ga0075367_100120783 375
196 3300021384 Ga0213876_10096307 Ga0213876_100963072 375
197 3300025909 Ga0207705_10102483 Ga0207705_101024832 375
198 3300025928 Ga0207700_10161802 Ga0207700_101618022 375
199 3300031727 Ga0316576_10248913 Ga0316576_102489131 375
200 3300035398 Ga0316574_0003414 Ga0316574_0003414_1755_2894 375
201 3300036712 Ga0316584_0099682 Ga0316584_0099682_154_1293 375
202 3300039437 Ga0436365_0903140 Ga0436365_0903140_1496_2629 375
203 3300048903 Ga0496100_0011897 Ga0496100_0011897_3268_4401 375
204 3300048904 Ga0496101_0002084 Ga0496101_0002084_8490_9623 375
205 3300048905 Ga0496102_0029733 Ga0496102_0029733_3314_4447 375
206 3300048906 Ga0496103_0013488 Ga0496103_0013488_3012_4145 375
207 3300048907 Ga0496104_0006456 Ga0496104_0006456_8712_9845 375
208 3300048908 Ga0496105_0032246 Ga0496105_0032246_1516_2649 375
209 3300048909 Ga0496106_0035173 Ga0496106_0035173_427_1560 375
210 3300048910 Ga0496107_0012023 Ga0496107_0012023_1546_2679 375
211 3300048911 Ga0496108_0008123 Ga0496108_0008123_6275_7408 375
212 3300048911 Ga0496108_0014550 Ga0496108_0014550_1899_3032 375
213 3300048912 Ga0496109_0008742 Ga0496109_0008742_578_1711 375
214 3300048913 Ga0496110_0006704 Ga0496110_0006704_6274_7407 375
215 3300048913 Ga0496110_0059599 Ga0496110_0059599_799_1932 375
216 3300048914 Ga0496111_0018672 Ga0496111_0018672_1092_2225 375
217 3300048916 Ga0496113_0061077 Ga0496113_0061077_760_1929 375
218 3300048916 Ga0496113_0127457 Ga0496113_0127457_446_1579 375
219 3300048917 Ga0496114_0137178 Ga0496114_0137178_719_1852 375
220 3300048918 Ga0496115_0023653 Ga0496115_0023653_3472_4605 375
221 3300050491 nmdc:mga00v17_9760_c1 nmdc:mga00v17_9760_c1_2493_3626 375
222 3300053119 Ga0500595_018756 Ga0500595_018756_720_1853 375
223 3300053131 Ga0500652_000043 Ga0500652_000043_55389_56522 375
224 iso_pu_bacteria 2545555834 2545677611 375
225 iso_pu_bacteria 3003665799 3003667322 375
226 iso_pu_bacteria 641522639 641640346 375
227 iso_pu_bacteria 643348564 643597783 375
228 3300005458 Ga0070681_10007499 Ga0070681_100074997 376
229 3300005530 Ga0070679_100010240 Ga0070679_1000102405 376
230 3300005536 Ga0070697_100014105 Ga0070697_1000141051 376
231 3300005545 Ga0070695_100003310 Ga0070695_1000033102 376
232 3300006914 Ga0075436_100002664 Ga0075436_1000026649 376
233 3300009098 Ga0105245_10276091 Ga0105245_102760912 376
234 3300025918 Ga0207662_10038601 Ga0207662_100386013 376
235 3300025939 Ga0207665_10149648 Ga0207665_101496482 376
236 3300035111 Ga0373923_0034646 Ga0373923_0034646_410_1546 376
237 3300035172 Ga0373955_0025780 Ga0373955_0025780_1795_2931 376
238 3300035695 Ga0373927_0020166 Ga0373927_0020166_2359_3495 376
239 3300035724 Ga0373933_0000325 Ga0373933_0000325_1633_2769 376
240 3300036401 Ga0373937_0002429 Ga0373937_0002429_6165_7301 376
241 3300037068 Ga0373925_0071882 Ga0373925_0071882_438_1574 376
242 3300046454 Ga0495592_0027438 Ga0495592_0027438_250_1386 376
243 3300046459 Ga0495629_0011442 Ga0495629_0011442_200_1336 376
244 3300046462 Ga0495651_0002748 Ga0495651_0002748_2719_3855 376
245 3300046463 Ga0495653_0012932 Ga0495653_0012932_4251_5387 376
246 3300046511 Ga0495608_0006299 Ga0495608_0006299_3058_4194 376
247 3300046514 Ga0495618_0001885 Ga0495618_0001885_782_1918 376
248 3300046516 Ga0495628_0167126 Ga0495628_0167126_201_1337 376
249 3300046526 Ga0495666_0087671 Ga0495666_0087671_36_1172 376
250 3300046529 Ga0495652_0020776 Ga0495652_0020776_622_1758 376
251 3300046533 Ga0495640_0003282 Ga0495640_0003282_7714_8850 376
252 3300046536 Ga0495587_0000568 Ga0495587_0000568_12250_13386 376
253 3300046543 Ga0495645_0024674 Ga0495645_0024674_3051_4187 376
254 3300046559 Ga0495667_0002169 Ga0495667_0002169_6144_7280 376
255 3300046642 Ga0495634_0021991 Ga0495634_0021991_1261_2397 376
256 3300046663 Ga0495635_0048578 Ga0495635_0048578_1591_2727 376
257 3300046678 Ga0495599_0008520 Ga0495599_0008520_922_2058 376
258 3300046679 Ga0495623_0001240 Ga0495623_0001240_11509_12645 376
259 3300046680 Ga0495646_0055013 Ga0495646_0055013_989_2125 376
260 3300046689 Ga0495613_0013543 Ga0495613_0013543_3795_4931 376
261 3300046690 Ga0495624_0109282 Ga0495624_0109282_145_1281 376
262 3300046809 Ga0495600_0003096 Ga0495600_0003096_3706_4842 376
263 3300047317 Ga0495604_0000168 Ga0495604_0000168_50120_51256 376
264 3300047319 Ga0495674_0004591 Ga0495674_0004591_4511_5647 376
265 3300047321 Ga0495676_0059014 Ga0495676_0059014_1328_2464 376
266 3300047322 Ga0495680_0000415 Ga0495680_0000415_18628_19764 376
267 3300047322 Ga0495680_0179150 Ga0495680_0179150_326_1462 376
268 3300047444 Ga0495675_0006869 Ga0495675_0006869_4566_5702 376
269 3300047471 Ga0495684_0116072 Ga0495684_0116072_248_1384 376
270 3300047673 Ga0495593_0057331 Ga0495593_0057331_690_1826 376
271 3300048088 Ga0495602_0001302 Ga0495602_0001302_18927_20063 376
272 3300049571 Ga0501034_0318911 Ga0501034_0318911_195_1340 376
273 3300049581 Ga0501047_0034600 Ga0501047_0034600_1683_2828 376
274 3300049583 Ga0501067_0036049 Ga0501067_0036049_1375_2520 376
275 3300049586 Ga0501070_0066001 Ga0501070_0066001_1609_2754 376
276 3300049588 Ga0501072_0108720 Ga0501072_0108720_294_1439 376
277 3300049742 Ga0501080_0084856 Ga0501080_0084856_359_1504 376
278 3300049823 Ga0501044_0340242 Ga0501044_0340242_135_1280 376
279 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_286784_287968 376
280 3300053077 Ga0495601_0007869 Ga0495601_0007869_4125_5261 376
281 3300053078 Ga0495612_0000774 Ga0495612_0000774_5697_6833 376
282 3300053084 Ga0495595_0000265 Ga0495595_0000265_663_1799 376
283 3300053085 Ga0495619_0000354 Ga0495619_0000354_128_1264 376
284 3300060353 Ga0501082_0269318 Ga0501082_0269318_103_1248 376
285 iso_pu_bacteria 2829745981 2829746407 376
286 iso_pu_bacteria 2919450847 2919453038 376
287 iso_pu_bacteria 8001845381 8001850626 376
288 3300003215 JGI25153J46596_10006762 JGI25153J46596_100067621 377
289 3300005439 Ga0070711_100227183 Ga0070711_1002271831 377
290 3300006028 Ga0070717_10178156 Ga0070717_101781562 377
291 3300006177 Ga0075362_10044379 Ga0075362_100443792 377
292 3300006178 Ga0075367_10100456 Ga0075367_101004562 377
293 3300006847 Ga0075431_100097396 Ga0075431_1000973962 377
294 3300009093 Ga0105240_10004682 Ga0105240_1000468212 377
295 3300009094 Ga0111539_10171707 Ga0111539_101717073 377
296 3300021377 Ga0213874_10048999 Ga0213874_100489991 377
297 3300025297 Ga0209758_1000312 Ga0209758_100031283 377
298 3300025913 Ga0207695_10000107 Ga0207695_1000010718 377
299 3300025915 Ga0207693_10021913 Ga0207693_100219134 377
300 3300025929 Ga0207664_10032181 Ga0207664_100321813 377
301 3300026142 Ga0207698_10007221 Ga0207698_100072213 377
302 3300031241 Ga0265325_10011638 Ga0265325_100116382 377
303 3300035171 Ga0373946_0095198 Ga0373946_0095198_14_1150 377
304 3300035692 Ga0373935_0057105 Ga0373935_0057105_783_1925 377
305 3300035725 Ga0373947_0025548 Ga0373947_0025548_230_1366 377
306 3300037068 Ga0373925_0148109 Ga0373925_0148109_361_1503 377
307 3300037853 Ga0436364_0033507 Ga0436364_0033507_98_1483 377
308 3300044684 Ga0466966_0045849 Ga0466966_0045849_709_1851 377
309 3300044694 Ga0466963_0132010 Ga0466963_0132010_81_1223 377
310 3300046455 Ga0495603_0073678 Ga0495603_0073678_382_1524 377
311 3300046472 Ga0495580_0037671 Ga0495580_0037671_1038_2180 377
312 3300046476 Ga0495662_0037470 Ga0495662_0037470_517_1659 377
313 3300046533 Ga0495640_0112404 Ga0495640_0112404_470_1612 377
314 3300046674 Ga0495588_0079273 Ga0495588_0079273_28_1164 377
315 3300048909 Ga0496106_0085211 Ga0496106_0085211_1065_2213 377
316 3300048913 Ga0496110_0105767 Ga0496110_0105767_1319_2452 377
317 3300049570 Ga0501033_0096076 Ga0501033_0096076_807_1964 377
318 3300049742 Ga0501080_0248477 Ga0501080_0248477_254_1387 377
319 3300049744 Ga0501083_0118716 Ga0501083_0118716_330_1463 377
320 3300050494 nmdc:mga06z11_84607_c1 nmdc:mga06z11_84607_c1_261_1397 377
321 3300050510 nmdc:mga06r32_231467_c1 nmdc:mga06r32_231467_c1_626_1768 377
322 3300053077 Ga0495601_0031433 Ga0495601_0031433_191_1333 377
323 3300053094 Ga0500566_0000383 Ga0500566_0000383_5985_7247 377
324 3300053117 Ga0500593_000134 Ga0500593_000134_13103_14260 377
325 3300053119 Ga0500595_027905 Ga0500595_027905_298_1431 377
326 3300053139 Ga0500568_0000005 Ga0500568_0000005_271369_272526 377
327 3300003215 JGI25153J46596_10002083 JGI25153J46596_100020833 378
328 3300003215 JGI25153J46596_10003147 JGI25153J46596_100031473 378
329 3300005333 Ga0070677_10033564 Ga0070677_100335643 378
330 3300005336 Ga0070680_100003784 Ga0070680_1000037845 378
331 3300005340 Ga0070689_100011341 Ga0070689_1000113414 378
332 3300005354 Ga0070675_100124035 Ga0070675_1001240352 378
333 3300005356 Ga0070674_100005761 Ga0070674_1000057616 378
334 3300005365 Ga0070688_100008590 Ga0070688_1000085903 378
335 3300005366 Ga0070659_100007423 Ga0070659_1000074232 378
336 3300005367 Ga0070667_100124451 Ga0070667_1001244512 378
337 3300005436 Ga0070713_100018647 Ga0070713_1000186473 378
338 3300005436 Ga0070713_100192177 Ga0070713_1001921772 378
339 3300005441 Ga0070700_100137114 Ga0070700_1001371142 378
340 3300005456 Ga0070678_100040542 Ga0070678_1000405422 378
341 3300005458 Ga0070681_10001010 Ga0070681_1000101017 378
342 3300005471 Ga0070698_100048964 Ga0070698_1000489643 378
343 3300005536 Ga0070697_100103146 Ga0070697_1001031461 378
344 3300005549 Ga0070704_100001522 Ga0070704_1000015228 378
345 3300005563 Ga0068855_100003400 Ga0068855_10000340018 378
346 3300005577 Ga0068857_100130343 Ga0068857_1001303431 378
347 3300005577 Ga0068857_100308193 Ga0068857_1003081932 378
348 3300005617 Ga0068859_100049426 Ga0068859_1000494262 378
349 3300005617 Ga0068859_100408670 Ga0068859_1004086701 378
350 3300005618 Ga0068864_100172550 Ga0068864_1001725501 378
351 3300005618 Ga0068864_100225319 Ga0068864_1002253192 378
352 3300005841 Ga0068863_100094543 Ga0068863_1000945433 378
353 3300005937 Ga0081455_10024342 Ga0081455_100243426 378
354 3300006028 Ga0070717_10182202 Ga0070717_101822022 378
355 3300006195 Ga0075366_10001179 Ga0075366_100011793 378
356 3300006931 Ga0097620_100049426 Ga0097620_1000494262 378
357 3300006931 Ga0097620_100408691 Ga0097620_1004086911 378
358 3300009148 Ga0105243_10118081 Ga0105243_101180811 378
359 3300009553 Ga0105249_10000366 Ga0105249_100003668 378
360 3300013100 Ga0157373_10074325 Ga0157373_100743252 378
361 3300013104 Ga0157370_10007752 Ga0157370_100077529 378
362 3300013307 Ga0157372_10001212 Ga0157372_100012128 378
363 3300017792 Ga0163161_10131273 Ga0163161_101312732 378
364 3300025297 Ga0209758_1000308 Ga0209758_100030824 378
365 3300025297 Ga0209758_1028725 Ga0209758_10287252 378
366 3300025893 Ga0207682_10059186 Ga0207682_100591862 378
367 3300025901 Ga0207688_10025459 Ga0207688_100254594 378
368 3300025907 Ga0207645_10037589 Ga0207645_100375893 378
369 3300025908 Ga0207643_10107794 Ga0207643_101077941 378
370 3300025912 Ga0207707_10005935 Ga0207707_100059359 378
371 3300025917 Ga0207660_10120633 Ga0207660_101206332 378
372 3300025921 Ga0207652_10005989 Ga0207652_100059893 378
373 3300025923 Ga0207681_10019099 Ga0207681_100190993 378
374 3300025927 Ga0207687_10309102 Ga0207687_103091021 378
375 3300025928 Ga0207700_10034853 Ga0207700_100348533 378
376 3300025929 Ga0207664_10028136 Ga0207664_100281362 378
377 3300025931 Ga0207644_10229240 Ga0207644_102292402 378
378 3300025932 Ga0207690_10044356 Ga0207690_100443562 378
379 3300025936 Ga0207670_10019375 Ga0207670_100193753 378
380 3300025937 Ga0207669_10008682 Ga0207669_100086824 378
381 3300025940 Ga0207691_10138170 Ga0207691_101381703 378
382 3300025960 Ga0207651_10168876 Ga0207651_101688762 378
383 3300025961 Ga0207712_10002501 Ga0207712_100025017 378
384 3300025972 Ga0207668_10227145 Ga0207668_102271451 378
385 3300026035 Ga0207703_10168976 Ga0207703_101689762 378
386 3300026041 Ga0207639_10005685 Ga0207639_100056853 378
387 3300026088 Ga0207641_10049115 Ga0207641_100491152 378
388 3300026095 Ga0207676_10022380 Ga0207676_100223804 378
389 3300026095 Ga0207676_10035276 Ga0207676_100352763 378
390 3300026116 Ga0207674_10035866 Ga0207674_100358662 378
391 3300026116 Ga0207674_10173314 Ga0207674_101733142 378
392 3300026118 Ga0207675_100241923 Ga0207675_1002419232 378
393 3300026118 Ga0207675_100269956 Ga0207675_1002699562 378
394 3300026121 Ga0207683_10042766 Ga0207683_100427663 378
395 3300026121 Ga0207683_10298291 Ga0207683_102982912 378
396 3300028381 Ga0268264_10054902 Ga0268264_100549021 378
397 3300028800 Ga0265338_10013547 Ga0265338_100135473 378
398 3300031235 Ga0265330_10012094 Ga0265330_100120942 378
399 3300031247 Ga0265340_10008344 Ga0265340_100083445 378
400 3300031249 Ga0265339_10000054 Ga0265339_1000005443 378
401 3300031595 Ga0265313_10001832 Ga0265313_1000183217 378
402 3300032002 Ga0307416_100259201 Ga0307416_1002592011 378
403 3300035086 Ga0373934_0004863 Ga0373934_0004863_1330_2481 378
404 3300035114 Ga0373939_0019841 Ga0373939_0019841_281_1441 378
405 3300035115 Ga0373941_0053487 Ga0373941_0053487_39_1208 378
406 3300035117 Ga0373953_0015305 Ga0373953_0015305_1300_2451 378
407 3300035118 Ga0373954_0001810 Ga0373954_0001810_6419_7570 378
408 3300035119 Ga0373956_0012138 Ga0373956_0012138_2266_3417 378
409 3300035120 Ga0373957_0008145 Ga0373957_0008145_898_2049 378
410 3300035170 Ga0373943_0054003 Ga0373943_0054003_552_1691 378
411 3300035172 Ga0373955_0000357 Ga0373955_0000357_3698_4849 378
412 3300035410 Ga0373924_0002287 Ga0373924_0002287_5202_6353 378
413 3300035691 Ga0373931_0008332 Ga0373931_0008332_702_1847 378
414 3300035695 Ga0373927_0171522 Ga0373927_0171522_158_1297 378
415 3300035724 Ga0373933_0004421 Ga0373933_0004421_6418_7569 378
416 3300035725 Ga0373947_0061242 Ga0373947_0061242_1005_2144 378
417 3300036401 Ga0373937_0004812 Ga0373937_0004812_3898_5049 378
418 3300037068 Ga0373925_0028146 Ga0373925_0028146_1833_2969 378
419 3300037466 Ga0395898_0014622 Ga0395898_0014622_3029_4198 378
420 3300039437 Ga0436365_1369522 Ga0436365_1369522_21_1166 378
421 3300039437 Ga0436365_1489713 Ga0436365_1489713_239_1393 378
422 3300042125 Ga0450923_006355 Ga0450923_006355_460_1608 378
423 3300046454 Ga0495592_0010291 Ga0495592_0010291_3351_4502 378
424 3300046455 Ga0495603_0016472 Ga0495603_0016472_1319_2458 378
425 3300046457 Ga0495590_0055695 Ga0495590_0055695_219_1358 378
426 3300046459 Ga0495629_0005277 Ga0495629_0005277_2112_3263 378
427 3300046462 Ga0495651_0007674 Ga0495651_0007674_3224_4375 378
428 3300046463 Ga0495653_0004652 Ga0495653_0004652_6459_7610 378
429 3300046511 Ga0495608_0005565 Ga0495608_0005565_6359_7510 378
430 3300046514 Ga0495618_0021032 Ga0495618_0021032_1995_3146 378
431 3300046516 Ga0495628_0014732 Ga0495628_0014732_2071_3222 378
432 3300046529 Ga0495652_0027961 Ga0495652_0027961_465_1616 378
433 3300046533 Ga0495640_0022826 Ga0495640_0022826_814_1965 378
434 3300046543 Ga0495645_0027819 Ga0495645_0027819_1036_2187 378
435 3300046559 Ga0495667_0002715 Ga0495667_0002715_8418_9569 378
436 3300046663 Ga0495635_0007564 Ga0495635_0007564_3082_4233 378
437 3300046663 Ga0495635_0024285 Ga0495635_0024285_382_1518 378
438 3300046675 Ga0495657_0015592 Ga0495657_0015592_3224_4375 378
439 3300046678 Ga0495599_0008026 Ga0495599_0008026_4967_6118 378
440 3300046679 Ga0495623_0006690 Ga0495623_0006690_1308_2459 378
441 3300046680 Ga0495646_0004537 Ga0495646_0004537_750_1901 378
442 3300046683 Ga0495658_0217094 Ga0495658_0217094_41_1180 378
443 3300046689 Ga0495613_0011001 Ga0495613_0011001_4760_5911 378
444 3300046689 Ga0495613_0097432 Ga0495613_0097432_593_1732 378
445 3300046809 Ga0495600_0001425 Ga0495600_0001425_3669_4820 378
446 3300047317 Ga0495604_0016356 Ga0495604_0016356_1180_2331 378
447 3300047322 Ga0495680_0011266 Ga0495680_0011266_3553_4704 378
448 3300047471 Ga0495684_0004699 Ga0495684_0004699_6397_7548 378
449 3300048914 Ga0496111_0041816 Ga0496111_0041816_1578_2738 378
450 3300048915 Ga0496112_0106012 Ga0496112_0106012_819_1979 378
451 3300048918 Ga0496115_0182037 Ga0496115_0182037_515_1651 378
452 3300048919 Ga0496116_0002755 Ga0496116_0002755_898_2115 378
453 3300048920 Ga0496117_0048428 Ga0496117_0048428_1328_2545 378
454 3300048929 Ga0496126_0026035 Ga0496126_0026035_4461_5600 378
455 3300048929 Ga0496126_0052219 Ga0496126_0052219_2170_3321 378
456 3300049569 Ga0501032_0088695 Ga0501032_0088695_301_1443 378
457 3300049571 Ga0501034_0134166 Ga0501034_0134166_325_1464 378
458 3300049574 Ga0501038_0014878 Ga0501038_0014878_849_1988 378
459 3300049575 Ga0501039_0203043 Ga0501039_0203043_191_1333 378
460 3300049578 Ga0501042_0055181 Ga0501042_0055181_625_1764 378
461 3300049581 Ga0501047_0243819 Ga0501047_0243819_74_1231 378
462 3300049582 Ga0501048_0001047 Ga0501048_0001047_7389_8528 378
463 3300049583 Ga0501067_0113005 Ga0501067_0113005_349_1488 378
464 3300049590 Ga0501074_0013077 Ga0501074_0013077_2750_3889 378
465 3300049592 Ga0501076_0026991 Ga0501076_0026991_2430_3569 378
466 3300049742 Ga0501080_0121301 Ga0501080_0121301_994_2133 378
467 3300049744 Ga0501083_0016513 Ga0501083_0016513_2274_3413 378
468 3300049823 Ga0501044_0000509 Ga0501044_0000509_6496_7635 378
469 3300050494 nmdc:mga06z11_73017_c1 nmdc:mga06z11_73017_c1_439_1581 378
470 3300050512 nmdc:mga0n895_94093_c1 nmdc:mga0n895_94093_c1_106_1368 378
471 3300050516 nmdc:mga0sz30_75785_c1 nmdc:mga0sz30_75785_c1_273_1415 378
472 3300053077 Ga0495601_0001764 Ga0495601_0001764_8536_9687 378
473 3300053077 Ga0495601_0048473 Ga0495601_0048473_872_2008 378
474 3300053084 Ga0495595_0021713 Ga0495595_0021713_701_1837 378
475 3300053085 Ga0495619_0003889 Ga0495619_0003889_2036_3187 378
476 3300053085 Ga0495619_0173034 Ga0495619_0173034_122_1258 378
477 3300053153 Ga0500616_0000038 Ga0500616_0000038_81957_83096 378
478 3300054114 Ga0501084_0097600 Ga0501084_0097600_838_1977 378
479 3300060353 Ga0501082_0026070 Ga0501082_0026070_2477_3616 378
480 iso_pu_bacteria 2513237141 2513890266 378
481 3300005328 Ga0070676_10043602 Ga0070676_100436023 379
482 3300005331 Ga0070670_100075627 Ga0070670_1000756272 379
483 3300005333 Ga0070677_10006415 Ga0070677_100064151 379
484 3300005365 Ga0070688_100101294 Ga0070688_1001012943 379
485 3300005435 Ga0070714_100091746 Ga0070714_1000917461 379
486 3300005459 Ga0068867_100019168 Ga0068867_1000191683 379
487 3300005466 Ga0070685_10105051 Ga0070685_101050511 379
488 3300005530 Ga0070679_100182565 Ga0070679_1001825651 379
489 3300005543 Ga0070672_100003393 Ga0070672_1000033939 379
490 3300005981 Ga0081538_10004768 Ga0081538_100047689 379
491 3300006051 Ga0075364_10020580 Ga0075364_100205804 379
492 3300006177 Ga0075362_10003097 Ga0075362_100030974 379
493 3300006178 Ga0075367_10065950 Ga0075367_100659503 379
494 3300006844 Ga0075428_100000690 Ga0075428_10000069030 379
495 3300006844 Ga0075428_100159494 Ga0075428_1001594943 379
496 3300006846 Ga0075430_100013482 Ga0075430_1000134827 379
497 3300006846 Ga0075430_100185337 Ga0075430_1001853372 379
498 3300006847 Ga0075431_100000098 Ga0075431_10000009832 379
499 3300006847 Ga0075431_100276217 Ga0075431_1002762172 379
500 3300006880 Ga0075429_100009106 Ga0075429_1000091062 379
501 3300007076 Ga0075435_100026824 Ga0075435_1000268242 379
502 3300009094 Ga0111539_10000703 Ga0111539_1000070338 379
503 3300009094 Ga0111539_10138857 Ga0111539_101388572 379
504 3300009147 Ga0114129_10000057 Ga0114129_100000573 379
505 3300009147 Ga0114129_10119075 Ga0114129_101190753 379
506 3300013297 Ga0157378_10099275 Ga0157378_100992753 379
507 3300013308 Ga0157375_10236355 Ga0157375_102363553 379
508 3300014326 Ga0157380_10248157 Ga0157380_102481572 379
509 3300014969 Ga0157376_10089692 Ga0157376_100896922 379
510 3300025893 Ga0207682_10001973 Ga0207682_100019739 379
511 3300025903 Ga0207680_10166839 Ga0207680_101668391 379
512 3300025929 Ga0207664_10061831 Ga0207664_100618315 379
513 3300025936 Ga0207670_10054094 Ga0207670_100540941 379
514 3300025940 Ga0207691_10002047 Ga0207691_100020471 379
515 3300026041 Ga0207639_10242315 Ga0207639_102423151 379
516 3300026089 Ga0207648_10016126 Ga0207648_100161264 379
517 3300026121 Ga0207683_10001331 Ga0207683_1000133112 379
518 3300027907 Ga0207428_10008746 Ga0207428_100087467 379
519 3300039437 Ga0436365_0311840 Ga0436365_0311840_326_1474 379
520 3300039437 Ga0436365_0878170 Ga0436365_0878170_928_2082 379
521 3300046474 Ga0495605_0123784 Ga0495605_0123784_19_1158 379
522 3300046539 Ga0495621_0043207 Ga0495621_0043207_47_1186 379
523 3300048090 Ga0495615_0003085 Ga0495615_0003085_472_1611 379
524 3300048903 Ga0496100_0063474 Ga0496100_0063474_1001_2140 379
525 3300048907 Ga0496104_0036217 Ga0496104_0036217_2747_3892 379
526 3300048908 Ga0496105_0099697 Ga0496105_0099697_128_1273 379
527 3300048910 Ga0496107_0085708 Ga0496107_0085708_639_1784 379
528 3300048911 Ga0496108_0105696 Ga0496108_0105696_1007_2146 379
529 3300048913 Ga0496110_0053328 Ga0496110_0053328_2059_3204 379
530 3300048917 Ga0496114_0089694 Ga0496114_0089694_800_1939 379
531 3300048918 Ga0496115_0161066 Ga0496115_0161066_65_1210 379
532 3300049568 Ga0501031_0019583 Ga0501031_0019583_710_1852 379
533 3300049570 Ga0501033_0040664 Ga0501033_0040664_118_1284 379
534 3300049570 Ga0501033_0059678 Ga0501033_0059678_855_1997 379
535 3300049570 Ga0501033_0083339 Ga0501033_0083339_30_1223 379
536 3300049571 Ga0501034_0028861 Ga0501034_0028861_1367_2560 379
537 3300049571 Ga0501034_0078354 Ga0501034_0078354_1559_2701 379
538 3300049571 Ga0501034_0084059 Ga0501034_0084059_938_2080 379
539 3300049572 Ga0501036_0049226 Ga0501036_0049226_1572_2714 379
540 3300049572 Ga0501036_0120535 Ga0501036_0120535_784_1977 379
541 3300049573 Ga0501037_0067159 Ga0501037_0067159_275_1417 379
542 3300049573 Ga0501037_0120523 Ga0501037_0120523_96_1289 379
543 3300049574 Ga0501038_0002943 Ga0501038_0002943_12837_13979 379
544 3300049574 Ga0501038_0017952 Ga0501038_0017952_199_1392 379
545 3300049575 Ga0501039_0030956 Ga0501039_0030956_2707_3849 379
546 3300049575 Ga0501039_0189868 Ga0501039_0189868_29_1192 379
547 3300049579 Ga0501043_0119338 Ga0501043_0119338_840_1982 379
548 3300049579 Ga0501043_0197854 Ga0501043_0197854_246_1439 379
549 3300049581 Ga0501047_0010604 Ga0501047_0010604_6100_7293 379
550 3300049583 Ga0501067_0051045 Ga0501067_0051045_691_1884 379
551 3300049587 Ga0501071_0077009 Ga0501071_0077009_861_2036 379
552 3300049588 Ga0501072_0005296 Ga0501072_0005296_714_1889 379
553 3300049589 Ga0501073_0121462 Ga0501073_0121462_412_1605 379
554 3300049591 Ga0501075_0123896 Ga0501075_0123896_493_1668 379
555 3300049742 Ga0501080_0018950 Ga0501080_0018950_3746_4939 379
556 3300049822 Ga0501035_0017022 Ga0501035_0017022_4931_6073 379
557 3300049823 Ga0501044_0008635 Ga0501044_0008635_9727_10920 379
558 3300049823 Ga0501044_0097349 Ga0501044_0097349_1704_2870 379
559 3300049823 Ga0501044_0154290 Ga0501044_0154290_223_1365 379
560 3300050489 nmdc:mga03683_3554_c1 nmdc:mga03683_3554_c1_2563_3723 379
561 3300050493 nmdc:mga0k408_66566_c1 nmdc:mga0k408_66566_c1_532_1692 379
562 3300050507 nmdc:mga05p37_2362_c1 nmdc:mga05p37_2362_c1_14520_15659 379
563 3300050507 nmdc:mga05p37_45624_c1 nmdc:mga05p37_45624_c1_1949_3091 379
564 3300050508 nmdc:mga09592_16449_c1 nmdc:mga09592_16449_c1_4705_5844 379
565 3300050509 nmdc:mga0qj67_7709_c1 nmdc:mga0qj67_7709_c1_19_1158 379
566 3300050510 nmdc:mga06r32_1530_c1 nmdc:mga06r32_1530_c1_17577_18716 379
567 3300050511 nmdc:mga08y16_1107_c1 nmdc:mga08y16_1107_c1_20704_21843 379
568 3300050511 nmdc:mga08y16_114383_c1 nmdc:mga08y16_114383_c1_221_1360 379
569 3300050512 nmdc:mga0n895_20390_c1 nmdc:mga0n895_20390_c1_2055_3194 379
570 3300050513 nmdc:mga0rr50_104447_c1 nmdc:mga0rr50_104447_c1_274_1413 379
571 3300050515 nmdc:mga0a205_23199_c1 nmdc:mga0a205_23199_c1_1082_2221 379
572 3300053085 Ga0495619_0083293 Ga0495619_0083293_608_1747 379
573 3300003203 JGI25406J46586_10007117 JGI25406J46586_100071171 380
574 3300005330 Ga0070690_100129472 Ga0070690_1001294721 380
575 3300005340 Ga0070689_100015423 Ga0070689_1000154231 380
576 3300005343 Ga0070687_100021537 Ga0070687_1000215373 380
577 3300005344 Ga0070661_100129529 Ga0070661_1001295292 380
578 3300005365 Ga0070688_100090839 Ga0070688_1000908392 380
579 3300005434 Ga0070709_10004047 Ga0070709_100040473 380
580 3300005436 Ga0070713_100034533 Ga0070713_1000345332 380
581 3300005436 Ga0070713_100146154 Ga0070713_1001461541 380
582 3300005437 Ga0070710_10012502 Ga0070710_100125022 380
583 3300005439 Ga0070711_100038994 Ga0070711_1000389942 380
584 3300005457 Ga0070662_100020173 Ga0070662_1000201732 380
585 3300005564 Ga0070664_100026016 Ga0070664_1000260163 380
586 3300005615 Ga0070702_100058593 Ga0070702_1000585933 380
587 3300005842 Ga0068858_100208551 Ga0068858_1002085512 380
588 3300005937 Ga0081455_10003898 Ga0081455_100038989 380
589 3300005981 Ga0081538_10051010 Ga0081538_100510102 380
590 3300005983 Ga0081540_1000105 Ga0081540_100010578 380
591 3300005983 Ga0081540_1001881 Ga0081540_100188111 380
592 3300005983 Ga0081540_1007650 Ga0081540_10076505 380
593 3300005985 Ga0081539_10000891 Ga0081539_100008911 380
594 3300006028 Ga0070717_10048077 Ga0070717_100480772 380
595 3300006042 Ga0075368_10021774 Ga0075368_100217742 380
596 3300006048 Ga0075363_100060200 Ga0075363_1000602002 380
597 3300006048 Ga0075363_100116589 Ga0075363_1001165891 380
598 3300006051 Ga0075364_10112960 Ga0075364_101129601 380
599 3300006163 Ga0070715_10005445 Ga0070715_100054452 380
600 3300006173 Ga0070716_100014992 Ga0070716_1000149923 380
601 3300006175 Ga0070712_100004767 Ga0070712_1000047672 380
602 3300006178 Ga0075367_10026837 Ga0075367_100268372 380
603 3300006353 Ga0075370_10066134 Ga0075370_100661342 380
604 3300006844 Ga0075428_100019356 Ga0075428_1000193563 380
605 3300006846 Ga0075430_100001644 Ga0075430_1000016442 380
606 3300006847 Ga0075431_100005461 Ga0075431_1000054614 380
607 3300006847 Ga0075431_100343066 Ga0075431_1003430661 380
608 3300006871 Ga0075434_100106958 Ga0075434_1001069582 380
609 3300006914 Ga0075436_100051103 Ga0075436_1000511032 380
610 3300006914 Ga0075436_100217860 Ga0075436_1002178601 380
611 3300007076 Ga0075435_100047016 Ga0075435_1000470161 380
612 3300007265 Ga0099794_10027936 Ga0099794_100279362 380
613 3300007788 Ga0099795_10035914 Ga0099795_100359142 380
614 3300009094 Ga0111539_10068500 Ga0111539_100685002 380
615 3300009098 Ga0105245_10053403 Ga0105245_100534032 380
616 3300009147 Ga0114129_10003135 Ga0114129_100031354 380
617 3300009553 Ga0105249_10128236 Ga0105249_101282362 380
618 3300010159 Ga0099796_10001780 Ga0099796_100017802 380
619 3300025898 Ga0207692_10007136 Ga0207692_100071362 380
620 3300025905 Ga0207685_10017067 Ga0207685_100170672 380
621 3300025906 Ga0207699_10052503 Ga0207699_100525032 380
622 3300025915 Ga0207693_10010902 Ga0207693_100109024 380
623 3300025916 Ga0207663_10127641 Ga0207663_101276411 380
624 3300025918 Ga0207662_10005064 Ga0207662_100050641 380
625 3300025920 Ga0207649_10074669 Ga0207649_100746691 380
626 3300025921 Ga0207652_10050604 Ga0207652_100506042 380
627 3300025927 Ga0207687_10070089 Ga0207687_100700892 380
628 3300025928 Ga0207700_10148972 Ga0207700_101489722 380
629 3300025933 Ga0207706_10047931 Ga0207706_100479313 380
630 3300025936 Ga0207670_10013413 Ga0207670_100134133 380
631 3300025939 Ga0207665_10001716 Ga0207665_1000171612 380
632 3300025945 Ga0207679_10030219 Ga0207679_100302191 380
633 3300025961 Ga0207712_10093383 Ga0207712_100933832 380
634 3300026035 Ga0207703_10245897 Ga0207703_102458972 380
635 3300027512 Ga0209179_1005067 Ga0209179_10050671 380
636 3300027907 Ga0207428_10066812 Ga0207428_100668123 380
637 3300031235 Ga0265330_10015445 Ga0265330_100154454 380
638 3300031238 Ga0265332_10001857 Ga0265332_100018575 380
639 3300031241 Ga0265325_10012217 Ga0265325_100122174 380
640 3300031241 Ga0265325_10078671 Ga0265325_100786712 380
641 3300031242 Ga0265329_10004050 Ga0265329_100040503 380
642 3300031242 Ga0265329_10023902 Ga0265329_100239022 380
643 3300031247 Ga0265340_10006014 Ga0265340_100060147 380
644 3300031247 Ga0265340_10010587 Ga0265340_100105873 380
645 3300031249 Ga0265339_10005140 Ga0265339_100051403 380
646 3300031249 Ga0265339_10016311 Ga0265339_100163113 380
647 3300031250 Ga0265331_10007501 Ga0265331_100075012 380
648 3300031250 Ga0265331_10016215 Ga0265331_100162154 380
649 3300031344 Ga0265316_10221080 Ga0265316_102210802 380
650 3300031595 Ga0265313_10005086 Ga0265313_100050864 380
651 3300031711 Ga0265314_10008808 Ga0265314_100088084 380
652 3300031712 Ga0265342_10000092 Ga0265342_1000009274 380
653 3300031712 Ga0265342_10004949 Ga0265342_100049498 380
654 3300031712 Ga0265342_10006461 Ga0265342_1000646110 380
655 3300035086 Ga0373934_0027427 Ga0373934_0027427_172_1323 380
656 3300035120 Ga0373957_0053391 Ga0373957_0053391_242_1393 380
657 3300035172 Ga0373955_0081238 Ga0373955_0081238_506_1657 380
658 3300035692 Ga0373935_0074012 Ga0373935_0074012_814_1965 380
659 3300035724 Ga0373933_0028802 Ga0373933_0028802_275_1426 380
660 3300036401 Ga0373937_0001589 Ga0373937_0001589_16666_17817 380
661 3300037418 Ga0395900_0226783 Ga0395900_0226783_663_1805 380
662 3300037466 Ga0395898_0063937 Ga0395898_0063937_424_1566 380
663 3300039437 Ga0436365_0505017 Ga0436365_0505017_2737_3882 380
664 3300039450 Ga0436363_0640332 Ga0436363_0640332_1489_2742 380
665 3300041408 Ga0439453_0003561 Ga0439453_0003561_234_1394 380
666 3300041413 Ga0439465_0033510 Ga0439465_0033510_435_1595 380
667 3300042436 Ga0439435_0001109 Ga0439435_0001109_134_1294 380
668 3300046460 Ga0495638_0023817 Ga0495638_0023817_299_1459 380
669 3300047320 Ga0495672_0124407 Ga0495672_0124407_104_1264 380
670 3300048904 Ga0496101_0100185 Ga0496101_0100185_618_1796 380
671 3300048917 Ga0496114_0204612 Ga0496114_0204612_411_1583 380
672 3300048918 Ga0496115_0031238 Ga0496115_0031238_2970_4142 380
673 3300048922 Ga0496119_0006427 Ga0496119_0006427_123_1283 380
674 3300048925 Ga0496122_0013338 Ga0496122_0013338_3064_4224 380
675 3300048926 Ga0496123_0020995 Ga0496123_0020995_3725_4885 380
676 3300049589 Ga0501073_0149721 Ga0501073_0149721_435_1577 380
677 3300049591 Ga0501075_0113910 Ga0501075_0113910_582_1730 380
678 3300049592 Ga0501076_0045805 Ga0501076_0045805_615_1763 380
679 3300049744 Ga0501083_0057189 Ga0501083_0057189_715_1857 380
680 3300049744 Ga0501083_0144294 Ga0501083_0144294_261_1403 380
681 3300050489 nmdc:mga03683_25739_c1 nmdc:mga03683_25739_c1_588_1730 380
682 3300050507 nmdc:mga05p37_29385_c1 nmdc:mga05p37_29385_c1_2018_3172 380
683 3300050509 nmdc:mga0qj67_471_c1 nmdc:mga0qj67_471_c1_396_1538 380
684 3300050510 nmdc:mga06r32_318279_c1 nmdc:mga06r32_318279_c1_213_1355 380
685 3300050510 nmdc:mga06r32_6629_c1 nmdc:mga06r32_6629_c1_5596_6774 380
686 3300050512 nmdc:mga0n895_21450_c1 nmdc:mga0n895_21450_c1_4290_5474 380
687 3300050514 nmdc:mga08x19_47330_c1 nmdc:mga08x19_47330_c1_524_1702 380
688 3300050514 nmdc:mga08x19_59405_c1 nmdc:mga08x19_59405_c1_539_1723 380
689 3300050515 nmdc:mga0a205_70803_c1 nmdc:mga0a205_70803_c1_341_1519 380
690 3300053077 Ga0495601_0128438 Ga0495601_0128438_40_1188 380
691 3300053104 Ga0500556_0000124 Ga0500556_0000124_9522_10682 380
692 3300053134 Ga0500658_0091701 Ga0500658_0091701_16_1158 380
693 3300053153 Ga0500616_0016164 Ga0500616_0016164_337_1479 380
694 3300053153 Ga0500616_0018268 Ga0500616_0018268_1920_3062 380
695 3300053153 Ga0500616_0111902 Ga0500616_0111902_116_1258 380
696 3300054114 Ga0501084_0315008 Ga0501084_0315008_134_1282 380
697 3300060353 Ga0501082_0004415 Ga0501082_0004415_6880_8022 380
698 3300060353 Ga0501082_0063753 Ga0501082_0063753_1099_2247 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13476

AAA_23

AAA domain

59

124

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

79

117

0.89

PF02463

SMC_N

RecF/RecN/SMC N terminal domain

56

128

0.87

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

226

430

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z69-assembly1.cif.gz_B structure of the recombination mediator protein recf-atprs in recfor pathway 0.893 2 380
5z69-assembly1.cif.gz_B structure of the recombination mediator protein recf-atprs in recfor pathway 0.8817 2 380
5z68-assembly2.cif.gz_D structure of the recombination mediator protein recf-atp in recfor pathway 0.8739 1 379
5z68-assembly1.cif.gz_B structure of the recombination mediator protein recf-atp in recfor pathway 0.8721 1 380
5z68-assembly2.cif.gz_D structure of the recombination mediator protein recf-atp in recfor pathway 0.8717 1 379
ID Description Score Start End Superfamily
af_P0A7H0_3_104_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8864 7 114 3.40.50.300
af_P0A7H0_3_104_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8705 7 114 3.40.50.300
af_Q2G275_4_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8668 8 106 3.40.50.300
af_Q2G275_4_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.85 8 106 3.40.50.300
af_P0A7H0_121_296_1.20.1050.90 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;RecF/RecN/SMC, N-terminal domain 0.8311 132 316 1.20.1050.90
ID Description Score Start End GO Terms
AF-A0A6B8LV32-F1-model_v4 deleted 0.9861 2 379
AF-A0A537XLI0-F1-model_v4 DNA replication and repair protein RecF 0.9843 154 380 GO:0000731
GO:0003697
GO:0005524
GO:0005737
GO:0006260
GO:0006302
GO:0016887
AF-A0A327KX86-F1-model_v4 DNA replication and repair protein RecF 0.9804 1 380 GO:0000731
GO:0003697
GO:0005524
GO:0005737
GO:0006260
GO:0006302
GO:0009432
AF-B6R5S7-F1-model_v4 deleted 0.9803 3 379
AF-A0A537XLI0-F1-model_v4 DNA replication and repair protein RecF 0.98 154 380 GO:0000731
GO:0003697
GO:0005524
GO:0005737
GO:0006260
GO:0006302
GO:0016887

Feature Viewer

pLDDT pTM Quality
95.17 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map