F475969
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 334 | 687 | 379 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0033507|Ga0436364_0033507_98_1483 |
| Length | 461 |
| Sequence | MAGHVPGHVLFYCAVPHSRDLTFSIVGNGGRIAIGWSNERRTSNLGVTDYLAAVPSIRRLNLTRFRSYRSAAIGTSANLVVLTGPNGAGKTNLLEAISFLSPGRGLRRARLDDVGYRDRGRHGCKHRGEDAGIGGGVRSWAVSAEVDGALGLANLGTGLEPASFLGPAGAGEAVLSRACRIDREPVGSAAAFADHLRLVWLVPEMDGLFLGSASERRRFLDRLVLAVDAAHAARVAGLERALRSRNRLLEQLAEHRDHDPRWLDAAEQEASTLAVVVAAARAETVRRLAGALAARPAKQNSFPSAEVAVDGWLENLVVTGPAIEAEDRYRAVLRDNRARDAAAGRTLVGPHLSDFAVVYREKALPAGDASTGEQKALLIALVLAHAGLVTAMTGMAPVVLLDEVVAHLDPARRAALFDALEAIGAQVWMTGADPATFVDLGQRADMFDVRDLSCDVPAAMG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 3 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 4 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 5 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 6 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 7 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 103 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 202 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 203 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 305 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 323 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 331 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 332 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 333 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 334 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 0 |
| Isolates | 1.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.59 |
| Nodule | 1 |
| Rhizoplane | 5.73 |
| Rhizosphere | 84.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007117 | 3300003203 | Bacteria | 5125 |
| 2 | JGI25153J46596_10002083 | 3300003215 | Bacteria | 11762 |
| 3 | JGI25153J46596_10003147 | 3300003215 | Bacteria | 9308 |
| 4 | JGI25153J46596_10006762 | 3300003215 | Bacteria | 5750 |
| 5 | Ga0070676_10043602 | 3300005328 | Bacteria | 2608 |
| 6 | Ga0070690_100129472 | 3300005330 | Bacteria | 1703 |
| 7 | Ga0070670_100056259 | 3300005331 | Bacteria | 3376 |
| 8 | Ga0070670_100075627 | 3300005331 | Bacteria | 2893 |
| 9 | Ga0070677_10006415 | 3300005333 | Bacteria | 3907 |
| 10 | Ga0070677_10033564 | 3300005333 | Bacteria | 1977 |
| 11 | Ga0070680_100003784 | 3300005336 | Bacteria | 11309 |
| 12 | Ga0070682_100031186 | 3300005337 | Bacteria | 3223 |
| 13 | Ga0068868_100002623 | 3300005338 | Bacteria | 12471 |
| 14 | Ga0070689_100011341 | 3300005340 | Bacteria | 6380 |
| 15 | Ga0070689_100015423 | 3300005340 | Bacteria | 5571 |
| 16 | Ga0070687_100021537 | 3300005343 | Bacteria | 3032 |
| 17 | Ga0070661_100129529 | 3300005344 | Bacteria | 1894 |
| 18 | Ga0070675_100124035 | 3300005354 | Bacteria | 2197 |
| 19 | Ga0070671_100002901 | 3300005355 | Bacteria | 13344 |
| 20 | Ga0070674_100005761 | 3300005356 | Bacteria | 7189 |
| 21 | Ga0070673_100056398 | 3300005364 | Bacteria | 3100 |
| 22 | Ga0070688_100008590 | 3300005365 | Bacteria | 5555 |
| 23 | Ga0070688_100090839 | 3300005365 | Bacteria | 1995 |
| 24 | Ga0070688_100101294 | 3300005365 | Bacteria | 1899 |
| 25 | Ga0070659_100007423 | 3300005366 | Bacteria | 7963 |
| 26 | Ga0070667_100024338 | 3300005367 | Bacteria | 5029 |
| 27 | Ga0070667_100124451 | 3300005367 | Bacteria | 2246 |
| 28 | Ga0070709_10004047 | 3300005434 | Bacteria | 7909 |
| 29 | Ga0070709_10023880 | 3300005434 | Bacteria | 3595 |
| 30 | Ga0070714_100028556 | 3300005435 | Bacteria | 4630 |
| 31 | Ga0070714_100091746 | 3300005435 | Bacteria | 2662 |
| 32 | Ga0070714_100097321 | 3300005435 | Bacteria | 2587 |
| 33 | Ga0070713_100018647 | 3300005436 | Bacteria | 5275 |
| 34 | Ga0070713_100034533 | 3300005436 | Bacteria | 4064 |
| 35 | Ga0070713_100146154 | 3300005436 | Bacteria | 2099 |
| 36 | Ga0070713_100192177 | 3300005436 | Bacteria | 1840 |
| 37 | Ga0070710_10012502 | 3300005437 | Bacteria | 4217 |
| 38 | Ga0070711_100032154 | 3300005439 | Bacteria | 3487 |
| 39 | Ga0070711_100038994 | 3300005439 | Bacteria | 3197 |
| 40 | Ga0070711_100068347 | 3300005439 | Bacteria | 2496 |
| 41 | Ga0070711_100227183 | 3300005439 | Unclassified | 1454 |
| 42 | Ga0070700_100137114 | 3300005441 | Bacteria | 1658 |
| 43 | Ga0070678_100040542 | 3300005456 | Bacteria | 3295 |
| 44 | Ga0070662_100020173 | 3300005457 | Bacteria | 4536 |
| 45 | Ga0070681_10001010 | 3300005458 | Bacteria | 23785 |
| 46 | Ga0070681_10007499 | 3300005458 | Bacteria | 10662 |
| 47 | Ga0068867_100019168 | 3300005459 | Bacteria | 4873 |
| 48 | Ga0070685_10105051 | 3300005466 | Bacteria | 1730 |
| 49 | Ga0070698_100048964 | 3300005471 | Bacteria | 4316 |
| 50 | Ga0070679_100010240 | 3300005530 | Bacteria | 8891 |
| 51 | Ga0070679_100066634 | 3300005530 | Bacteria | 3589 |
| 52 | Ga0070679_100182565 | 3300005530 | Bacteria | 2070 |
| 53 | Ga0070679_100289343 | 3300005530 | Bacteria | 1590 |
| 54 | Ga0070697_100014105 | 3300005536 | Bacteria | 6276 |
| 55 | Ga0070697_100103146 | 3300005536 | Bacteria | 2371 |
| 56 | Ga0068853_100005846 | 3300005539 | Bacteria | 9691 |
| 57 | Ga0070672_100003393 | 3300005543 | Bacteria | 10322 |
| 58 | Ga0070695_100003310 | 3300005545 | Bacteria | 9419 |
| 59 | Ga0070704_100001522 | 3300005549 | Bacteria | 12496 |
| 60 | Ga0068855_100003400 | 3300005563 | Bacteria | 19482 |
| 61 | Ga0070664_100026016 | 3300005564 | Bacteria | 4852 |
| 62 | Ga0068857_100130343 | 3300005577 | Bacteria | 2268 |
| 63 | Ga0068857_100308193 | 3300005577 | Bacteria | 1460 |
| 64 | Ga0070702_100058593 | 3300005615 | Bacteria | 2232 |
| 65 | Ga0068859_100049426 | 3300005617 | Bacteria | 4223 |
| 66 | Ga0068859_100181268 | 3300005617 | Bacteria | 2189 |
| 67 | Ga0068859_100408670 | 3300005617 | Bacteria | 1453 |
| 68 | Ga0068864_100109424 | 3300005618 | Bacteria | 2460 |
| 69 | Ga0068864_100172550 | 3300005618 | Bacteria | 1973 |
| 70 | Ga0068864_100225319 | 3300005618 | Bacteria | 1731 |
| 71 | Ga0068863_100094543 | 3300005841 | Bacteria | 2837 |
| 72 | Ga0068858_100208551 | 3300005842 | Bacteria | 1849 |
| 73 | Ga0081455_10003898 | 3300005937 | Bacteria | 16987 |
| 74 | Ga0081455_10024342 | 3300005937 | Bacteria | 5608 |
| 75 | Ga0081538_10004768 | 3300005981 | Bacteria | 12398 |
| 76 | Ga0081538_10051010 | 3300005981 | Bacteria | 2490 |
| 77 | Ga0081540_1000105 | 3300005983 | Bacteria | 89863 |
| 78 | Ga0081540_1001881 | 3300005983 | Bacteria | 17573 |
| 79 | Ga0081540_1007650 | 3300005983 | Bacteria | 7667 |
| 80 | Ga0081539_10000891 | 3300005985 | Bacteria | 57129 |
| 81 | Ga0070717_10048077 | 3300006028 | Bacteria | 3498 |
| 82 | Ga0070717_10178156 | 3300006028 | Bacteria | 1852 |
| 83 | Ga0070717_10182202 | 3300006028 | Bacteria | 1831 |
| 84 | Ga0075368_10021774 | 3300006042 | Bacteria | 2436 |
| 85 | Ga0075363_100060200 | 3300006048 | Bacteria | 2044 |
| 86 | Ga0075363_100116589 | 3300006048 | Bacteria | 1488 |
| 87 | Ga0075364_10020580 | 3300006051 | Bacteria | 4151 |
| 88 | Ga0075364_10112960 | 3300006051 | Bacteria | 1814 |
| 89 | Ga0070715_10005445 | 3300006163 | Bacteria | 4243 |
| 90 | Ga0070716_100014992 | 3300006173 | Bacteria | 3976 |
| 91 | Ga0070712_100004767 | 3300006175 | Bacteria | 8382 |
| 92 | Ga0070712_100005000 | 3300006175 | Bacteria | 8206 |
| 93 | Ga0070712_100052359 | 3300006175 | Bacteria | 2846 |
| 94 | Ga0075362_10003097 | 3300006177 | Bacteria | 5733 |
| 95 | Ga0075362_10044379 | 3300006177 | Bacteria | 1971 |
| 96 | Ga0075367_10012078 | 3300006178 | Bacteria | 4591 |
| 97 | Ga0075367_10026837 | 3300006178 | Bacteria | 3270 |
| 98 | Ga0075367_10065950 | 3300006178 | Bacteria | 2169 |
| 99 | Ga0075367_10100456 | 3300006178 | Bacteria | 1768 |
| 100 | Ga0075369_10054202 | 3300006186 | Bacteria | 1741 |
| 101 | Ga0075366_10001179 | 3300006195 | Bacteria | 12962 |
| 102 | Ga0097621_100081999 | 3300006237 | Bacteria | 2685 |
| 103 | Ga0075370_10066134 | 3300006353 | Bacteria | 2062 |
| 104 | Ga0075428_100000690 | 3300006844 | Bacteria | 34808 |
| 105 | Ga0075428_100019356 | 3300006844 | Bacteria | 7533 |
| 106 | Ga0075428_100159494 | 3300006844 | Bacteria | 2449 |
| 107 | Ga0075430_100001644 | 3300006846 | Bacteria | 18255 |
| 108 | Ga0075430_100013482 | 3300006846 | Bacteria | 6968 |
| 109 | Ga0075430_100185337 | 3300006846 | Bacteria | 1731 |
| 110 | Ga0075431_100000098 | 3300006847 | Bacteria | 54303 |
| 111 | Ga0075431_100005461 | 3300006847 | Bacteria | 12556 |
| 112 | Ga0075431_100097396 | 3300006847 | Bacteria | 3038 |
| 113 | Ga0075431_100276217 | 3300006847 | Bacteria | 1702 |
| 114 | Ga0075431_100343066 | 3300006847 | Bacteria | 1503 |
| 115 | Ga0075434_100106958 | 3300006871 | Bacteria | 2807 |
| 116 | Ga0075429_100009106 | 3300006880 | Bacteria | 8621 |
| 117 | Ga0075436_100002664 | 3300006914 | Bacteria | 12272 |
| 118 | Ga0075436_100051103 | 3300006914 | Bacteria | 2853 |
| 119 | Ga0075436_100217860 | 3300006914 | Bacteria | 1354 |
| 120 | Ga0097620_100049426 | 3300006931 | Bacteria | 4223 |
| 121 | Ga0097620_100181273 | 3300006931 | Bacteria | 2189 |
| 122 | Ga0097620_100408691 | 3300006931 | Bacteria | 1453 |
| 123 | Ga0075435_100026824 | 3300007076 | Bacteria | 4499 |
| 124 | Ga0075435_100047016 | 3300007076 | Bacteria | 3464 |
| 125 | Ga0099794_10027936 | 3300007265 | Bacteria | 2620 |
| 126 | Ga0099794_10074803 | 3300007265 | Bacteria | 1664 |
| 127 | Ga0099795_10035914 | 3300007788 | Bacteria | 1736 |
| 128 | Ga0105240_10004682 | 3300009093 | Bacteria | 20685 |
| 129 | Ga0111539_10000703 | 3300009094 | Bacteria | 43347 |
| 130 | Ga0111539_10068500 | 3300009094 | Bacteria | 4190 |
| 131 | Ga0111539_10138857 | 3300009094 | Bacteria | 2846 |
| 132 | Ga0111539_10171707 | 3300009094 | Bacteria | 2533 |
| 133 | Ga0105245_10000898 | 3300009098 | Bacteria | 27086 |
| 134 | Ga0105245_10053403 | 3300009098 | Bacteria | 3627 |
| 135 | Ga0105245_10276091 | 3300009098 | Bacteria | 1641 |
| 136 | Ga0114129_10000057 | 3300009147 | Bacteria | 99258 |
| 137 | Ga0114129_10003135 | 3300009147 | Bacteria | 23199 |
| 138 | Ga0114129_10119075 | 3300009147 | Bacteria | 3637 |
| 139 | Ga0105243_10062299 | 3300009148 | Bacteria | 2986 |
| 140 | Ga0105243_10118081 | 3300009148 | Bacteria | 2231 |
| 141 | Ga0105248_10083721 | 3300009177 | Bacteria | 3588 |
| 142 | Ga0105238_10027483 | 3300009551 | Bacteria | 5799 |
| 143 | Ga0105249_10000366 | 3300009553 | Bacteria | 44857 |
| 144 | Ga0105249_10128236 | 3300009553 | Bacteria | 2418 |
| 145 | Ga0099796_10001780 | 3300010159 | Bacteria | 4500 |
| 146 | Ga0157373_10066627 | 3300013100 | Bacteria | 2547 |
| 147 | Ga0157373_10074325 | 3300013100 | Bacteria | 2398 |
| 148 | Ga0157370_10007752 | 3300013104 | Bacteria | 11636 |
| 149 | Ga0157374_10295070 | 3300013296 | Bacteria | 1603 |
| 150 | Ga0157378_10099275 | 3300013297 | Bacteria | 2656 |
| 151 | Ga0157372_10001212 | 3300013307 | Bacteria | 27905 |
| 152 | Ga0157375_10236355 | 3300013308 | Bacteria | 1987 |
| 153 | Ga0163163_10205249 | 3300014325 | Bacteria | 2019 |
| 154 | Ga0157380_10248157 | 3300014326 | Bacteria | 1609 |
| 155 | Ga0157376_10089692 | 3300014969 | Bacteria | 2659 |
| 156 | Ga0163161_10131273 | 3300017792 | Bacteria | 1890 |
| 157 | Ga0213874_10048999 | 3300021377 | Bacteria | 1290 |
| 158 | Ga0213876_10012097 | 3300021384 | Bacteria | 4597 |
| 159 | Ga0213876_10096307 | 3300021384 | Bacteria | 1568 |
| 160 | Ga0213875_10000031 | 3300021388 | Bacteria | 176367 |
| 161 | Ga0224572_1000034 | 3300024225 | Bacteria | 7758 |
| 162 | Ga0228598_1011336 | 3300024227 | Bacteria | 1773 |
| 163 | Ga0228598_1020122 | 3300024227 | Bacteria | 1314 |
| 164 | Ga0209758_1000308 | 3300025297 | Bacteria | 94851 |
| 165 | Ga0209758_1000312 | 3300025297 | Bacteria | 94114 |
| 166 | Ga0209758_1028725 | 3300025297 | Bacteria | 2344 |
| 167 | Ga0207682_10001973 | 3300025893 | Bacteria | 9298 |
| 168 | Ga0207682_10059186 | 3300025893 | Bacteria | 1600 |
| 169 | Ga0207692_10007136 | 3300025898 | Bacteria | 4566 |
| 170 | Ga0207688_10025459 | 3300025901 | Bacteria | 3249 |
| 171 | Ga0207680_10166839 | 3300025903 | Bacteria | 1480 |
| 172 | Ga0207685_10017067 | 3300025905 | Bacteria | 2338 |
| 173 | Ga0207699_10021051 | 3300025906 | Bacteria | 3507 |
| 174 | Ga0207699_10052503 | 3300025906 | Bacteria | 2413 |
| 175 | Ga0207645_10037589 | 3300025907 | Bacteria | 3106 |
| 176 | Ga0207643_10107794 | 3300025908 | Bacteria | 1638 |
| 177 | Ga0207705_10102483 | 3300025909 | Bacteria | 2107 |
| 178 | Ga0207707_10005935 | 3300025912 | Bacteria | 10688 |
| 179 | Ga0207707_10189204 | 3300025912 | Bacteria | 1796 |
| 180 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 181 | Ga0207693_10008563 | 3300025915 | Bacteria | 8374 |
| 182 | Ga0207693_10010902 | 3300025915 | Bacteria | 7371 |
| 183 | Ga0207693_10021913 | 3300025915 | Bacteria | 5080 |
| 184 | Ga0207693_10176339 | 3300025915 | Bacteria | 1682 |
| 185 | Ga0207663_10127641 | 3300025916 | Bacteria | 1752 |
| 186 | Ga0207660_10104513 | 3300025917 | Bacteria | 2121 |
| 187 | Ga0207660_10120633 | 3300025917 | Bacteria | 1985 |
| 188 | Ga0207662_10005064 | 3300025918 | Bacteria | 6983 |
| 189 | Ga0207662_10038601 | 3300025918 | Bacteria | 2798 |
| 190 | Ga0207649_10074669 | 3300025920 | Bacteria | 2176 |
| 191 | Ga0207652_10005989 | 3300025921 | Bacteria | 9836 |
| 192 | Ga0207652_10050604 | 3300025921 | Bacteria | 3560 |
| 193 | Ga0207652_10165212 | 3300025921 | Bacteria | 1985 |
| 194 | Ga0207681_10019099 | 3300025923 | Bacteria | 4328 |
| 195 | Ga0207650_10013257 | 3300025925 | Bacteria | 5703 |
| 196 | Ga0207659_10017877 | 3300025926 | Bacteria | 4639 |
| 197 | Ga0207687_10070089 | 3300025927 | Bacteria | 2502 |
| 198 | Ga0207687_10309102 | 3300025927 | Bacteria | 1276 |
| 199 | Ga0207700_10034853 | 3300025928 | Bacteria | 3618 |
| 200 | Ga0207700_10145823 | 3300025928 | Bacteria | 1951 |
| 201 | Ga0207700_10148972 | 3300025928 | Bacteria | 1932 |
| 202 | Ga0207700_10161802 | 3300025928 | Bacteria | 1859 |
| 203 | Ga0207664_10006820 | 3300025929 | Bacteria | 7891 |
| 204 | Ga0207664_10028136 | 3300025929 | Bacteria | 4269 |
| 205 | Ga0207664_10032181 | 3300025929 | Bacteria | 4018 |
| 206 | Ga0207664_10061831 | 3300025929 | Bacteria | 2989 |
| 207 | Ga0207664_10092307 | 3300025929 | Bacteria | 2485 |
| 208 | Ga0207644_10229240 | 3300025931 | Bacteria | 1475 |
| 209 | Ga0207690_10044356 | 3300025932 | Bacteria | 2931 |
| 210 | Ga0207706_10047931 | 3300025933 | Bacteria | 3779 |
| 211 | Ga0207670_10013413 | 3300025936 | Bacteria | 4831 |
| 212 | Ga0207670_10017840 | 3300025936 | Bacteria | 4299 |
| 213 | Ga0207670_10019375 | 3300025936 | Bacteria | 4156 |
| 214 | Ga0207670_10054094 | 3300025936 | Bacteria | 2707 |
| 215 | Ga0207669_10008682 | 3300025937 | Bacteria | 4786 |
| 216 | Ga0207665_10001716 | 3300025939 | Bacteria | 14730 |
| 217 | Ga0207665_10149648 | 3300025939 | Bacteria | 1671 |
| 218 | Ga0207691_10002047 | 3300025940 | Bacteria | 19715 |
| 219 | Ga0207691_10095637 | 3300025940 | Bacteria | 2657 |
| 220 | Ga0207691_10138170 | 3300025940 | Bacteria | 2148 |
| 221 | Ga0207711_10064329 | 3300025941 | Bacteria | 3168 |
| 222 | Ga0207661_10015374 | 3300025944 | Bacteria | 5631 |
| 223 | Ga0207679_10030219 | 3300025945 | Bacteria | 3781 |
| 224 | Ga0207651_10002803 | 3300025960 | Bacteria | 8381 |
| 225 | Ga0207651_10026194 | 3300025960 | Bacteria | 3638 |
| 226 | Ga0207651_10168876 | 3300025960 | Bacteria | 1723 |
| 227 | Ga0207712_10002501 | 3300025961 | Bacteria | 11828 |
| 228 | Ga0207712_10093383 | 3300025961 | Bacteria | 2220 |
| 229 | Ga0207668_10227145 | 3300025972 | Bacteria | 1503 |
| 230 | Ga0207658_10153659 | 3300025986 | Bacteria | 1878 |
| 231 | Ga0207677_10025711 | 3300026023 | Bacteria | 3677 |
| 232 | Ga0207703_10168976 | 3300026035 | Bacteria | 1922 |
| 233 | Ga0207703_10245897 | 3300026035 | Bacteria | 1610 |
| 234 | Ga0207639_10005685 | 3300026041 | Bacteria | 8438 |
| 235 | Ga0207639_10242315 | 3300026041 | Bacteria | 1568 |
| 236 | Ga0207641_10049115 | 3300026088 | Bacteria | 3564 |
| 237 | Ga0207648_10016126 | 3300026089 | Bacteria | 6841 |
| 238 | Ga0207676_10022380 | 3300026095 | Bacteria | 4647 |
| 239 | Ga0207676_10035276 | 3300026095 | Bacteria | 3795 |
| 240 | Ga0207674_10035866 | 3300026116 | Bacteria | 5173 |
| 241 | Ga0207674_10173314 | 3300026116 | Bacteria | 2110 |
| 242 | Ga0207675_100241923 | 3300026118 | Bacteria | 1744 |
| 243 | Ga0207675_100269956 | 3300026118 | Bacteria | 1651 |
| 244 | Ga0207683_10001331 | 3300026121 | Bacteria | 22269 |
| 245 | Ga0207683_10042766 | 3300026121 | Bacteria | 3957 |
| 246 | Ga0207683_10298291 | 3300026121 | Bacteria | 1474 |
| 247 | Ga0207698_10007221 | 3300026142 | Bacteria | 6959 |
| 248 | Ga0209179_1005067 | 3300027512 | Bacteria | 2035 |
| 249 | Ga0207428_10008746 | 3300027907 | Bacteria | 9132 |
| 250 | Ga0207428_10066812 | 3300027907 | Bacteria | 2832 |
| 251 | Ga0268264_10054902 | 3300028381 | Bacteria | 3328 |
| 252 | Ga0265337_1007585 | 3300028556 | Bacteria | 4045 |
| 253 | Ga0265338_10013547 | 3300028800 | Bacteria | 9192 |
| 254 | Ga0265330_10012094 | 3300031235 | Bacteria | 4036 |
| 255 | Ga0265330_10015445 | 3300031235 | Bacteria | 3532 |
| 256 | Ga0265332_10001857 | 3300031238 | Bacteria | 11220 |
| 257 | Ga0265325_10003766 | 3300031241 | Bacteria | 9786 |
| 258 | Ga0265325_10011638 | 3300031241 | Bacteria | 5053 |
| 259 | Ga0265325_10012217 | 3300031241 | Bacteria | 4913 |
| 260 | Ga0265325_10078671 | 3300031241 | Bacteria | 1642 |
| 261 | Ga0265329_10004050 | 3300031242 | Bacteria | 6227 |
| 262 | Ga0265329_10023902 | 3300031242 | Bacteria | 2031 |
| 263 | Ga0265340_10006014 | 3300031247 | Bacteria | 6702 |
| 264 | Ga0265340_10008344 | 3300031247 | Bacteria | 5596 |
| 265 | Ga0265340_10010587 | 3300031247 | Bacteria | 4930 |
| 266 | Ga0265339_10000054 | 3300031249 | Bacteria | 100374 |
| 267 | Ga0265339_10002624 | 3300031249 | Bacteria | 12823 |
| 268 | Ga0265339_10005140 | 3300031249 | Bacteria | 8777 |
| 269 | Ga0265339_10016311 | 3300031249 | Bacteria | 4431 |
| 270 | Ga0265331_10007501 | 3300031250 | Bacteria | 6306 |
| 271 | Ga0265331_10016215 | 3300031250 | Bacteria | 3915 |
| 272 | Ga0265316_10111529 | 3300031344 | Bacteria | 2071 |
| 273 | Ga0265316_10221080 | 3300031344 | Bacteria | 1397 |
| 274 | Ga0265313_10001832 | 3300031595 | Bacteria | 19396 |
| 275 | Ga0265313_10001996 | 3300031595 | Bacteria | 18368 |
| 276 | Ga0265313_10005086 | 3300031595 | Bacteria | 9795 |
| 277 | Ga0265314_10008808 | 3300031711 | Bacteria | 8621 |
| 278 | Ga0265342_10000092 | 3300031712 | Bacteria | 99040 |
| 279 | Ga0265342_10004949 | 3300031712 | Bacteria | 10288 |
| 280 | Ga0265342_10006461 | 3300031712 | Bacteria | 8727 |
| 281 | Ga0316576_10248913 | 3300031727 | Bacteria | 1334 |
| 282 | Ga0307416_100259201 | 3300032002 | Bacteria | 1698 |
| 283 | Ga0373934_0004863 | 3300035086 | Bacteria | 4970 |
| 284 | Ga0373934_0027427 | 3300035086 | Bacteria | 2213 |
| 285 | Ga0373923_0034646 | 3300035111 | Bacteria | 2050 |
| 286 | Ga0373936_0027130 | 3300035113 | Bacteria | 2246 |
| 287 | Ga0373939_0019841 | 3300035114 | Bacteria | 1818 |
| 288 | Ga0373941_0053487 | 3300035115 | Bacteria | 1291 |
| 289 | Ga0373945_0025365 | 3300035116 | Bacteria | 2059 |
| 290 | Ga0373953_0002026 | 3300035117 | Bacteria | 6028 |
| 291 | Ga0373953_0015305 | 3300035117 | Bacteria | 2776 |
| 292 | Ga0373953_0022405 | 3300035117 | Bacteria | 2382 |
| 293 | Ga0373954_0001810 | 3300035118 | Bacteria | 8810 |
| 294 | Ga0373954_0003140 | 3300035118 | Bacteria | 6983 |
| 295 | Ga0373956_0012138 | 3300035119 | Bacteria | 3564 |
| 296 | Ga0373957_0008145 | 3300035120 | Bacteria | 3384 |
| 297 | Ga0373957_0053391 | 3300035120 | Bacteria | 1550 |
| 298 | Ga0373943_0000261 | 3300035170 | Bacteria | 21642 |
| 299 | Ga0373943_0054003 | 3300035170 | Bacteria | 1986 |
| 300 | Ga0373943_0054365 | 3300035170 | Bacteria | 1980 |
| 301 | Ga0373946_0009016 | 3300035171 | Bacteria | 3670 |
| 302 | Ga0373946_0024627 | 3300035171 | Bacteria | 2360 |
| 303 | Ga0373946_0095198 | 3300035171 | Bacteria | 1326 |
| 304 | Ga0373955_0000294 | 3300035172 | Bacteria | 20614 |
| 305 | Ga0373955_0000357 | 3300035172 | Bacteria | 19267 |
| 306 | Ga0373955_0025780 | 3300035172 | Bacteria | 3022 |
| 307 | Ga0373955_0081238 | 3300035172 | Bacteria | 1832 |
| 308 | Ga0316574_0003414 | 3300035398 | Bacteria | 8185 |
| 309 | Ga0373924_0002287 | 3300035410 | Bacteria | 6434 |
| 310 | Ga0373924_0003415 | 3300035410 | Bacteria | 5462 |
| 311 | Ga0373924_0053719 | 3300035410 | Bacteria | 1674 |
| 312 | Ga0373924_0134536 | 3300035410 | Bacteria | 1076 |
| 313 | Ga0373931_0008332 | 3300035691 | Bacteria | 4910 |
| 314 | Ga0373935_0000298 | 3300035692 | Bacteria | 24560 |
| 315 | Ga0373935_0057105 | 3300035692 | Bacteria | 2490 |
| 316 | Ga0373935_0066253 | 3300035692 | Bacteria | 2319 |
| 317 | Ga0373935_0074012 | 3300035692 | Bacteria | 2201 |
| 318 | Ga0373935_0168033 | 3300035692 | Bacteria | 1499 |
| 319 | Ga0373927_0003788 | 3300035695 | Bacteria | 10729 |
| 320 | Ga0373927_0004430 | 3300035695 | Bacteria | 9837 |
| 321 | Ga0373927_0005686 | 3300035695 | Bacteria | 8559 |
| 322 | Ga0373927_0020166 | 3300035695 | Bacteria | 4371 |
| 323 | Ga0373927_0059904 | 3300035695 | Bacteria | 2462 |
| 324 | Ga0373927_0171522 | 3300035695 | Bacteria | 1422 |
| 325 | Ga0373933_0000325 | 3300035724 | Bacteria | 30685 |
| 326 | Ga0373933_0004421 | 3300035724 | Bacteria | 7714 |
| 327 | Ga0373933_0028802 | 3300035724 | Bacteria | 3206 |
| 328 | Ga0373947_0000391 | 3300035725 | Bacteria | 24724 |
| 329 | Ga0373947_0025548 | 3300035725 | Bacteria | 3446 |
| 330 | Ga0373947_0033218 | 3300035725 | Bacteria | 3044 |
| 331 | Ga0373947_0038909 | 3300035725 | Bacteria | 2828 |
| 332 | Ga0373947_0050684 | 3300035725 | Bacteria | 2496 |
| 333 | Ga0373947_0061242 | 3300035725 | Bacteria | 2287 |
| 334 | Ga0373937_0000081 | 3300036401 | Bacteria | 88009 |
| 335 | Ga0373937_0001589 | 3300036401 | Bacteria | 19103 |
| 336 | Ga0373937_0002429 | 3300036401 | Bacteria | 15499 |
| 337 | Ga0373937_0004812 | 3300036401 | Bacteria | 11473 |
| 338 | Ga0373937_0237558 | 3300036401 | Bacteria | 1716 |
| 339 | Ga0316582_0213509 | 3300036647 | Bacteria | 1319 |
| 340 | Ga0316584_0099682 | 3300036712 | Bacteria | 2175 |
| 341 | Ga0373925_0000425 | 3300037068 | Bacteria | 42725 |
| 342 | Ga0373925_0028146 | 3300037068 | Bacteria | 4117 |
| 343 | Ga0373925_0040551 | 3300037068 | Bacteria | 3447 |
| 344 | Ga0373925_0071882 | 3300037068 | Bacteria | 2617 |
| 345 | Ga0373925_0139038 | 3300037068 | Bacteria | 1900 |
| 346 | Ga0373925_0148109 | 3300037068 | Bacteria | 1841 |
| 347 | Ga0395900_0226783 | 3300037418 | Bacteria | 1881 |
| 348 | Ga0395898_0014622 | 3300037466 | Bacteria | 8061 |
| 349 | Ga0395898_0063937 | 3300037466 | Bacteria | 3570 |
| 350 | Ga0436364_0033507 | 3300037853 | Bacteria | 2498 |
| 351 | Ga0436364_0793438 | 3300037853 | Bacteria | 64960 |
| 352 | Ga0436365_0085454 | 3300039437 | Bacteria | 2136 |
| 353 | Ga0436365_0311840 | 3300039437 | Bacteria | 2476 |
| 354 | Ga0436365_0505017 | 3300039437 | Bacteria | 4658 |
| 355 | Ga0436365_0657686 | 3300039437 | Bacteria | 27042 |
| 356 | Ga0436365_0878170 | 3300039437 | Bacteria | 3969 |
| 357 | Ga0436365_0903140 | 3300039437 | Bacteria | 3075 |
| 358 | Ga0436365_1369522 | 3300039437 | Bacteria | 1209 |
| 359 | Ga0436365_1489713 | 3300039437 | Bacteria | 3522 |
| 360 | Ga0436360_1257472 | 3300039438 | Bacteria | 1409 |
| 361 | Ga0436361_0112327 | 3300039447 | Bacteria | 4381 |
| 362 | Ga0436363_0225098 | 3300039450 | Bacteria | 4259 |
| 363 | Ga0436363_0640332 | 3300039450 | Bacteria | 3068 |
| 364 | Ga0439453_0003561 | 3300041408 | Bacteria | 2248 |
| 365 | Ga0439465_0033510 | 3300041413 | Bacteria | 1643 |
| 366 | Ga0450923_006355 | 3300042125 | Bacteria | 1954 |
| 367 | Ga0439435_0001109 | 3300042436 | Bacteria | 4794 |
| 368 | Ga0466966_0045849 | 3300044684 | Bacteria | 2794 |
| 369 | Ga0466963_0132010 | 3300044694 | Bacteria | 1726 |
| 370 | Ga0495592_0002862 | 3300046454 | Bacteria | 12266 |
| 371 | Ga0495592_0010291 | 3300046454 | Bacteria | 7052 |
| 372 | Ga0495592_0027438 | 3300046454 | Bacteria | 4317 |
| 373 | Ga0495603_0016472 | 3300046455 | Bacteria | 4472 |
| 374 | Ga0495603_0073678 | 3300046455 | Bacteria | 2006 |
| 375 | Ga0495603_0085819 | 3300046455 | Bacteria | 1843 |
| 376 | Ga0495590_0055695 | 3300046457 | Bacteria | 1382 |
| 377 | Ga0495629_0005277 | 3300046459 | Bacteria | 9659 |
| 378 | Ga0495629_0011442 | 3300046459 | Bacteria | 6446 |
| 379 | Ga0495629_0180675 | 3300046459 | Bacteria | 1462 |
| 380 | Ga0495638_0023817 | 3300046460 | Bacteria | 3999 |
| 381 | Ga0495651_0000541 | 3300046462 | Bacteria | 29187 |
| 382 | Ga0495651_0002748 | 3300046462 | Bacteria | 13649 |
| 383 | Ga0495651_0007674 | 3300046462 | Bacteria | 8247 |
| 384 | Ga0495651_0194257 | 3300046462 | Bacteria | 1426 |
| 385 | Ga0495653_0000054 | 3300046463 | Bacteria | 102885 |
| 386 | Ga0495653_0004652 | 3300046463 | Bacteria | 11104 |
| 387 | Ga0495653_0012932 | 3300046463 | Bacteria | 6810 |
| 388 | Ga0495653_0137502 | 3300046463 | Bacteria | 1722 |
| 389 | Ga0495580_0037671 | 3300046472 | Bacteria | 3468 |
| 390 | Ga0495605_0123784 | 3300046474 | Bacteria | 1171 |
| 391 | Ga0495662_0013700 | 3300046476 | Bacteria | 3949 |
| 392 | Ga0495662_0037470 | 3300046476 | Bacteria | 2342 |
| 393 | Ga0495664_0000020 | 3300046477 | Bacteria | 150749 |
| 394 | Ga0495664_0000385 | 3300046477 | Bacteria | 21527 |
| 395 | Ga0495608_0000024 | 3300046511 | Bacteria | 159429 |
| 396 | Ga0495608_0005565 | 3300046511 | Bacteria | 8999 |
| 397 | Ga0495608_0006299 | 3300046511 | Bacteria | 8417 |
| 398 | Ga0495608_0045485 | 3300046511 | Bacteria | 2925 |
| 399 | Ga0495618_0000020 | 3300046514 | Bacteria | 130661 |
| 400 | Ga0495618_0001885 | 3300046514 | Bacteria | 13809 |
| 401 | Ga0495618_0021032 | 3300046514 | Bacteria | 4020 |
| 402 | Ga0495618_0059854 | 3300046514 | Bacteria | 2414 |
| 403 | Ga0495618_0139032 | 3300046514 | Bacteria | 1553 |
| 404 | Ga0495628_0000015 | 3300046516 | Bacteria | 198912 |
| 405 | Ga0495628_0014732 | 3300046516 | Bacteria | 6545 |
| 406 | Ga0495628_0050220 | 3300046516 | Bacteria | 3299 |
| 407 | Ga0495628_0167126 | 3300046516 | Bacteria | 1669 |
| 408 | Ga0495630_0001403 | 3300046517 | Bacteria | 16663 |
| 409 | Ga0495630_0031144 | 3300046517 | Bacteria | 3970 |
| 410 | Ga0495630_0042715 | 3300046517 | Bacteria | 3385 |
| 411 | Ga0495666_0087671 | 3300046526 | Bacteria | 1470 |
| 412 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 413 | Ga0495652_0020776 | 3300046529 | Bacteria | 5834 |
| 414 | Ga0495652_0027961 | 3300046529 | Bacteria | 4966 |
| 415 | Ga0495665_0027276 | 3300046531 | Bacteria | 3066 |
| 416 | Ga0495665_0065481 | 3300046531 | Bacteria | 1918 |
| 417 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 418 | Ga0495640_0003282 | 3300046533 | Bacteria | 13013 |
| 419 | Ga0495640_0022826 | 3300046533 | Bacteria | 4568 |
| 420 | Ga0495640_0112404 | 3300046533 | Bacteria | 1778 |
| 421 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 422 | Ga0495587_0000568 | 3300046536 | Bacteria | 25456 |
| 423 | Ga0495621_0043207 | 3300046539 | Bacteria | 1589 |
| 424 | Ga0495645_0000013 | 3300046543 | Bacteria | 186399 |
| 425 | Ga0495645_0024674 | 3300046543 | Bacteria | 4363 |
| 426 | Ga0495645_0027819 | 3300046543 | Bacteria | 4108 |
| 427 | Ga0495667_0000030 | 3300046559 | Bacteria | 147898 |
| 428 | Ga0495667_0002169 | 3300046559 | Bacteria | 13096 |
| 429 | Ga0495667_0002715 | 3300046559 | Bacteria | 11835 |
| 430 | Ga0495634_0000117 | 3300046642 | Bacteria | 67216 |
| 431 | Ga0495634_0007759 | 3300046642 | Bacteria | 8028 |
| 432 | Ga0495634_0021991 | 3300046642 | Bacteria | 4497 |
| 433 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 434 | Ga0495635_0000800 | 3300046663 | Bacteria | 20534 |
| 435 | Ga0495635_0007564 | 3300046663 | Bacteria | 7579 |
| 436 | Ga0495635_0024285 | 3300046663 | Bacteria | 4225 |
| 437 | Ga0495635_0048578 | 3300046663 | Bacteria | 2925 |
| 438 | Ga0495588_0079273 | 3300046674 | Bacteria | 1714 |
| 439 | Ga0495657_0000028 | 3300046675 | Bacteria | 131008 |
| 440 | Ga0495657_0015592 | 3300046675 | Bacteria | 5554 |
| 441 | Ga0495599_0000050 | 3300046678 | Bacteria | 82601 |
| 442 | Ga0495599_0008026 | 3300046678 | Bacteria | 6408 |
| 443 | Ga0495599_0008520 | 3300046678 | Bacteria | 6239 |
| 444 | Ga0495623_0000013 | 3300046679 | Bacteria | 119870 |
| 445 | Ga0495623_0001240 | 3300046679 | Bacteria | 17330 |
| 446 | Ga0495623_0006690 | 3300046679 | Bacteria | 7499 |
| 447 | Ga0495623_0018525 | 3300046679 | Bacteria | 4497 |
| 448 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 449 | Ga0495646_0004537 | 3300046680 | Bacteria | 8742 |
| 450 | Ga0495646_0055013 | 3300046680 | Bacteria | 2392 |
| 451 | Ga0495658_0217094 | 3300046683 | Bacteria | 1196 |
| 452 | Ga0495613_0011001 | 3300046689 | Bacteria | 6721 |
| 453 | Ga0495613_0013543 | 3300046689 | Bacteria | 6054 |
| 454 | Ga0495613_0041659 | 3300046689 | Bacteria | 3400 |
| 455 | Ga0495613_0048411 | 3300046689 | Bacteria | 3139 |
| 456 | Ga0495613_0097432 | 3300046689 | Bacteria | 2126 |
| 457 | Ga0495613_0108269 | 3300046689 | Bacteria | 2004 |
| 458 | Ga0495624_0003637 | 3300046690 | Bacteria | 11404 |
| 459 | Ga0495624_0029449 | 3300046690 | Bacteria | 3582 |
| 460 | Ga0495624_0109282 | 3300046690 | Bacteria | 1701 |
| 461 | Ga0495600_0000002 | 3300046809 | Bacteria | 186597 |
| 462 | Ga0495600_0001425 | 3300046809 | Bacteria | 13226 |
| 463 | Ga0495600_0003096 | 3300046809 | Bacteria | 9724 |
| 464 | Ga0495581_0218873 | 3300047315 | Bacteria | 1113 |
| 465 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 466 | Ga0495604_0000168 | 3300047317 | Bacteria | 57429 |
| 467 | Ga0495604_0016356 | 3300047317 | Bacteria | 5929 |
| 468 | Ga0495604_0147070 | 3300047317 | Bacteria | 1678 |
| 469 | Ga0495674_0000018 | 3300047319 | Bacteria | 204024 |
| 470 | Ga0495674_0001787 | 3300047319 | Bacteria | 21202 |
| 471 | Ga0495674_0004591 | 3300047319 | Bacteria | 13281 |
| 472 | Ga0495674_0260471 | 3300047319 | Bacteria | 1425 |
| 473 | Ga0495672_0124407 | 3300047320 | Bacteria | 1366 |
| 474 | Ga0495676_0059014 | 3300047321 | Bacteria | 3016 |
| 475 | Ga0495676_0159333 | 3300047321 | Bacteria | 1598 |
| 476 | Ga0495680_0000159 | 3300047322 | Bacteria | 68873 |
| 477 | Ga0495680_0000415 | 3300047322 | Bacteria | 47694 |
| 478 | Ga0495680_0011266 | 3300047322 | Bacteria | 7927 |
| 479 | Ga0495680_0179150 | 3300047322 | Bacteria | 1531 |
| 480 | Ga0495675_0000238 | 3300047444 | Bacteria | 39857 |
| 481 | Ga0495675_0006869 | 3300047444 | Bacteria | 6987 |
| 482 | Ga0495675_0242738 | 3300047444 | Bacteria | 1084 |
| 483 | Ga0495685_021510 | 3300047447 | Bacteria | 2219 |
| 484 | Ga0495684_0000010 | 3300047471 | Bacteria | 198915 |
| 485 | Ga0495684_0004699 | 3300047471 | Bacteria | 10659 |
| 486 | Ga0495684_0048571 | 3300047471 | Bacteria | 3244 |
| 487 | Ga0495684_0075131 | 3300047471 | Bacteria | 2567 |
| 488 | Ga0495684_0076363 | 3300047471 | Bacteria | 2544 |
| 489 | Ga0495684_0116072 | 3300047471 | Bacteria | 2018 |
| 490 | Ga0495593_0002081 | 3300047673 | Bacteria | 11959 |
| 491 | Ga0495593_0038636 | 3300047673 | Bacteria | 2577 |
| 492 | Ga0495593_0057331 | 3300047673 | Bacteria | 2046 |
| 493 | Ga0495602_0000016 | 3300048088 | Bacteria | 190311 |
| 494 | Ga0495602_0001302 | 3300048088 | Bacteria | 24603 |
| 495 | Ga0495615_0003085 | 3300048090 | Bacteria | 2756 |
| 496 | Ga0496100_0011897 | 3300048903 | Bacteria | 4969 |
| 497 | Ga0496100_0063474 | 3300048903 | Bacteria | 2441 |
| 498 | Ga0496101_0002084 | 3300048904 | Bacteria | 12181 |
| 499 | Ga0496101_0100185 | 3300048904 | Bacteria | 2167 |
| 500 | Ga0496102_0029733 | 3300048905 | Bacteria | 4889 |
| 501 | Ga0496103_0013488 | 3300048906 | Bacteria | 4849 |
| 502 | Ga0496104_0006456 | 3300048907 | Bacteria | 10309 |
| 503 | Ga0496104_0036217 | 3300048907 | Bacteria | 4612 |
| 504 | Ga0496104_0301833 | 3300048907 | Bacteria | 1513 |
| 505 | Ga0496105_0032246 | 3300048908 | Bacteria | 4298 |
| 506 | Ga0496105_0099697 | 3300048908 | Bacteria | 2399 |
| 507 | Ga0496106_0035173 | 3300048909 | Bacteria | 3745 |
| 508 | Ga0496106_0085211 | 3300048909 | Bacteria | 2433 |
| 509 | Ga0496106_0193608 | 3300048909 | Bacteria | 1617 |
| 510 | Ga0496107_0012023 | 3300048910 | Bacteria | 6036 |
| 511 | Ga0496107_0085708 | 3300048910 | Bacteria | 2299 |
| 512 | Ga0496108_0008123 | 3300048911 | Bacteria | 8512 |
| 513 | Ga0496108_0014550 | 3300048911 | Bacteria | 6423 |
| 514 | Ga0496108_0105696 | 3300048911 | Bacteria | 2404 |
| 515 | Ga0496108_0176356 | 3300048911 | Bacteria | 1850 |
| 516 | Ga0496108_0222345 | 3300048911 | Bacteria | 1641 |
| 517 | Ga0496109_0008742 | 3300048912 | Bacteria | 8623 |
| 518 | Ga0496110_0006704 | 3300048913 | Bacteria | 9155 |
| 519 | Ga0496110_0053328 | 3300048913 | Bacteria | 3555 |
| 520 | Ga0496110_0059599 | 3300048913 | Bacteria | 3365 |
| 521 | Ga0496110_0105767 | 3300048913 | Bacteria | 2525 |
| 522 | Ga0496111_0018672 | 3300048914 | Bacteria | 4806 |
| 523 | Ga0496111_0041816 | 3300048914 | Bacteria | 3290 |
| 524 | Ga0496112_0017515 | 3300048915 | Bacteria | 6732 |
| 525 | Ga0496112_0106012 | 3300048915 | Bacteria | 2780 |
| 526 | Ga0496113_0061077 | 3300048916 | Bacteria | 2843 |
| 527 | Ga0496113_0127457 | 3300048916 | Bacteria | 1994 |
| 528 | Ga0496114_0089694 | 3300048917 | Bacteria | 2609 |
| 529 | Ga0496114_0137178 | 3300048917 | Bacteria | 2116 |
| 530 | Ga0496114_0144390 | 3300048917 | Bacteria | 2062 |
| 531 | Ga0496114_0204612 | 3300048917 | Bacteria | 1730 |
| 532 | Ga0496115_0023653 | 3300048918 | Bacteria | 4768 |
| 533 | Ga0496115_0031238 | 3300048918 | Bacteria | 4195 |
| 534 | Ga0496115_0161066 | 3300048918 | Bacteria | 1854 |
| 535 | Ga0496115_0182037 | 3300048918 | Bacteria | 1737 |
| 536 | Ga0496116_0002755 | 3300048919 | Bacteria | 18052 |
| 537 | Ga0496117_0048428 | 3300048920 | Bacteria | 3036 |
| 538 | Ga0496119_0006427 | 3300048922 | Bacteria | 10897 |
| 539 | Ga0496122_0013338 | 3300048925 | Bacteria | 8050 |
| 540 | Ga0496123_0020995 | 3300048926 | Bacteria | 5089 |
| 541 | Ga0496126_0026035 | 3300048929 | Bacteria | 5616 |
| 542 | Ga0496126_0052219 | 3300048929 | Bacteria | 3716 |
| 543 | Ga0501031_0019583 | 3300049568 | Bacteria | 4408 |
| 544 | Ga0501032_0088695 | 3300049569 | Bacteria | 2053 |
| 545 | Ga0501033_0040664 | 3300049570 | Bacteria | 3471 |
| 546 | Ga0501033_0059678 | 3300049570 | Bacteria | 2816 |
| 547 | Ga0501033_0060430 | 3300049570 | Bacteria | 2796 |
| 548 | Ga0501033_0083339 | 3300049570 | Bacteria | 2344 |
| 549 | Ga0501033_0096076 | 3300049570 | Bacteria | 2165 |
| 550 | Ga0501034_0028861 | 3300049571 | Bacteria | 5643 |
| 551 | Ga0501034_0078354 | 3300049571 | Bacteria | 3309 |
| 552 | Ga0501034_0084059 | 3300049571 | Bacteria | 3185 |
| 553 | Ga0501034_0134166 | 3300049571 | Bacteria | 2457 |
| 554 | Ga0501034_0275389 | 3300049571 | Bacteria | 1623 |
| 555 | Ga0501034_0318911 | 3300049571 | Bacteria | 1487 |
| 556 | Ga0501036_0049226 | 3300049572 | Bacteria | 3568 |
| 557 | Ga0501036_0120535 | 3300049572 | Bacteria | 2215 |
| 558 | Ga0501036_0122485 | 3300049572 | Bacteria | 2196 |
| 559 | Ga0501037_0067159 | 3300049573 | Bacteria | 2611 |
| 560 | Ga0501037_0120523 | 3300049573 | Bacteria | 1886 |
| 561 | Ga0501038_0002943 | 3300049574 | Bacteria | 15884 |
| 562 | Ga0501038_0014878 | 3300049574 | Bacteria | 7084 |
| 563 | Ga0501038_0017952 | 3300049574 | Bacteria | 6391 |
| 564 | Ga0501039_0030956 | 3300049575 | Bacteria | 4126 |
| 565 | Ga0501039_0189868 | 3300049575 | Bacteria | 1616 |
| 566 | Ga0501039_0203043 | 3300049575 | Bacteria | 1558 |
| 567 | Ga0501042_0055181 | 3300049578 | Bacteria | 2835 |
| 568 | Ga0501043_0119338 | 3300049579 | Bacteria | 2068 |
| 569 | Ga0501043_0150154 | 3300049579 | Bacteria | 1823 |
| 570 | Ga0501043_0197854 | 3300049579 | Bacteria | 1561 |
| 571 | Ga0501047_0010604 | 3300049581 | Bacteria | 8714 |
| 572 | Ga0501047_0034600 | 3300049581 | Bacteria | 4878 |
| 573 | Ga0501047_0046121 | 3300049581 | Bacteria | 4213 |
| 574 | Ga0501047_0243819 | 3300049581 | Bacteria | 1647 |
| 575 | Ga0501048_0001047 | 3300049582 | Bacteria | 20704 |
| 576 | Ga0501067_0036049 | 3300049583 | Bacteria | 2747 |
| 577 | Ga0501067_0051045 | 3300049583 | Bacteria | 2293 |
| 578 | Ga0501067_0113005 | 3300049583 | Bacteria | 1510 |
| 579 | Ga0501070_0047057 | 3300049586 | Bacteria | 3587 |
| 580 | Ga0501070_0066001 | 3300049586 | Bacteria | 2996 |
| 581 | Ga0501071_0077009 | 3300049587 | Bacteria | 2436 |
| 582 | Ga0501071_0100043 | 3300049587 | Bacteria | 2137 |
| 583 | Ga0501072_0002322 | 3300049588 | Bacteria | 14269 |
| 584 | Ga0501072_0005296 | 3300049588 | Bacteria | 9820 |
| 585 | Ga0501072_0108720 | 3300049588 | Bacteria | 2206 |
| 586 | Ga0501073_0121462 | 3300049589 | Bacteria | 1810 |
| 587 | Ga0501073_0134401 | 3300049589 | Bacteria | 1714 |
| 588 | Ga0501073_0149721 | 3300049589 | Bacteria | 1617 |
| 589 | Ga0501074_0013077 | 3300049590 | Bacteria | 6033 |
| 590 | Ga0501074_0239948 | 3300049590 | Bacteria | 1289 |
| 591 | Ga0501075_0113910 | 3300049591 | Bacteria | 2056 |
| 592 | Ga0501075_0123896 | 3300049591 | Bacteria | 1967 |
| 593 | Ga0501076_0026991 | 3300049592 | Bacteria | 4453 |
| 594 | Ga0501076_0045805 | 3300049592 | Bacteria | 3454 |
| 595 | Ga0501076_0047928 | 3300049592 | Bacteria | 3378 |
| 596 | Ga0501077_0003493 | 3300049593 | Bacteria | 9437 |
| 597 | Ga0501079_0014464 | 3300049741 | Bacteria | 6017 |
| 598 | Ga0501080_0018950 | 3300049742 | Bacteria | 6375 |
| 599 | Ga0501080_0084856 | 3300049742 | Bacteria | 2942 |
| 600 | Ga0501080_0121301 | 3300049742 | Bacteria | 2422 |
| 601 | Ga0501080_0248477 | 3300049742 | Bacteria | 1622 |
| 602 | Ga0501081_0002149 | 3300049743 | Bacteria | 12350 |
| 603 | Ga0501083_0016513 | 3300049744 | Bacteria | 5165 |
| 604 | Ga0501083_0054594 | 3300049744 | Bacteria | 2681 |
| 605 | Ga0501083_0057189 | 3300049744 | Bacteria | 2612 |
| 606 | Ga0501083_0102997 | 3300049744 | Bacteria | 1881 |
| 607 | Ga0501083_0118716 | 3300049744 | Bacteria | 1735 |
| 608 | Ga0501083_0144294 | 3300049744 | Bacteria | 1558 |
| 609 | Ga0501083_0290457 | 3300049744 | Bacteria | 1063 |
| 610 | Ga0501035_0017022 | 3300049822 | Bacteria | 6699 |
| 611 | Ga0501044_0000509 | 3300049823 | Bacteria | 47320 |
| 612 | Ga0501044_0008635 | 3300049823 | Bacteria | 11156 |
| 613 | Ga0501044_0097349 | 3300049823 | Bacteria | 2964 |
| 614 | Ga0501044_0154290 | 3300049823 | Bacteria | 2276 |
| 615 | Ga0501044_0340242 | 3300049823 | Bacteria | 1421 |
| 616 | nmdc:mga03683_25739_c1 | 3300050489 | Bacteria | 1785 |
| 617 | nmdc:mga03683_3554_c1 | 3300050489 | Bacteria | 5050 |
| 618 | nmdc:mga00v17_9760_c1 | 3300050491 | Bacteria | 5212 |
| 619 | nmdc:mga0k408_66566_c1 | 3300050493 | Bacteria | 2099 |
| 620 | nmdc:mga06z11_73017_c1 | 3300050494 | Bacteria | 1821 |
| 621 | nmdc:mga06z11_84607_c1 | 3300050494 | Bacteria | 1709 |
| 622 | nmdc:mga05p37_2362_c1 | 3300050507 | Bacteria | 21952 |
| 623 | nmdc:mga05p37_29385_c1 | 3300050507 | Bacteria | 6708 |
| 624 | nmdc:mga05p37_45624_c1 | 3300050507 | Bacteria | 4011 |
| 625 | nmdc:mga09592_16449_c1 | 3300050508 | Bacteria | 6051 |
| 626 | nmdc:mga09592_269632_c1 | 3300050508 | Bacteria | 1476 |
| 627 | nmdc:mga0qj67_471_c1 | 3300050509 | Bacteria | 27479 |
| 628 | nmdc:mga0qj67_7709_c1 | 3300050509 | Bacteria | 6175 |
| 629 | nmdc:mga06r32_1530_c1 | 3300050510 | Bacteria | 20800 |
| 630 | nmdc:mga06r32_231467_c1 | 3300050510 | Bacteria | 1836 |
| 631 | nmdc:mga06r32_318279_c1 | 3300050510 | Bacteria | 1541 |
| 632 | nmdc:mga06r32_6629_c1 | 3300050510 | Bacteria | 10406 |
| 633 | nmdc:mga08y16_1107_c1 | 3300050511 | Bacteria | 26547 |
| 634 | nmdc:mga08y16_114383_c1 | 3300050511 | Bacteria | 2809 |
| 635 | nmdc:mga0n895_20390_c1 | 3300050512 | Bacteria | 6182 |
| 636 | nmdc:mga0n895_21450_c1 | 3300050512 | Bacteria | 6041 |
| 637 | nmdc:mga0n895_94093_c1 | 3300050512 | Bacteria | 3000 |
| 638 | nmdc:mga0rr50_104447_c1 | 3300050513 | Bacteria | 2232 |
| 639 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 640 | nmdc:mga08x19_47330_c1 | 3300050514 | Bacteria | 2752 |
| 641 | nmdc:mga08x19_59405_c1 | 3300050514 | Bacteria | 2475 |
| 642 | nmdc:mga0a205_23199_c1 | 3300050515 | Bacteria | 5885 |
| 643 | nmdc:mga0a205_70803_c1 | 3300050515 | Bacteria | 3367 |
| 644 | nmdc:mga0sz30_75785_c1 | 3300050516 | Bacteria | 1452 |
| 645 | Ga0495601_0000021 | 3300053077 | Bacteria | 159355 |
| 646 | Ga0495601_0001764 | 3300053077 | Bacteria | 11978 |
| 647 | Ga0495601_0007869 | 3300053077 | Bacteria | 6276 |
| 648 | Ga0495601_0031433 | 3300053077 | Bacteria | 3299 |
| 649 | Ga0495601_0048473 | 3300053077 | Bacteria | 2675 |
| 650 | Ga0495601_0128438 | 3300053077 | Bacteria | 1650 |
| 651 | Ga0495612_0000018 | 3300053078 | Bacteria | 150870 |
| 652 | Ga0495612_0000774 | 3300053078 | Bacteria | 12984 |
| 653 | Ga0495612_0006049 | 3300053078 | Bacteria | 4984 |
| 654 | Ga0495612_0047593 | 3300053078 | Bacteria | 1757 |
| 655 | Ga0495595_0000028 | 3300053084 | Bacteria | 97682 |
| 656 | Ga0495595_0000265 | 3300053084 | Bacteria | 20703 |
| 657 | Ga0495595_0021713 | 3300053084 | Bacteria | 2808 |
| 658 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 659 | Ga0495619_0000354 | 3300053085 | Bacteria | 32055 |
| 660 | Ga0495619_0003889 | 3300053085 | Bacteria | 9601 |
| 661 | Ga0495619_0070070 | 3300053085 | Bacteria | 2344 |
| 662 | Ga0495619_0082451 | 3300053085 | Bacteria | 2167 |
| 663 | Ga0495619_0083293 | 3300053085 | Bacteria | 2157 |
| 664 | Ga0495619_0090413 | 3300053085 | Bacteria | 2072 |
| 665 | Ga0495619_0103126 | 3300053085 | Bacteria | 1943 |
| 666 | Ga0495619_0173034 | 3300053085 | Bacteria | 1493 |
| 667 | Ga0500566_0000383 | 3300053094 | Bacteria | 24452 |
| 668 | Ga0500556_0000124 | 3300053104 | Bacteria | 67080 |
| 669 | Ga0500593_000134 | 3300053117 | Bacteria | 29394 |
| 670 | Ga0500595_018756 | 3300053119 | Bacteria | 2524 |
| 671 | Ga0500595_027905 | 3300053119 | Bacteria | 1929 |
| 672 | Ga0500652_000043 | 3300053131 | Bacteria | 64726 |
| 673 | Ga0500658_0091701 | 3300053134 | Bacteria | 1315 |
| 674 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 675 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 676 | Ga0500616_0016164 | 3300053153 | Bacteria | 4254 |
| 677 | Ga0500616_0018268 | 3300053153 | Bacteria | 3966 |
| 678 | Ga0500616_0111902 | 3300053153 | Bacteria | 1317 |
| 679 | Ga0501084_0042118 | 3300054114 | Bacteria | 3819 |
| 680 | Ga0501084_0097600 | 3300054114 | Bacteria | 2467 |
| 681 | Ga0501084_0315008 | 3300054114 | Bacteria | 1321 |
| 682 | Ga0501082_0004415 | 3300060353 | Bacteria | 12281 |
| 683 | Ga0501082_0026070 | 3300060353 | Bacteria | 5039 |
| 684 | Ga0501082_0063753 | 3300060353 | Bacteria | 3173 |
| 685 | Ga0501082_0088234 | 3300060353 | Bacteria | 2676 |
| 686 | Ga0501082_0269318 | 3300060353 | Bacteria | 1482 |
| 687 | Ga0530510_0144869 | 3300061734 | Bacteria | 1752 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047315 | Ga0495581_0218873 | Ga0495581_0218873_138_1058 | 304 |
| 2 | 3300035410 | Ga0373924_0134536 | Ga0373924_0134536_142_1062 | 305 |
| 3 | 3300049744 | Ga0501083_0290457 | Ga0501083_0290457_58_978 | 306 |
| 4 | 3300047444 | Ga0495675_0242738 | Ga0495675_0242738_64_1056 | 309 |
| 5 | 3300049744 | Ga0501083_0054594 | Ga0501083_0054594_23_1000 | 317 |
| 6 | 3300050508 | nmdc:mga09592_269632_c1 | nmdc:mga09592_269632_c1_436_1452 | 337 |
| 7 | 3300049587 | Ga0501071_0100043 | Ga0501071_0100043_102_1154 | 350 |
| 8 | 3300049590 | Ga0501074_0239948 | Ga0501074_0239948_24_1076 | 350 |
| 9 | 3300049592 | Ga0501076_0047928 | Ga0501076_0047928_1792_2844 | 350 |
| 10 | 3300049593 | Ga0501077_0003493 | Ga0501077_0003493_7017_8069 | 350 |
| 11 | 3300049741 | Ga0501079_0014464 | Ga0501079_0014464_1831_2883 | 350 |
| 12 | 3300049743 | Ga0501081_0002149 | Ga0501081_0002149_1879_2931 | 350 |
| 13 | 3300054114 | Ga0501084_0042118 | Ga0501084_0042118_2319_3371 | 350 |
| 14 | 3300060353 | Ga0501082_0088234 | Ga0501082_0088234_1090_2142 | 350 |
| 15 | 3300061734 | Ga0530510_0144869 | Ga0530510_0144869_241_1293 | 350 |
| 16 | 3300039450 | Ga0436363_0225098 | Ga0436363_0225098_2040_3182 | 354 |
| 17 | 3300005337 | Ga0070682_100031186 | Ga0070682_1000311862 | 356 |
| 18 | 3300005530 | Ga0070679_100066634 | Ga0070679_1000666342 | 356 |
| 19 | 3300005539 | Ga0068853_100005846 | Ga0068853_1000058468 | 356 |
| 20 | 3300047319 | Ga0495674_0260471 | Ga0495674_0260471_163_1305 | 358 |
| 21 | 3300053085 | Ga0495619_0070070 | Ga0495619_0070070_1056_2198 | 358 |
| 22 | 3300035116 | Ga0373945_0025365 | Ga0373945_0025365_594_1754 | 360 |
| 23 | 3300006175 | Ga0070712_100005000 | Ga0070712_1000050007 | 362 |
| 24 | 3300025915 | Ga0207693_10008563 | Ga0207693_100085633 | 362 |
| 25 | 3300035695 | Ga0373927_0004430 | Ga0373927_0004430_7147_8286 | 362 |
| 26 | 3300035725 | Ga0373947_0050684 | Ga0373947_0050684_1219_2358 | 362 |
| 27 | 3300046689 | Ga0495613_0108269 | Ga0495613_0108269_446_1585 | 362 |
| 28 | 3300047471 | Ga0495684_0048571 | Ga0495684_0048571_944_2092 | 362 |
| 29 | 3300005435 | Ga0070714_100028556 | Ga0070714_1000285562 | 364 |
| 30 | 3300005439 | Ga0070711_100068347 | Ga0070711_1000683472 | 364 |
| 31 | 3300035117 | Ga0373953_0002026 | Ga0373953_0002026_1160_2338 | 364 |
| 32 | 3300035118 | Ga0373954_0003140 | Ga0373954_0003140_3262_4440 | 364 |
| 33 | 3300035171 | Ga0373946_0009016 | Ga0373946_0009016_1256_2434 | 364 |
| 34 | 3300035172 | Ga0373955_0000294 | Ga0373955_0000294_4942_6120 | 364 |
| 35 | 3300035410 | Ga0373924_0003415 | Ga0373924_0003415_384_1562 | 364 |
| 36 | 3300035692 | Ga0373935_0000298 | Ga0373935_0000298_7473_8651 | 364 |
| 37 | 3300035695 | Ga0373927_0005686 | Ga0373927_0005686_7145_8323 | 364 |
| 38 | 3300035725 | Ga0373947_0000391 | Ga0373947_0000391_773_1951 | 364 |
| 39 | 3300036401 | Ga0373937_0000081 | Ga0373937_0000081_68665_69843 | 364 |
| 40 | 3300037068 | Ga0373925_0000425 | Ga0373925_0000425_30676_31854 | 364 |
| 41 | 3300046454 | Ga0495592_0002862 | Ga0495592_0002862_3906_5084 | 364 |
| 42 | 3300046462 | Ga0495651_0000541 | Ga0495651_0000541_3385_4563 | 364 |
| 43 | 3300046463 | Ga0495653_0000054 | Ga0495653_0000054_23351_24529 | 364 |
| 44 | 3300046476 | Ga0495662_0013700 | Ga0495662_0013700_302_1480 | 364 |
| 45 | 3300046477 | Ga0495664_0000020 | Ga0495664_0000020_71304_72482 | 364 |
| 46 | 3300046511 | Ga0495608_0000024 | Ga0495608_0000024_79887_81065 | 364 |
| 47 | 3300046514 | Ga0495618_0000020 | Ga0495618_0000020_78268_79446 | 364 |
| 48 | 3300046516 | Ga0495628_0000015 | Ga0495628_0000015_119459_120637 | 364 |
| 49 | 3300046517 | Ga0495630_0001403 | Ga0495630_0001403_4888_6066 | 364 |
| 50 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_380252_381430 | 364 |
| 51 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_566993_568171 | 364 |
| 52 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_639449_640627 | 364 |
| 53 | 3300046543 | Ga0495645_0000013 | Ga0495645_0000013_78260_79438 | 364 |
| 54 | 3300046559 | Ga0495667_0000030 | Ga0495667_0000030_83304_84482 | 364 |
| 55 | 3300046642 | Ga0495634_0000117 | Ga0495634_0000117_63382_64560 | 364 |
| 56 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_625260_626438 | 364 |
| 57 | 3300046675 | Ga0495657_0000028 | Ga0495657_0000028_66436_67614 | 364 |
| 58 | 3300046678 | Ga0495599_0000050 | Ga0495599_0000050_1493_2671 | 364 |
| 59 | 3300046679 | Ga0495623_0000013 | Ga0495623_0000013_56138_57316 | 364 |
| 60 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_203248_204426 | 364 |
| 61 | 3300046689 | Ga0495613_0048411 | Ga0495613_0048411_1171_2349 | 364 |
| 62 | 3300046690 | Ga0495624_0029449 | Ga0495624_0029449_153_1331 | 364 |
| 63 | 3300046809 | Ga0495600_0000002 | Ga0495600_0000002_66036_67214 | 364 |
| 64 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_588092_589270 | 364 |
| 65 | 3300047319 | Ga0495674_0000018 | Ga0495674_0000018_83472_84650 | 364 |
| 66 | 3300047321 | Ga0495676_0159333 | Ga0495676_0159333_88_1266 | 364 |
| 67 | 3300047322 | Ga0495680_0000159 | Ga0495680_0000159_27887_29065 | 364 |
| 68 | 3300047444 | Ga0495675_0000238 | Ga0495675_0000238_13796_14974 | 364 |
| 69 | 3300047471 | Ga0495684_0000010 | Ga0495684_0000010_78368_79546 | 364 |
| 70 | 3300047673 | Ga0495593_0002081 | Ga0495593_0002081_4918_6096 | 364 |
| 71 | 3300048088 | Ga0495602_0000016 | Ga0495602_0000016_78170_79348 | 364 |
| 72 | 3300053077 | Ga0495601_0000021 | Ga0495601_0000021_78250_79428 | 364 |
| 73 | 3300053078 | Ga0495612_0000018 | Ga0495612_0000018_78261_79439 | 364 |
| 74 | 3300053084 | Ga0495595_0000028 | Ga0495595_0000028_11198_12376 | 364 |
| 75 | 3300053085 | Ga0495619_0000006 | Ga0495619_0000006_303715_304893 | 364 |
| 76 | 3300006175 | Ga0070712_100052359 | Ga0070712_1000523591 | 365 |
| 77 | 3300025915 | Ga0207693_10176339 | Ga0207693_101763392 | 365 |
| 78 | 3300035113 | Ga0373936_0027130 | Ga0373936_0027130_782_1918 | 365 |
| 79 | 3300035170 | Ga0373943_0000261 | Ga0373943_0000261_20425_21561 | 365 |
| 80 | 3300035170 | Ga0373943_0054365 | Ga0373943_0054365_561_1697 | 365 |
| 81 | 3300035171 | Ga0373946_0024627 | Ga0373946_0024627_256_1392 | 365 |
| 82 | 3300035692 | Ga0373935_0066253 | Ga0373935_0066253_281_1417 | 365 |
| 83 | 3300035695 | Ga0373927_0003788 | Ga0373927_0003788_297_1433 | 365 |
| 84 | 3300035695 | Ga0373927_0059904 | Ga0373927_0059904_309_1445 | 365 |
| 85 | 3300035725 | Ga0373947_0033218 | Ga0373947_0033218_732_1868 | 365 |
| 86 | 3300035725 | Ga0373947_0038909 | Ga0373947_0038909_1225_2361 | 365 |
| 87 | 3300036647 | Ga0316582_0213509 | Ga0316582_0213509_11_1168 | 365 |
| 88 | 3300037068 | Ga0373925_0040551 | Ga0373925_0040551_1114_2250 | 365 |
| 89 | 3300039447 | Ga0436361_0112327 | Ga0436361_0112327_288_1424 | 365 |
| 90 | 3300046462 | Ga0495651_0194257 | Ga0495651_0194257_130_1266 | 365 |
| 91 | 3300046463 | Ga0495653_0137502 | Ga0495653_0137502_249_1397 | 365 |
| 92 | 3300046477 | Ga0495664_0000385 | Ga0495664_0000385_4972_6108 | 365 |
| 93 | 3300046514 | Ga0495618_0139032 | Ga0495618_0139032_212_1348 | 365 |
| 94 | 3300046517 | Ga0495630_0031144 | Ga0495630_0031144_2566_3702 | 365 |
| 95 | 3300046517 | Ga0495630_0042715 | Ga0495630_0042715_744_1880 | 365 |
| 96 | 3300046531 | Ga0495665_0027276 | Ga0495665_0027276_279_1427 | 365 |
| 97 | 3300046531 | Ga0495665_0065481 | Ga0495665_0065481_106_1242 | 365 |
| 98 | 3300046642 | Ga0495634_0007759 | Ga0495634_0007759_5670_6806 | 365 |
| 99 | 3300046663 | Ga0495635_0000800 | Ga0495635_0000800_1202_2338 | 365 |
| 100 | 3300046689 | Ga0495613_0041659 | Ga0495613_0041659_1022_2158 | 365 |
| 101 | 3300046690 | Ga0495624_0003637 | Ga0495624_0003637_1396_2532 | 365 |
| 102 | 3300047319 | Ga0495674_0001787 | Ga0495674_0001787_6021_7157 | 365 |
| 103 | 3300047471 | Ga0495684_0075131 | Ga0495684_0075131_980_2116 | 365 |
| 104 | 3300047471 | Ga0495684_0076363 | Ga0495684_0076363_295_1431 | 365 |
| 105 | 3300047673 | Ga0495593_0038636 | Ga0495593_0038636_705_1841 | 365 |
| 106 | 3300053078 | Ga0495612_0006049 | Ga0495612_0006049_1408_2544 | 365 |
| 107 | 3300053085 | Ga0495619_0082451 | Ga0495619_0082451_996_2132 | 365 |
| 108 | 3300053085 | Ga0495619_0103126 | Ga0495619_0103126_738_1874 | 365 |
| 109 | 3300021384 | Ga0213876_10012097 | Ga0213876_100120973 | 368 |
| 110 | 3300039437 | Ga0436365_0657686 | Ga0436365_0657686_22848_23993 | 368 |
| 111 | 3300049570 | Ga0501033_0060430 | Ga0501033_0060430_1126_2262 | 368 |
| 112 | 3300049571 | Ga0501034_0275389 | Ga0501034_0275389_266_1402 | 368 |
| 113 | 3300049572 | Ga0501036_0122485 | Ga0501036_0122485_12_1148 | 368 |
| 114 | 3300049579 | Ga0501043_0150154 | Ga0501043_0150154_212_1348 | 368 |
| 115 | 3300049581 | Ga0501047_0046121 | Ga0501047_0046121_476_1612 | 368 |
| 116 | 3300005530 | Ga0070679_100289343 | Ga0070679_1002893431 | 369 |
| 117 | 3300025912 | Ga0207707_10189204 | Ga0207707_101892042 | 369 |
| 118 | 3300025917 | Ga0207660_10104513 | Ga0207660_101045132 | 369 |
| 119 | 3300025921 | Ga0207652_10165212 | Ga0207652_101652122 | 369 |
| 120 | 3300049586 | Ga0501070_0047057 | Ga0501070_0047057_952_2094 | 369 |
| 121 | 3300049589 | Ga0501073_0134401 | Ga0501073_0134401_306_1448 | 369 |
| 122 | iso_pu_bacteria | 2909042592 | 2909047749 | 369 |
| 123 | 3300005434 | Ga0070709_10023880 | Ga0070709_100238802 | 370 |
| 124 | 3300025906 | Ga0207699_10021051 | Ga0207699_100210512 | 370 |
| 125 | 3300025929 | Ga0207664_10006820 | Ga0207664_100068202 | 370 |
| 126 | 3300047447 | Ga0495685_021510 | Ga0495685_021510_869_2026 | 370 |
| 127 | 3300053078 | Ga0495612_0047593 | Ga0495612_0047593_614_1732 | 370 |
| 128 | 3300005435 | Ga0070714_100097321 | Ga0070714_1000973212 | 371 |
| 129 | 3300025929 | Ga0207664_10092307 | Ga0207664_100923073 | 371 |
| 130 | 3300031241 | Ga0265325_10003766 | Ga0265325_100037665 | 371 |
| 131 | 3300031249 | Ga0265339_10002624 | Ga0265339_100026248 | 371 |
| 132 | 3300031344 | Ga0265316_10111529 | Ga0265316_101115292 | 371 |
| 133 | 3300031595 | Ga0265313_10001996 | Ga0265313_100019969 | 371 |
| 134 | 3300037068 | Ga0373925_0139038 | Ga0373925_0139038_526_1677 | 371 |
| 135 | 3300007265 | Ga0099794_10074803 | Ga0099794_100748032 | 372 |
| 136 | 3300009148 | Ga0105243_10062299 | Ga0105243_100622993 | 372 |
| 137 | 3300009551 | Ga0105238_10027483 | Ga0105238_100274834 | 372 |
| 138 | 3300025944 | Ga0207661_10015374 | Ga0207661_100153741 | 372 |
| 139 | 3300039438 | Ga0436360_1257472 | Ga0436360_1257472_33_1181 | 372 |
| 140 | 3300048909 | Ga0496106_0193608 | Ga0496106_0193608_20_1162 | 372 |
| 141 | 3300048911 | Ga0496108_0176356 | Ga0496108_0176356_492_1634 | 372 |
| 142 | 3300048917 | Ga0496114_0144390 | Ga0496114_0144390_36_1196 | 372 |
| 143 | 3300005439 | Ga0070711_100032154 | Ga0070711_1000321543 | 373 |
| 144 | 3300006186 | Ga0075369_10054202 | Ga0075369_100542022 | 373 |
| 145 | 3300028556 | Ga0265337_1007585 | Ga0265337_10075852 | 373 |
| 146 | 3300048907 | Ga0496104_0301833 | Ga0496104_0301833_23_1183 | 373 |
| 147 | 3300005331 | Ga0070670_100056259 | Ga0070670_1000562593 | 374 |
| 148 | 3300005338 | Ga0068868_100002623 | Ga0068868_10000262310 | 374 |
| 149 | 3300005355 | Ga0070671_100002901 | Ga0070671_1000029018 | 374 |
| 150 | 3300005364 | Ga0070673_100056398 | Ga0070673_1000563984 | 374 |
| 151 | 3300005367 | Ga0070667_100024338 | Ga0070667_1000243382 | 374 |
| 152 | 3300005617 | Ga0068859_100181268 | Ga0068859_1001812682 | 374 |
| 153 | 3300005618 | Ga0068864_100109424 | Ga0068864_1001094242 | 374 |
| 154 | 3300006237 | Ga0097621_100081999 | Ga0097621_1000819993 | 374 |
| 155 | 3300006931 | Ga0097620_100181273 | Ga0097620_1001812732 | 374 |
| 156 | 3300009098 | Ga0105245_10000898 | Ga0105245_100008982 | 374 |
| 157 | 3300009177 | Ga0105248_10083721 | Ga0105248_100837214 | 374 |
| 158 | 3300013100 | Ga0157373_10066627 | Ga0157373_100666273 | 374 |
| 159 | 3300013296 | Ga0157374_10295070 | Ga0157374_102950702 | 374 |
| 160 | 3300014325 | Ga0163163_10205249 | Ga0163163_102052491 | 374 |
| 161 | 3300021388 | Ga0213875_10000031 | Ga0213875_1000003153 | 374 |
| 162 | 3300024225 | Ga0224572_1000034 | Ga0224572_10000343 | 374 |
| 163 | 3300024227 | Ga0228598_1011336 | Ga0228598_10113362 | 374 |
| 164 | 3300024227 | Ga0228598_1020122 | Ga0228598_10201221 | 374 |
| 165 | 3300025925 | Ga0207650_10013257 | Ga0207650_100132573 | 374 |
| 166 | 3300025926 | Ga0207659_10017877 | Ga0207659_100178772 | 374 |
| 167 | 3300025928 | Ga0207700_10145823 | Ga0207700_101458232 | 374 |
| 168 | 3300025936 | Ga0207670_10017840 | Ga0207670_100178402 | 374 |
| 169 | 3300025940 | Ga0207691_10095637 | Ga0207691_100956373 | 374 |
| 170 | 3300025941 | Ga0207711_10064329 | Ga0207711_100643292 | 374 |
| 171 | 3300025960 | Ga0207651_10002803 | Ga0207651_100028036 | 374 |
| 172 | 3300025960 | Ga0207651_10026194 | Ga0207651_100261942 | 374 |
| 173 | 3300025986 | Ga0207658_10153659 | Ga0207658_101536591 | 374 |
| 174 | 3300026023 | Ga0207677_10025711 | Ga0207677_100257114 | 374 |
| 175 | 3300035117 | Ga0373953_0022405 | Ga0373953_0022405_1215_2342 | 374 |
| 176 | 3300035410 | Ga0373924_0053719 | Ga0373924_0053719_504_1631 | 374 |
| 177 | 3300035692 | Ga0373935_0168033 | Ga0373935_0168033_340_1467 | 374 |
| 178 | 3300036401 | Ga0373937_0237558 | Ga0373937_0237558_579_1706 | 374 |
| 179 | 3300037853 | Ga0436364_0793438 | Ga0436364_0793438_19249_20397 | 374 |
| 180 | 3300039437 | Ga0436365_0085454 | Ga0436365_0085454_666_1898 | 374 |
| 181 | 3300046455 | Ga0495603_0085819 | Ga0495603_0085819_228_1355 | 374 |
| 182 | 3300046459 | Ga0495629_0180675 | Ga0495629_0180675_160_1287 | 374 |
| 183 | 3300046511 | Ga0495608_0045485 | Ga0495608_0045485_1574_2701 | 374 |
| 184 | 3300046514 | Ga0495618_0059854 | Ga0495618_0059854_66_1193 | 374 |
| 185 | 3300046516 | Ga0495628_0050220 | Ga0495628_0050220_145_1272 | 374 |
| 186 | 3300046679 | Ga0495623_0018525 | Ga0495623_0018525_2153_3280 | 374 |
| 187 | 3300047317 | Ga0495604_0147070 | Ga0495604_0147070_334_1461 | 374 |
| 188 | 3300048911 | Ga0496108_0222345 | Ga0496108_0222345_134_1258 | 374 |
| 189 | 3300048915 | Ga0496112_0017515 | Ga0496112_0017515_3627_4751 | 374 |
| 190 | 3300049588 | Ga0501072_0002322 | Ga0501072_0002322_191_1330 | 374 |
| 191 | 3300049744 | Ga0501083_0102997 | Ga0501083_0102997_137_1276 | 374 |
| 192 | 3300053085 | Ga0495619_0090413 | Ga0495619_0090413_771_1898 | 374 |
| 193 | iso_pu_bacteria | 2524023210 | 2524467289 | 374 |
| 194 | iso_pu_bacteria | 8056681323 | 8056687601 | 374 |
| 195 | 3300006178 | Ga0075367_10012078 | Ga0075367_100120783 | 375 |
| 196 | 3300021384 | Ga0213876_10096307 | Ga0213876_100963072 | 375 |
| 197 | 3300025909 | Ga0207705_10102483 | Ga0207705_101024832 | 375 |
| 198 | 3300025928 | Ga0207700_10161802 | Ga0207700_101618022 | 375 |
| 199 | 3300031727 | Ga0316576_10248913 | Ga0316576_102489131 | 375 |
| 200 | 3300035398 | Ga0316574_0003414 | Ga0316574_0003414_1755_2894 | 375 |
| 201 | 3300036712 | Ga0316584_0099682 | Ga0316584_0099682_154_1293 | 375 |
| 202 | 3300039437 | Ga0436365_0903140 | Ga0436365_0903140_1496_2629 | 375 |
| 203 | 3300048903 | Ga0496100_0011897 | Ga0496100_0011897_3268_4401 | 375 |
| 204 | 3300048904 | Ga0496101_0002084 | Ga0496101_0002084_8490_9623 | 375 |
| 205 | 3300048905 | Ga0496102_0029733 | Ga0496102_0029733_3314_4447 | 375 |
| 206 | 3300048906 | Ga0496103_0013488 | Ga0496103_0013488_3012_4145 | 375 |
| 207 | 3300048907 | Ga0496104_0006456 | Ga0496104_0006456_8712_9845 | 375 |
| 208 | 3300048908 | Ga0496105_0032246 | Ga0496105_0032246_1516_2649 | 375 |
| 209 | 3300048909 | Ga0496106_0035173 | Ga0496106_0035173_427_1560 | 375 |
| 210 | 3300048910 | Ga0496107_0012023 | Ga0496107_0012023_1546_2679 | 375 |
| 211 | 3300048911 | Ga0496108_0008123 | Ga0496108_0008123_6275_7408 | 375 |
| 212 | 3300048911 | Ga0496108_0014550 | Ga0496108_0014550_1899_3032 | 375 |
| 213 | 3300048912 | Ga0496109_0008742 | Ga0496109_0008742_578_1711 | 375 |
| 214 | 3300048913 | Ga0496110_0006704 | Ga0496110_0006704_6274_7407 | 375 |
| 215 | 3300048913 | Ga0496110_0059599 | Ga0496110_0059599_799_1932 | 375 |
| 216 | 3300048914 | Ga0496111_0018672 | Ga0496111_0018672_1092_2225 | 375 |
| 217 | 3300048916 | Ga0496113_0061077 | Ga0496113_0061077_760_1929 | 375 |
| 218 | 3300048916 | Ga0496113_0127457 | Ga0496113_0127457_446_1579 | 375 |
| 219 | 3300048917 | Ga0496114_0137178 | Ga0496114_0137178_719_1852 | 375 |
| 220 | 3300048918 | Ga0496115_0023653 | Ga0496115_0023653_3472_4605 | 375 |
| 221 | 3300050491 | nmdc:mga00v17_9760_c1 | nmdc:mga00v17_9760_c1_2493_3626 | 375 |
| 222 | 3300053119 | Ga0500595_018756 | Ga0500595_018756_720_1853 | 375 |
| 223 | 3300053131 | Ga0500652_000043 | Ga0500652_000043_55389_56522 | 375 |
| 224 | iso_pu_bacteria | 2545555834 | 2545677611 | 375 |
| 225 | iso_pu_bacteria | 3003665799 | 3003667322 | 375 |
| 226 | iso_pu_bacteria | 641522639 | 641640346 | 375 |
| 227 | iso_pu_bacteria | 643348564 | 643597783 | 375 |
| 228 | 3300005458 | Ga0070681_10007499 | Ga0070681_100074997 | 376 |
| 229 | 3300005530 | Ga0070679_100010240 | Ga0070679_1000102405 | 376 |
| 230 | 3300005536 | Ga0070697_100014105 | Ga0070697_1000141051 | 376 |
| 231 | 3300005545 | Ga0070695_100003310 | Ga0070695_1000033102 | 376 |
| 232 | 3300006914 | Ga0075436_100002664 | Ga0075436_1000026649 | 376 |
| 233 | 3300009098 | Ga0105245_10276091 | Ga0105245_102760912 | 376 |
| 234 | 3300025918 | Ga0207662_10038601 | Ga0207662_100386013 | 376 |
| 235 | 3300025939 | Ga0207665_10149648 | Ga0207665_101496482 | 376 |
| 236 | 3300035111 | Ga0373923_0034646 | Ga0373923_0034646_410_1546 | 376 |
| 237 | 3300035172 | Ga0373955_0025780 | Ga0373955_0025780_1795_2931 | 376 |
| 238 | 3300035695 | Ga0373927_0020166 | Ga0373927_0020166_2359_3495 | 376 |
| 239 | 3300035724 | Ga0373933_0000325 | Ga0373933_0000325_1633_2769 | 376 |
| 240 | 3300036401 | Ga0373937_0002429 | Ga0373937_0002429_6165_7301 | 376 |
| 241 | 3300037068 | Ga0373925_0071882 | Ga0373925_0071882_438_1574 | 376 |
| 242 | 3300046454 | Ga0495592_0027438 | Ga0495592_0027438_250_1386 | 376 |
| 243 | 3300046459 | Ga0495629_0011442 | Ga0495629_0011442_200_1336 | 376 |
| 244 | 3300046462 | Ga0495651_0002748 | Ga0495651_0002748_2719_3855 | 376 |
| 245 | 3300046463 | Ga0495653_0012932 | Ga0495653_0012932_4251_5387 | 376 |
| 246 | 3300046511 | Ga0495608_0006299 | Ga0495608_0006299_3058_4194 | 376 |
| 247 | 3300046514 | Ga0495618_0001885 | Ga0495618_0001885_782_1918 | 376 |
| 248 | 3300046516 | Ga0495628_0167126 | Ga0495628_0167126_201_1337 | 376 |
| 249 | 3300046526 | Ga0495666_0087671 | Ga0495666_0087671_36_1172 | 376 |
| 250 | 3300046529 | Ga0495652_0020776 | Ga0495652_0020776_622_1758 | 376 |
| 251 | 3300046533 | Ga0495640_0003282 | Ga0495640_0003282_7714_8850 | 376 |
| 252 | 3300046536 | Ga0495587_0000568 | Ga0495587_0000568_12250_13386 | 376 |
| 253 | 3300046543 | Ga0495645_0024674 | Ga0495645_0024674_3051_4187 | 376 |
| 254 | 3300046559 | Ga0495667_0002169 | Ga0495667_0002169_6144_7280 | 376 |
| 255 | 3300046642 | Ga0495634_0021991 | Ga0495634_0021991_1261_2397 | 376 |
| 256 | 3300046663 | Ga0495635_0048578 | Ga0495635_0048578_1591_2727 | 376 |
| 257 | 3300046678 | Ga0495599_0008520 | Ga0495599_0008520_922_2058 | 376 |
| 258 | 3300046679 | Ga0495623_0001240 | Ga0495623_0001240_11509_12645 | 376 |
| 259 | 3300046680 | Ga0495646_0055013 | Ga0495646_0055013_989_2125 | 376 |
| 260 | 3300046689 | Ga0495613_0013543 | Ga0495613_0013543_3795_4931 | 376 |
| 261 | 3300046690 | Ga0495624_0109282 | Ga0495624_0109282_145_1281 | 376 |
| 262 | 3300046809 | Ga0495600_0003096 | Ga0495600_0003096_3706_4842 | 376 |
| 263 | 3300047317 | Ga0495604_0000168 | Ga0495604_0000168_50120_51256 | 376 |
| 264 | 3300047319 | Ga0495674_0004591 | Ga0495674_0004591_4511_5647 | 376 |
| 265 | 3300047321 | Ga0495676_0059014 | Ga0495676_0059014_1328_2464 | 376 |
| 266 | 3300047322 | Ga0495680_0000415 | Ga0495680_0000415_18628_19764 | 376 |
| 267 | 3300047322 | Ga0495680_0179150 | Ga0495680_0179150_326_1462 | 376 |
| 268 | 3300047444 | Ga0495675_0006869 | Ga0495675_0006869_4566_5702 | 376 |
| 269 | 3300047471 | Ga0495684_0116072 | Ga0495684_0116072_248_1384 | 376 |
| 270 | 3300047673 | Ga0495593_0057331 | Ga0495593_0057331_690_1826 | 376 |
| 271 | 3300048088 | Ga0495602_0001302 | Ga0495602_0001302_18927_20063 | 376 |
| 272 | 3300049571 | Ga0501034_0318911 | Ga0501034_0318911_195_1340 | 376 |
| 273 | 3300049581 | Ga0501047_0034600 | Ga0501047_0034600_1683_2828 | 376 |
| 274 | 3300049583 | Ga0501067_0036049 | Ga0501067_0036049_1375_2520 | 376 |
| 275 | 3300049586 | Ga0501070_0066001 | Ga0501070_0066001_1609_2754 | 376 |
| 276 | 3300049588 | Ga0501072_0108720 | Ga0501072_0108720_294_1439 | 376 |
| 277 | 3300049742 | Ga0501080_0084856 | Ga0501080_0084856_359_1504 | 376 |
| 278 | 3300049823 | Ga0501044_0340242 | Ga0501044_0340242_135_1280 | 376 |
| 279 | 3300050514 | nmdc:mga08x19_18_c1 | nmdc:mga08x19_18_c1_286784_287968 | 376 |
| 280 | 3300053077 | Ga0495601_0007869 | Ga0495601_0007869_4125_5261 | 376 |
| 281 | 3300053078 | Ga0495612_0000774 | Ga0495612_0000774_5697_6833 | 376 |
| 282 | 3300053084 | Ga0495595_0000265 | Ga0495595_0000265_663_1799 | 376 |
| 283 | 3300053085 | Ga0495619_0000354 | Ga0495619_0000354_128_1264 | 376 |
| 284 | 3300060353 | Ga0501082_0269318 | Ga0501082_0269318_103_1248 | 376 |
| 285 | iso_pu_bacteria | 2829745981 | 2829746407 | 376 |
| 286 | iso_pu_bacteria | 2919450847 | 2919453038 | 376 |
| 287 | iso_pu_bacteria | 8001845381 | 8001850626 | 376 |
| 288 | 3300003215 | JGI25153J46596_10006762 | JGI25153J46596_100067621 | 377 |
| 289 | 3300005439 | Ga0070711_100227183 | Ga0070711_1002271831 | 377 |
| 290 | 3300006028 | Ga0070717_10178156 | Ga0070717_101781562 | 377 |
| 291 | 3300006177 | Ga0075362_10044379 | Ga0075362_100443792 | 377 |
| 292 | 3300006178 | Ga0075367_10100456 | Ga0075367_101004562 | 377 |
| 293 | 3300006847 | Ga0075431_100097396 | Ga0075431_1000973962 | 377 |
| 294 | 3300009093 | Ga0105240_10004682 | Ga0105240_1000468212 | 377 |
| 295 | 3300009094 | Ga0111539_10171707 | Ga0111539_101717073 | 377 |
| 296 | 3300021377 | Ga0213874_10048999 | Ga0213874_100489991 | 377 |
| 297 | 3300025297 | Ga0209758_1000312 | Ga0209758_100031283 | 377 |
| 298 | 3300025913 | Ga0207695_10000107 | Ga0207695_1000010718 | 377 |
| 299 | 3300025915 | Ga0207693_10021913 | Ga0207693_100219134 | 377 |
| 300 | 3300025929 | Ga0207664_10032181 | Ga0207664_100321813 | 377 |
| 301 | 3300026142 | Ga0207698_10007221 | Ga0207698_100072213 | 377 |
| 302 | 3300031241 | Ga0265325_10011638 | Ga0265325_100116382 | 377 |
| 303 | 3300035171 | Ga0373946_0095198 | Ga0373946_0095198_14_1150 | 377 |
| 304 | 3300035692 | Ga0373935_0057105 | Ga0373935_0057105_783_1925 | 377 |
| 305 | 3300035725 | Ga0373947_0025548 | Ga0373947_0025548_230_1366 | 377 |
| 306 | 3300037068 | Ga0373925_0148109 | Ga0373925_0148109_361_1503 | 377 |
| 307 | 3300037853 | Ga0436364_0033507 | Ga0436364_0033507_98_1483 | 377 |
| 308 | 3300044684 | Ga0466966_0045849 | Ga0466966_0045849_709_1851 | 377 |
| 309 | 3300044694 | Ga0466963_0132010 | Ga0466963_0132010_81_1223 | 377 |
| 310 | 3300046455 | Ga0495603_0073678 | Ga0495603_0073678_382_1524 | 377 |
| 311 | 3300046472 | Ga0495580_0037671 | Ga0495580_0037671_1038_2180 | 377 |
| 312 | 3300046476 | Ga0495662_0037470 | Ga0495662_0037470_517_1659 | 377 |
| 313 | 3300046533 | Ga0495640_0112404 | Ga0495640_0112404_470_1612 | 377 |
| 314 | 3300046674 | Ga0495588_0079273 | Ga0495588_0079273_28_1164 | 377 |
| 315 | 3300048909 | Ga0496106_0085211 | Ga0496106_0085211_1065_2213 | 377 |
| 316 | 3300048913 | Ga0496110_0105767 | Ga0496110_0105767_1319_2452 | 377 |
| 317 | 3300049570 | Ga0501033_0096076 | Ga0501033_0096076_807_1964 | 377 |
| 318 | 3300049742 | Ga0501080_0248477 | Ga0501080_0248477_254_1387 | 377 |
| 319 | 3300049744 | Ga0501083_0118716 | Ga0501083_0118716_330_1463 | 377 |
| 320 | 3300050494 | nmdc:mga06z11_84607_c1 | nmdc:mga06z11_84607_c1_261_1397 | 377 |
| 321 | 3300050510 | nmdc:mga06r32_231467_c1 | nmdc:mga06r32_231467_c1_626_1768 | 377 |
| 322 | 3300053077 | Ga0495601_0031433 | Ga0495601_0031433_191_1333 | 377 |
| 323 | 3300053094 | Ga0500566_0000383 | Ga0500566_0000383_5985_7247 | 377 |
| 324 | 3300053117 | Ga0500593_000134 | Ga0500593_000134_13103_14260 | 377 |
| 325 | 3300053119 | Ga0500595_027905 | Ga0500595_027905_298_1431 | 377 |
| 326 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_271369_272526 | 377 |
| 327 | 3300003215 | JGI25153J46596_10002083 | JGI25153J46596_100020833 | 378 |
| 328 | 3300003215 | JGI25153J46596_10003147 | JGI25153J46596_100031473 | 378 |
| 329 | 3300005333 | Ga0070677_10033564 | Ga0070677_100335643 | 378 |
| 330 | 3300005336 | Ga0070680_100003784 | Ga0070680_1000037845 | 378 |
| 331 | 3300005340 | Ga0070689_100011341 | Ga0070689_1000113414 | 378 |
| 332 | 3300005354 | Ga0070675_100124035 | Ga0070675_1001240352 | 378 |
| 333 | 3300005356 | Ga0070674_100005761 | Ga0070674_1000057616 | 378 |
| 334 | 3300005365 | Ga0070688_100008590 | Ga0070688_1000085903 | 378 |
| 335 | 3300005366 | Ga0070659_100007423 | Ga0070659_1000074232 | 378 |
| 336 | 3300005367 | Ga0070667_100124451 | Ga0070667_1001244512 | 378 |
| 337 | 3300005436 | Ga0070713_100018647 | Ga0070713_1000186473 | 378 |
| 338 | 3300005436 | Ga0070713_100192177 | Ga0070713_1001921772 | 378 |
| 339 | 3300005441 | Ga0070700_100137114 | Ga0070700_1001371142 | 378 |
| 340 | 3300005456 | Ga0070678_100040542 | Ga0070678_1000405422 | 378 |
| 341 | 3300005458 | Ga0070681_10001010 | Ga0070681_1000101017 | 378 |
| 342 | 3300005471 | Ga0070698_100048964 | Ga0070698_1000489643 | 378 |
| 343 | 3300005536 | Ga0070697_100103146 | Ga0070697_1001031461 | 378 |
| 344 | 3300005549 | Ga0070704_100001522 | Ga0070704_1000015228 | 378 |
| 345 | 3300005563 | Ga0068855_100003400 | Ga0068855_10000340018 | 378 |
| 346 | 3300005577 | Ga0068857_100130343 | Ga0068857_1001303431 | 378 |
| 347 | 3300005577 | Ga0068857_100308193 | Ga0068857_1003081932 | 378 |
| 348 | 3300005617 | Ga0068859_100049426 | Ga0068859_1000494262 | 378 |
| 349 | 3300005617 | Ga0068859_100408670 | Ga0068859_1004086701 | 378 |
| 350 | 3300005618 | Ga0068864_100172550 | Ga0068864_1001725501 | 378 |
| 351 | 3300005618 | Ga0068864_100225319 | Ga0068864_1002253192 | 378 |
| 352 | 3300005841 | Ga0068863_100094543 | Ga0068863_1000945433 | 378 |
| 353 | 3300005937 | Ga0081455_10024342 | Ga0081455_100243426 | 378 |
| 354 | 3300006028 | Ga0070717_10182202 | Ga0070717_101822022 | 378 |
| 355 | 3300006195 | Ga0075366_10001179 | Ga0075366_100011793 | 378 |
| 356 | 3300006931 | Ga0097620_100049426 | Ga0097620_1000494262 | 378 |
| 357 | 3300006931 | Ga0097620_100408691 | Ga0097620_1004086911 | 378 |
| 358 | 3300009148 | Ga0105243_10118081 | Ga0105243_101180811 | 378 |
| 359 | 3300009553 | Ga0105249_10000366 | Ga0105249_100003668 | 378 |
| 360 | 3300013100 | Ga0157373_10074325 | Ga0157373_100743252 | 378 |
| 361 | 3300013104 | Ga0157370_10007752 | Ga0157370_100077529 | 378 |
| 362 | 3300013307 | Ga0157372_10001212 | Ga0157372_100012128 | 378 |
| 363 | 3300017792 | Ga0163161_10131273 | Ga0163161_101312732 | 378 |
| 364 | 3300025297 | Ga0209758_1000308 | Ga0209758_100030824 | 378 |
| 365 | 3300025297 | Ga0209758_1028725 | Ga0209758_10287252 | 378 |
| 366 | 3300025893 | Ga0207682_10059186 | Ga0207682_100591862 | 378 |
| 367 | 3300025901 | Ga0207688_10025459 | Ga0207688_100254594 | 378 |
| 368 | 3300025907 | Ga0207645_10037589 | Ga0207645_100375893 | 378 |
| 369 | 3300025908 | Ga0207643_10107794 | Ga0207643_101077941 | 378 |
| 370 | 3300025912 | Ga0207707_10005935 | Ga0207707_100059359 | 378 |
| 371 | 3300025917 | Ga0207660_10120633 | Ga0207660_101206332 | 378 |
| 372 | 3300025921 | Ga0207652_10005989 | Ga0207652_100059893 | 378 |
| 373 | 3300025923 | Ga0207681_10019099 | Ga0207681_100190993 | 378 |
| 374 | 3300025927 | Ga0207687_10309102 | Ga0207687_103091021 | 378 |
| 375 | 3300025928 | Ga0207700_10034853 | Ga0207700_100348533 | 378 |
| 376 | 3300025929 | Ga0207664_10028136 | Ga0207664_100281362 | 378 |
| 377 | 3300025931 | Ga0207644_10229240 | Ga0207644_102292402 | 378 |
| 378 | 3300025932 | Ga0207690_10044356 | Ga0207690_100443562 | 378 |
| 379 | 3300025936 | Ga0207670_10019375 | Ga0207670_100193753 | 378 |
| 380 | 3300025937 | Ga0207669_10008682 | Ga0207669_100086824 | 378 |
| 381 | 3300025940 | Ga0207691_10138170 | Ga0207691_101381703 | 378 |
| 382 | 3300025960 | Ga0207651_10168876 | Ga0207651_101688762 | 378 |
| 383 | 3300025961 | Ga0207712_10002501 | Ga0207712_100025017 | 378 |
| 384 | 3300025972 | Ga0207668_10227145 | Ga0207668_102271451 | 378 |
| 385 | 3300026035 | Ga0207703_10168976 | Ga0207703_101689762 | 378 |
| 386 | 3300026041 | Ga0207639_10005685 | Ga0207639_100056853 | 378 |
| 387 | 3300026088 | Ga0207641_10049115 | Ga0207641_100491152 | 378 |
| 388 | 3300026095 | Ga0207676_10022380 | Ga0207676_100223804 | 378 |
| 389 | 3300026095 | Ga0207676_10035276 | Ga0207676_100352763 | 378 |
| 390 | 3300026116 | Ga0207674_10035866 | Ga0207674_100358662 | 378 |
| 391 | 3300026116 | Ga0207674_10173314 | Ga0207674_101733142 | 378 |
| 392 | 3300026118 | Ga0207675_100241923 | Ga0207675_1002419232 | 378 |
| 393 | 3300026118 | Ga0207675_100269956 | Ga0207675_1002699562 | 378 |
| 394 | 3300026121 | Ga0207683_10042766 | Ga0207683_100427663 | 378 |
| 395 | 3300026121 | Ga0207683_10298291 | Ga0207683_102982912 | 378 |
| 396 | 3300028381 | Ga0268264_10054902 | Ga0268264_100549021 | 378 |
| 397 | 3300028800 | Ga0265338_10013547 | Ga0265338_100135473 | 378 |
| 398 | 3300031235 | Ga0265330_10012094 | Ga0265330_100120942 | 378 |
| 399 | 3300031247 | Ga0265340_10008344 | Ga0265340_100083445 | 378 |
| 400 | 3300031249 | Ga0265339_10000054 | Ga0265339_1000005443 | 378 |
| 401 | 3300031595 | Ga0265313_10001832 | Ga0265313_1000183217 | 378 |
| 402 | 3300032002 | Ga0307416_100259201 | Ga0307416_1002592011 | 378 |
| 403 | 3300035086 | Ga0373934_0004863 | Ga0373934_0004863_1330_2481 | 378 |
| 404 | 3300035114 | Ga0373939_0019841 | Ga0373939_0019841_281_1441 | 378 |
| 405 | 3300035115 | Ga0373941_0053487 | Ga0373941_0053487_39_1208 | 378 |
| 406 | 3300035117 | Ga0373953_0015305 | Ga0373953_0015305_1300_2451 | 378 |
| 407 | 3300035118 | Ga0373954_0001810 | Ga0373954_0001810_6419_7570 | 378 |
| 408 | 3300035119 | Ga0373956_0012138 | Ga0373956_0012138_2266_3417 | 378 |
| 409 | 3300035120 | Ga0373957_0008145 | Ga0373957_0008145_898_2049 | 378 |
| 410 | 3300035170 | Ga0373943_0054003 | Ga0373943_0054003_552_1691 | 378 |
| 411 | 3300035172 | Ga0373955_0000357 | Ga0373955_0000357_3698_4849 | 378 |
| 412 | 3300035410 | Ga0373924_0002287 | Ga0373924_0002287_5202_6353 | 378 |
| 413 | 3300035691 | Ga0373931_0008332 | Ga0373931_0008332_702_1847 | 378 |
| 414 | 3300035695 | Ga0373927_0171522 | Ga0373927_0171522_158_1297 | 378 |
| 415 | 3300035724 | Ga0373933_0004421 | Ga0373933_0004421_6418_7569 | 378 |
| 416 | 3300035725 | Ga0373947_0061242 | Ga0373947_0061242_1005_2144 | 378 |
| 417 | 3300036401 | Ga0373937_0004812 | Ga0373937_0004812_3898_5049 | 378 |
| 418 | 3300037068 | Ga0373925_0028146 | Ga0373925_0028146_1833_2969 | 378 |
| 419 | 3300037466 | Ga0395898_0014622 | Ga0395898_0014622_3029_4198 | 378 |
| 420 | 3300039437 | Ga0436365_1369522 | Ga0436365_1369522_21_1166 | 378 |
| 421 | 3300039437 | Ga0436365_1489713 | Ga0436365_1489713_239_1393 | 378 |
| 422 | 3300042125 | Ga0450923_006355 | Ga0450923_006355_460_1608 | 378 |
| 423 | 3300046454 | Ga0495592_0010291 | Ga0495592_0010291_3351_4502 | 378 |
| 424 | 3300046455 | Ga0495603_0016472 | Ga0495603_0016472_1319_2458 | 378 |
| 425 | 3300046457 | Ga0495590_0055695 | Ga0495590_0055695_219_1358 | 378 |
| 426 | 3300046459 | Ga0495629_0005277 | Ga0495629_0005277_2112_3263 | 378 |
| 427 | 3300046462 | Ga0495651_0007674 | Ga0495651_0007674_3224_4375 | 378 |
| 428 | 3300046463 | Ga0495653_0004652 | Ga0495653_0004652_6459_7610 | 378 |
| 429 | 3300046511 | Ga0495608_0005565 | Ga0495608_0005565_6359_7510 | 378 |
| 430 | 3300046514 | Ga0495618_0021032 | Ga0495618_0021032_1995_3146 | 378 |
| 431 | 3300046516 | Ga0495628_0014732 | Ga0495628_0014732_2071_3222 | 378 |
| 432 | 3300046529 | Ga0495652_0027961 | Ga0495652_0027961_465_1616 | 378 |
| 433 | 3300046533 | Ga0495640_0022826 | Ga0495640_0022826_814_1965 | 378 |
| 434 | 3300046543 | Ga0495645_0027819 | Ga0495645_0027819_1036_2187 | 378 |
| 435 | 3300046559 | Ga0495667_0002715 | Ga0495667_0002715_8418_9569 | 378 |
| 436 | 3300046663 | Ga0495635_0007564 | Ga0495635_0007564_3082_4233 | 378 |
| 437 | 3300046663 | Ga0495635_0024285 | Ga0495635_0024285_382_1518 | 378 |
| 438 | 3300046675 | Ga0495657_0015592 | Ga0495657_0015592_3224_4375 | 378 |
| 439 | 3300046678 | Ga0495599_0008026 | Ga0495599_0008026_4967_6118 | 378 |
| 440 | 3300046679 | Ga0495623_0006690 | Ga0495623_0006690_1308_2459 | 378 |
| 441 | 3300046680 | Ga0495646_0004537 | Ga0495646_0004537_750_1901 | 378 |
| 442 | 3300046683 | Ga0495658_0217094 | Ga0495658_0217094_41_1180 | 378 |
| 443 | 3300046689 | Ga0495613_0011001 | Ga0495613_0011001_4760_5911 | 378 |
| 444 | 3300046689 | Ga0495613_0097432 | Ga0495613_0097432_593_1732 | 378 |
| 445 | 3300046809 | Ga0495600_0001425 | Ga0495600_0001425_3669_4820 | 378 |
| 446 | 3300047317 | Ga0495604_0016356 | Ga0495604_0016356_1180_2331 | 378 |
| 447 | 3300047322 | Ga0495680_0011266 | Ga0495680_0011266_3553_4704 | 378 |
| 448 | 3300047471 | Ga0495684_0004699 | Ga0495684_0004699_6397_7548 | 378 |
| 449 | 3300048914 | Ga0496111_0041816 | Ga0496111_0041816_1578_2738 | 378 |
| 450 | 3300048915 | Ga0496112_0106012 | Ga0496112_0106012_819_1979 | 378 |
| 451 | 3300048918 | Ga0496115_0182037 | Ga0496115_0182037_515_1651 | 378 |
| 452 | 3300048919 | Ga0496116_0002755 | Ga0496116_0002755_898_2115 | 378 |
| 453 | 3300048920 | Ga0496117_0048428 | Ga0496117_0048428_1328_2545 | 378 |
| 454 | 3300048929 | Ga0496126_0026035 | Ga0496126_0026035_4461_5600 | 378 |
| 455 | 3300048929 | Ga0496126_0052219 | Ga0496126_0052219_2170_3321 | 378 |
| 456 | 3300049569 | Ga0501032_0088695 | Ga0501032_0088695_301_1443 | 378 |
| 457 | 3300049571 | Ga0501034_0134166 | Ga0501034_0134166_325_1464 | 378 |
| 458 | 3300049574 | Ga0501038_0014878 | Ga0501038_0014878_849_1988 | 378 |
| 459 | 3300049575 | Ga0501039_0203043 | Ga0501039_0203043_191_1333 | 378 |
| 460 | 3300049578 | Ga0501042_0055181 | Ga0501042_0055181_625_1764 | 378 |
| 461 | 3300049581 | Ga0501047_0243819 | Ga0501047_0243819_74_1231 | 378 |
| 462 | 3300049582 | Ga0501048_0001047 | Ga0501048_0001047_7389_8528 | 378 |
| 463 | 3300049583 | Ga0501067_0113005 | Ga0501067_0113005_349_1488 | 378 |
| 464 | 3300049590 | Ga0501074_0013077 | Ga0501074_0013077_2750_3889 | 378 |
| 465 | 3300049592 | Ga0501076_0026991 | Ga0501076_0026991_2430_3569 | 378 |
| 466 | 3300049742 | Ga0501080_0121301 | Ga0501080_0121301_994_2133 | 378 |
| 467 | 3300049744 | Ga0501083_0016513 | Ga0501083_0016513_2274_3413 | 378 |
| 468 | 3300049823 | Ga0501044_0000509 | Ga0501044_0000509_6496_7635 | 378 |
| 469 | 3300050494 | nmdc:mga06z11_73017_c1 | nmdc:mga06z11_73017_c1_439_1581 | 378 |
| 470 | 3300050512 | nmdc:mga0n895_94093_c1 | nmdc:mga0n895_94093_c1_106_1368 | 378 |
| 471 | 3300050516 | nmdc:mga0sz30_75785_c1 | nmdc:mga0sz30_75785_c1_273_1415 | 378 |
| 472 | 3300053077 | Ga0495601_0001764 | Ga0495601_0001764_8536_9687 | 378 |
| 473 | 3300053077 | Ga0495601_0048473 | Ga0495601_0048473_872_2008 | 378 |
| 474 | 3300053084 | Ga0495595_0021713 | Ga0495595_0021713_701_1837 | 378 |
| 475 | 3300053085 | Ga0495619_0003889 | Ga0495619_0003889_2036_3187 | 378 |
| 476 | 3300053085 | Ga0495619_0173034 | Ga0495619_0173034_122_1258 | 378 |
| 477 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_81957_83096 | 378 |
| 478 | 3300054114 | Ga0501084_0097600 | Ga0501084_0097600_838_1977 | 378 |
| 479 | 3300060353 | Ga0501082_0026070 | Ga0501082_0026070_2477_3616 | 378 |
| 480 | iso_pu_bacteria | 2513237141 | 2513890266 | 378 |
| 481 | 3300005328 | Ga0070676_10043602 | Ga0070676_100436023 | 379 |
| 482 | 3300005331 | Ga0070670_100075627 | Ga0070670_1000756272 | 379 |
| 483 | 3300005333 | Ga0070677_10006415 | Ga0070677_100064151 | 379 |
| 484 | 3300005365 | Ga0070688_100101294 | Ga0070688_1001012943 | 379 |
| 485 | 3300005435 | Ga0070714_100091746 | Ga0070714_1000917461 | 379 |
| 486 | 3300005459 | Ga0068867_100019168 | Ga0068867_1000191683 | 379 |
| 487 | 3300005466 | Ga0070685_10105051 | Ga0070685_101050511 | 379 |
| 488 | 3300005530 | Ga0070679_100182565 | Ga0070679_1001825651 | 379 |
| 489 | 3300005543 | Ga0070672_100003393 | Ga0070672_1000033939 | 379 |
| 490 | 3300005981 | Ga0081538_10004768 | Ga0081538_100047689 | 379 |
| 491 | 3300006051 | Ga0075364_10020580 | Ga0075364_100205804 | 379 |
| 492 | 3300006177 | Ga0075362_10003097 | Ga0075362_100030974 | 379 |
| 493 | 3300006178 | Ga0075367_10065950 | Ga0075367_100659503 | 379 |
| 494 | 3300006844 | Ga0075428_100000690 | Ga0075428_10000069030 | 379 |
| 495 | 3300006844 | Ga0075428_100159494 | Ga0075428_1001594943 | 379 |
| 496 | 3300006846 | Ga0075430_100013482 | Ga0075430_1000134827 | 379 |
| 497 | 3300006846 | Ga0075430_100185337 | Ga0075430_1001853372 | 379 |
| 498 | 3300006847 | Ga0075431_100000098 | Ga0075431_10000009832 | 379 |
| 499 | 3300006847 | Ga0075431_100276217 | Ga0075431_1002762172 | 379 |
| 500 | 3300006880 | Ga0075429_100009106 | Ga0075429_1000091062 | 379 |
| 501 | 3300007076 | Ga0075435_100026824 | Ga0075435_1000268242 | 379 |
| 502 | 3300009094 | Ga0111539_10000703 | Ga0111539_1000070338 | 379 |
| 503 | 3300009094 | Ga0111539_10138857 | Ga0111539_101388572 | 379 |
| 504 | 3300009147 | Ga0114129_10000057 | Ga0114129_100000573 | 379 |
| 505 | 3300009147 | Ga0114129_10119075 | Ga0114129_101190753 | 379 |
| 506 | 3300013297 | Ga0157378_10099275 | Ga0157378_100992753 | 379 |
| 507 | 3300013308 | Ga0157375_10236355 | Ga0157375_102363553 | 379 |
| 508 | 3300014326 | Ga0157380_10248157 | Ga0157380_102481572 | 379 |
| 509 | 3300014969 | Ga0157376_10089692 | Ga0157376_100896922 | 379 |
| 510 | 3300025893 | Ga0207682_10001973 | Ga0207682_100019739 | 379 |
| 511 | 3300025903 | Ga0207680_10166839 | Ga0207680_101668391 | 379 |
| 512 | 3300025929 | Ga0207664_10061831 | Ga0207664_100618315 | 379 |
| 513 | 3300025936 | Ga0207670_10054094 | Ga0207670_100540941 | 379 |
| 514 | 3300025940 | Ga0207691_10002047 | Ga0207691_100020471 | 379 |
| 515 | 3300026041 | Ga0207639_10242315 | Ga0207639_102423151 | 379 |
| 516 | 3300026089 | Ga0207648_10016126 | Ga0207648_100161264 | 379 |
| 517 | 3300026121 | Ga0207683_10001331 | Ga0207683_1000133112 | 379 |
| 518 | 3300027907 | Ga0207428_10008746 | Ga0207428_100087467 | 379 |
| 519 | 3300039437 | Ga0436365_0311840 | Ga0436365_0311840_326_1474 | 379 |
| 520 | 3300039437 | Ga0436365_0878170 | Ga0436365_0878170_928_2082 | 379 |
| 521 | 3300046474 | Ga0495605_0123784 | Ga0495605_0123784_19_1158 | 379 |
| 522 | 3300046539 | Ga0495621_0043207 | Ga0495621_0043207_47_1186 | 379 |
| 523 | 3300048090 | Ga0495615_0003085 | Ga0495615_0003085_472_1611 | 379 |
| 524 | 3300048903 | Ga0496100_0063474 | Ga0496100_0063474_1001_2140 | 379 |
| 525 | 3300048907 | Ga0496104_0036217 | Ga0496104_0036217_2747_3892 | 379 |
| 526 | 3300048908 | Ga0496105_0099697 | Ga0496105_0099697_128_1273 | 379 |
| 527 | 3300048910 | Ga0496107_0085708 | Ga0496107_0085708_639_1784 | 379 |
| 528 | 3300048911 | Ga0496108_0105696 | Ga0496108_0105696_1007_2146 | 379 |
| 529 | 3300048913 | Ga0496110_0053328 | Ga0496110_0053328_2059_3204 | 379 |
| 530 | 3300048917 | Ga0496114_0089694 | Ga0496114_0089694_800_1939 | 379 |
| 531 | 3300048918 | Ga0496115_0161066 | Ga0496115_0161066_65_1210 | 379 |
| 532 | 3300049568 | Ga0501031_0019583 | Ga0501031_0019583_710_1852 | 379 |
| 533 | 3300049570 | Ga0501033_0040664 | Ga0501033_0040664_118_1284 | 379 |
| 534 | 3300049570 | Ga0501033_0059678 | Ga0501033_0059678_855_1997 | 379 |
| 535 | 3300049570 | Ga0501033_0083339 | Ga0501033_0083339_30_1223 | 379 |
| 536 | 3300049571 | Ga0501034_0028861 | Ga0501034_0028861_1367_2560 | 379 |
| 537 | 3300049571 | Ga0501034_0078354 | Ga0501034_0078354_1559_2701 | 379 |
| 538 | 3300049571 | Ga0501034_0084059 | Ga0501034_0084059_938_2080 | 379 |
| 539 | 3300049572 | Ga0501036_0049226 | Ga0501036_0049226_1572_2714 | 379 |
| 540 | 3300049572 | Ga0501036_0120535 | Ga0501036_0120535_784_1977 | 379 |
| 541 | 3300049573 | Ga0501037_0067159 | Ga0501037_0067159_275_1417 | 379 |
| 542 | 3300049573 | Ga0501037_0120523 | Ga0501037_0120523_96_1289 | 379 |
| 543 | 3300049574 | Ga0501038_0002943 | Ga0501038_0002943_12837_13979 | 379 |
| 544 | 3300049574 | Ga0501038_0017952 | Ga0501038_0017952_199_1392 | 379 |
| 545 | 3300049575 | Ga0501039_0030956 | Ga0501039_0030956_2707_3849 | 379 |
| 546 | 3300049575 | Ga0501039_0189868 | Ga0501039_0189868_29_1192 | 379 |
| 547 | 3300049579 | Ga0501043_0119338 | Ga0501043_0119338_840_1982 | 379 |
| 548 | 3300049579 | Ga0501043_0197854 | Ga0501043_0197854_246_1439 | 379 |
| 549 | 3300049581 | Ga0501047_0010604 | Ga0501047_0010604_6100_7293 | 379 |
| 550 | 3300049583 | Ga0501067_0051045 | Ga0501067_0051045_691_1884 | 379 |
| 551 | 3300049587 | Ga0501071_0077009 | Ga0501071_0077009_861_2036 | 379 |
| 552 | 3300049588 | Ga0501072_0005296 | Ga0501072_0005296_714_1889 | 379 |
| 553 | 3300049589 | Ga0501073_0121462 | Ga0501073_0121462_412_1605 | 379 |
| 554 | 3300049591 | Ga0501075_0123896 | Ga0501075_0123896_493_1668 | 379 |
| 555 | 3300049742 | Ga0501080_0018950 | Ga0501080_0018950_3746_4939 | 379 |
| 556 | 3300049822 | Ga0501035_0017022 | Ga0501035_0017022_4931_6073 | 379 |
| 557 | 3300049823 | Ga0501044_0008635 | Ga0501044_0008635_9727_10920 | 379 |
| 558 | 3300049823 | Ga0501044_0097349 | Ga0501044_0097349_1704_2870 | 379 |
| 559 | 3300049823 | Ga0501044_0154290 | Ga0501044_0154290_223_1365 | 379 |
| 560 | 3300050489 | nmdc:mga03683_3554_c1 | nmdc:mga03683_3554_c1_2563_3723 | 379 |
| 561 | 3300050493 | nmdc:mga0k408_66566_c1 | nmdc:mga0k408_66566_c1_532_1692 | 379 |
| 562 | 3300050507 | nmdc:mga05p37_2362_c1 | nmdc:mga05p37_2362_c1_14520_15659 | 379 |
| 563 | 3300050507 | nmdc:mga05p37_45624_c1 | nmdc:mga05p37_45624_c1_1949_3091 | 379 |
| 564 | 3300050508 | nmdc:mga09592_16449_c1 | nmdc:mga09592_16449_c1_4705_5844 | 379 |
| 565 | 3300050509 | nmdc:mga0qj67_7709_c1 | nmdc:mga0qj67_7709_c1_19_1158 | 379 |
| 566 | 3300050510 | nmdc:mga06r32_1530_c1 | nmdc:mga06r32_1530_c1_17577_18716 | 379 |
| 567 | 3300050511 | nmdc:mga08y16_1107_c1 | nmdc:mga08y16_1107_c1_20704_21843 | 379 |
| 568 | 3300050511 | nmdc:mga08y16_114383_c1 | nmdc:mga08y16_114383_c1_221_1360 | 379 |
| 569 | 3300050512 | nmdc:mga0n895_20390_c1 | nmdc:mga0n895_20390_c1_2055_3194 | 379 |
| 570 | 3300050513 | nmdc:mga0rr50_104447_c1 | nmdc:mga0rr50_104447_c1_274_1413 | 379 |
| 571 | 3300050515 | nmdc:mga0a205_23199_c1 | nmdc:mga0a205_23199_c1_1082_2221 | 379 |
| 572 | 3300053085 | Ga0495619_0083293 | Ga0495619_0083293_608_1747 | 379 |
| 573 | 3300003203 | JGI25406J46586_10007117 | JGI25406J46586_100071171 | 380 |
| 574 | 3300005330 | Ga0070690_100129472 | Ga0070690_1001294721 | 380 |
| 575 | 3300005340 | Ga0070689_100015423 | Ga0070689_1000154231 | 380 |
| 576 | 3300005343 | Ga0070687_100021537 | Ga0070687_1000215373 | 380 |
| 577 | 3300005344 | Ga0070661_100129529 | Ga0070661_1001295292 | 380 |
| 578 | 3300005365 | Ga0070688_100090839 | Ga0070688_1000908392 | 380 |
| 579 | 3300005434 | Ga0070709_10004047 | Ga0070709_100040473 | 380 |
| 580 | 3300005436 | Ga0070713_100034533 | Ga0070713_1000345332 | 380 |
| 581 | 3300005436 | Ga0070713_100146154 | Ga0070713_1001461541 | 380 |
| 582 | 3300005437 | Ga0070710_10012502 | Ga0070710_100125022 | 380 |
| 583 | 3300005439 | Ga0070711_100038994 | Ga0070711_1000389942 | 380 |
| 584 | 3300005457 | Ga0070662_100020173 | Ga0070662_1000201732 | 380 |
| 585 | 3300005564 | Ga0070664_100026016 | Ga0070664_1000260163 | 380 |
| 586 | 3300005615 | Ga0070702_100058593 | Ga0070702_1000585933 | 380 |
| 587 | 3300005842 | Ga0068858_100208551 | Ga0068858_1002085512 | 380 |
| 588 | 3300005937 | Ga0081455_10003898 | Ga0081455_100038989 | 380 |
| 589 | 3300005981 | Ga0081538_10051010 | Ga0081538_100510102 | 380 |
| 590 | 3300005983 | Ga0081540_1000105 | Ga0081540_100010578 | 380 |
| 591 | 3300005983 | Ga0081540_1001881 | Ga0081540_100188111 | 380 |
| 592 | 3300005983 | Ga0081540_1007650 | Ga0081540_10076505 | 380 |
| 593 | 3300005985 | Ga0081539_10000891 | Ga0081539_100008911 | 380 |
| 594 | 3300006028 | Ga0070717_10048077 | Ga0070717_100480772 | 380 |
| 595 | 3300006042 | Ga0075368_10021774 | Ga0075368_100217742 | 380 |
| 596 | 3300006048 | Ga0075363_100060200 | Ga0075363_1000602002 | 380 |
| 597 | 3300006048 | Ga0075363_100116589 | Ga0075363_1001165891 | 380 |
| 598 | 3300006051 | Ga0075364_10112960 | Ga0075364_101129601 | 380 |
| 599 | 3300006163 | Ga0070715_10005445 | Ga0070715_100054452 | 380 |
| 600 | 3300006173 | Ga0070716_100014992 | Ga0070716_1000149923 | 380 |
| 601 | 3300006175 | Ga0070712_100004767 | Ga0070712_1000047672 | 380 |
| 602 | 3300006178 | Ga0075367_10026837 | Ga0075367_100268372 | 380 |
| 603 | 3300006353 | Ga0075370_10066134 | Ga0075370_100661342 | 380 |
| 604 | 3300006844 | Ga0075428_100019356 | Ga0075428_1000193563 | 380 |
| 605 | 3300006846 | Ga0075430_100001644 | Ga0075430_1000016442 | 380 |
| 606 | 3300006847 | Ga0075431_100005461 | Ga0075431_1000054614 | 380 |
| 607 | 3300006847 | Ga0075431_100343066 | Ga0075431_1003430661 | 380 |
| 608 | 3300006871 | Ga0075434_100106958 | Ga0075434_1001069582 | 380 |
| 609 | 3300006914 | Ga0075436_100051103 | Ga0075436_1000511032 | 380 |
| 610 | 3300006914 | Ga0075436_100217860 | Ga0075436_1002178601 | 380 |
| 611 | 3300007076 | Ga0075435_100047016 | Ga0075435_1000470161 | 380 |
| 612 | 3300007265 | Ga0099794_10027936 | Ga0099794_100279362 | 380 |
| 613 | 3300007788 | Ga0099795_10035914 | Ga0099795_100359142 | 380 |
| 614 | 3300009094 | Ga0111539_10068500 | Ga0111539_100685002 | 380 |
| 615 | 3300009098 | Ga0105245_10053403 | Ga0105245_100534032 | 380 |
| 616 | 3300009147 | Ga0114129_10003135 | Ga0114129_100031354 | 380 |
| 617 | 3300009553 | Ga0105249_10128236 | Ga0105249_101282362 | 380 |
| 618 | 3300010159 | Ga0099796_10001780 | Ga0099796_100017802 | 380 |
| 619 | 3300025898 | Ga0207692_10007136 | Ga0207692_100071362 | 380 |
| 620 | 3300025905 | Ga0207685_10017067 | Ga0207685_100170672 | 380 |
| 621 | 3300025906 | Ga0207699_10052503 | Ga0207699_100525032 | 380 |
| 622 | 3300025915 | Ga0207693_10010902 | Ga0207693_100109024 | 380 |
| 623 | 3300025916 | Ga0207663_10127641 | Ga0207663_101276411 | 380 |
| 624 | 3300025918 | Ga0207662_10005064 | Ga0207662_100050641 | 380 |
| 625 | 3300025920 | Ga0207649_10074669 | Ga0207649_100746691 | 380 |
| 626 | 3300025921 | Ga0207652_10050604 | Ga0207652_100506042 | 380 |
| 627 | 3300025927 | Ga0207687_10070089 | Ga0207687_100700892 | 380 |
| 628 | 3300025928 | Ga0207700_10148972 | Ga0207700_101489722 | 380 |
| 629 | 3300025933 | Ga0207706_10047931 | Ga0207706_100479313 | 380 |
| 630 | 3300025936 | Ga0207670_10013413 | Ga0207670_100134133 | 380 |
| 631 | 3300025939 | Ga0207665_10001716 | Ga0207665_1000171612 | 380 |
| 632 | 3300025945 | Ga0207679_10030219 | Ga0207679_100302191 | 380 |
| 633 | 3300025961 | Ga0207712_10093383 | Ga0207712_100933832 | 380 |
| 634 | 3300026035 | Ga0207703_10245897 | Ga0207703_102458972 | 380 |
| 635 | 3300027512 | Ga0209179_1005067 | Ga0209179_10050671 | 380 |
| 636 | 3300027907 | Ga0207428_10066812 | Ga0207428_100668123 | 380 |
| 637 | 3300031235 | Ga0265330_10015445 | Ga0265330_100154454 | 380 |
| 638 | 3300031238 | Ga0265332_10001857 | Ga0265332_100018575 | 380 |
| 639 | 3300031241 | Ga0265325_10012217 | Ga0265325_100122174 | 380 |
| 640 | 3300031241 | Ga0265325_10078671 | Ga0265325_100786712 | 380 |
| 641 | 3300031242 | Ga0265329_10004050 | Ga0265329_100040503 | 380 |
| 642 | 3300031242 | Ga0265329_10023902 | Ga0265329_100239022 | 380 |
| 643 | 3300031247 | Ga0265340_10006014 | Ga0265340_100060147 | 380 |
| 644 | 3300031247 | Ga0265340_10010587 | Ga0265340_100105873 | 380 |
| 645 | 3300031249 | Ga0265339_10005140 | Ga0265339_100051403 | 380 |
| 646 | 3300031249 | Ga0265339_10016311 | Ga0265339_100163113 | 380 |
| 647 | 3300031250 | Ga0265331_10007501 | Ga0265331_100075012 | 380 |
| 648 | 3300031250 | Ga0265331_10016215 | Ga0265331_100162154 | 380 |
| 649 | 3300031344 | Ga0265316_10221080 | Ga0265316_102210802 | 380 |
| 650 | 3300031595 | Ga0265313_10005086 | Ga0265313_100050864 | 380 |
| 651 | 3300031711 | Ga0265314_10008808 | Ga0265314_100088084 | 380 |
| 652 | 3300031712 | Ga0265342_10000092 | Ga0265342_1000009274 | 380 |
| 653 | 3300031712 | Ga0265342_10004949 | Ga0265342_100049498 | 380 |
| 654 | 3300031712 | Ga0265342_10006461 | Ga0265342_1000646110 | 380 |
| 655 | 3300035086 | Ga0373934_0027427 | Ga0373934_0027427_172_1323 | 380 |
| 656 | 3300035120 | Ga0373957_0053391 | Ga0373957_0053391_242_1393 | 380 |
| 657 | 3300035172 | Ga0373955_0081238 | Ga0373955_0081238_506_1657 | 380 |
| 658 | 3300035692 | Ga0373935_0074012 | Ga0373935_0074012_814_1965 | 380 |
| 659 | 3300035724 | Ga0373933_0028802 | Ga0373933_0028802_275_1426 | 380 |
| 660 | 3300036401 | Ga0373937_0001589 | Ga0373937_0001589_16666_17817 | 380 |
| 661 | 3300037418 | Ga0395900_0226783 | Ga0395900_0226783_663_1805 | 380 |
| 662 | 3300037466 | Ga0395898_0063937 | Ga0395898_0063937_424_1566 | 380 |
| 663 | 3300039437 | Ga0436365_0505017 | Ga0436365_0505017_2737_3882 | 380 |
| 664 | 3300039450 | Ga0436363_0640332 | Ga0436363_0640332_1489_2742 | 380 |
| 665 | 3300041408 | Ga0439453_0003561 | Ga0439453_0003561_234_1394 | 380 |
| 666 | 3300041413 | Ga0439465_0033510 | Ga0439465_0033510_435_1595 | 380 |
| 667 | 3300042436 | Ga0439435_0001109 | Ga0439435_0001109_134_1294 | 380 |
| 668 | 3300046460 | Ga0495638_0023817 | Ga0495638_0023817_299_1459 | 380 |
| 669 | 3300047320 | Ga0495672_0124407 | Ga0495672_0124407_104_1264 | 380 |
| 670 | 3300048904 | Ga0496101_0100185 | Ga0496101_0100185_618_1796 | 380 |
| 671 | 3300048917 | Ga0496114_0204612 | Ga0496114_0204612_411_1583 | 380 |
| 672 | 3300048918 | Ga0496115_0031238 | Ga0496115_0031238_2970_4142 | 380 |
| 673 | 3300048922 | Ga0496119_0006427 | Ga0496119_0006427_123_1283 | 380 |
| 674 | 3300048925 | Ga0496122_0013338 | Ga0496122_0013338_3064_4224 | 380 |
| 675 | 3300048926 | Ga0496123_0020995 | Ga0496123_0020995_3725_4885 | 380 |
| 676 | 3300049589 | Ga0501073_0149721 | Ga0501073_0149721_435_1577 | 380 |
| 677 | 3300049591 | Ga0501075_0113910 | Ga0501075_0113910_582_1730 | 380 |
| 678 | 3300049592 | Ga0501076_0045805 | Ga0501076_0045805_615_1763 | 380 |
| 679 | 3300049744 | Ga0501083_0057189 | Ga0501083_0057189_715_1857 | 380 |
| 680 | 3300049744 | Ga0501083_0144294 | Ga0501083_0144294_261_1403 | 380 |
| 681 | 3300050489 | nmdc:mga03683_25739_c1 | nmdc:mga03683_25739_c1_588_1730 | 380 |
| 682 | 3300050507 | nmdc:mga05p37_29385_c1 | nmdc:mga05p37_29385_c1_2018_3172 | 380 |
| 683 | 3300050509 | nmdc:mga0qj67_471_c1 | nmdc:mga0qj67_471_c1_396_1538 | 380 |
| 684 | 3300050510 | nmdc:mga06r32_318279_c1 | nmdc:mga06r32_318279_c1_213_1355 | 380 |
| 685 | 3300050510 | nmdc:mga06r32_6629_c1 | nmdc:mga06r32_6629_c1_5596_6774 | 380 |
| 686 | 3300050512 | nmdc:mga0n895_21450_c1 | nmdc:mga0n895_21450_c1_4290_5474 | 380 |
| 687 | 3300050514 | nmdc:mga08x19_47330_c1 | nmdc:mga08x19_47330_c1_524_1702 | 380 |
| 688 | 3300050514 | nmdc:mga08x19_59405_c1 | nmdc:mga08x19_59405_c1_539_1723 | 380 |
| 689 | 3300050515 | nmdc:mga0a205_70803_c1 | nmdc:mga0a205_70803_c1_341_1519 | 380 |
| 690 | 3300053077 | Ga0495601_0128438 | Ga0495601_0128438_40_1188 | 380 |
| 691 | 3300053104 | Ga0500556_0000124 | Ga0500556_0000124_9522_10682 | 380 |
| 692 | 3300053134 | Ga0500658_0091701 | Ga0500658_0091701_16_1158 | 380 |
| 693 | 3300053153 | Ga0500616_0016164 | Ga0500616_0016164_337_1479 | 380 |
| 694 | 3300053153 | Ga0500616_0018268 | Ga0500616_0018268_1920_3062 | 380 |
| 695 | 3300053153 | Ga0500616_0111902 | Ga0500616_0111902_116_1258 | 380 |
| 696 | 3300054114 | Ga0501084_0315008 | Ga0501084_0315008_134_1282 | 380 |
| 697 | 3300060353 | Ga0501082_0004415 | Ga0501082_0004415_6880_8022 | 380 |
| 698 | 3300060353 | Ga0501082_0063753 | Ga0501082_0063753_1099_2247 | 380 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z69-assembly1.cif.gz_B | structure of the recombination mediator protein recf-atprs in recfor pathway | 0.893 | 2 | 380 |
| 5z69-assembly1.cif.gz_B | structure of the recombination mediator protein recf-atprs in recfor pathway | 0.8817 | 2 | 380 |
| 5z68-assembly2.cif.gz_D | structure of the recombination mediator protein recf-atp in recfor pathway | 0.8739 | 1 | 379 |
| 5z68-assembly1.cif.gz_B | structure of the recombination mediator protein recf-atp in recfor pathway | 0.8721 | 1 | 380 |
| 5z68-assembly2.cif.gz_D | structure of the recombination mediator protein recf-atp in recfor pathway | 0.8717 | 1 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A7H0_3_104_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8864 | 7 | 114 | 3.40.50.300 |
| af_P0A7H0_3_104_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8705 | 7 | 114 | 3.40.50.300 |
| af_Q2G275_4_97_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8668 | 8 | 106 | 3.40.50.300 |
| af_Q2G275_4_97_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.85 | 8 | 106 | 3.40.50.300 |
| af_P0A7H0_121_296_1.20.1050.90 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;RecF/RecN/SMC, N-terminal domain | 0.8311 | 132 | 316 | 1.20.1050.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B8LV32-F1-model_v4 | deleted | 0.9861 | 2 | 379 |
|
| AF-A0A537XLI0-F1-model_v4 | DNA replication and repair protein RecF | 0.9843 | 154 | 380 |
GO:0000731
GO:0003697 GO:0005524 GO:0005737 GO:0006260 GO:0006302 GO:0016887 |
| AF-A0A327KX86-F1-model_v4 | DNA replication and repair protein RecF | 0.9804 | 1 | 380 |
GO:0000731
GO:0003697 GO:0005524 GO:0005737 GO:0006260 GO:0006302 GO:0009432 |
| AF-B6R5S7-F1-model_v4 | deleted | 0.9803 | 3 | 379 |
|
| AF-A0A537XLI0-F1-model_v4 | DNA replication and repair protein RecF | 0.98 | 154 | 380 |
GO:0000731
GO:0003697 GO:0005524 GO:0005737 GO:0006260 GO:0006302 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar