F475987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 349 | 689 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0023500|Ga0501072_0023500_2579_3355 |
| Length | 258 |
| Sequence | VNATVGQGRVDLRNRLTAPNPAFHFSFILRRSLWCEDEVKMASLIRRGLRREGIAADVAIKGEDALWMAEATEYDAIVLDLMLPGIDGLEVCRRLRAEGVWSPILMLTARDAVRDRVAGLDGGADDYVTKPFSYAELLARLRALVRRGPAERPTQLEVGDLRLDPATRRVWRDDTEIELSAKEFAILEIFMRRAGEVLSRFQLLEHAWDYDYENRSNVVDSYVRFLRRKIDKPFGVESIETVRGAGYRLRDDGGGRES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 2 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 3 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 4 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 146 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 171 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 174 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 175 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 176 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 177 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 178 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 270 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 321 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 322 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 323 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 324 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 325 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 326 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 327 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 328 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 332 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 334 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 335 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 340 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 345 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 346 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 347 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 348 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 349 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.57 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.44 |
| Nodule | 0 |
| Rhizoplane | 5.3 |
| Rhizosphere | 82.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10016300 | 3300003203 | Bacteria | 3101 |
| 2 | Ga0065712_10134679 | 3300005290 | Bacteria | 1487 |
| 3 | Ga0070658_10167205 | 3300005327 | Bacteria | 1847 |
| 4 | Ga0070683_100001023 | 3300005329 | Bacteria | 20987 |
| 5 | Ga0070683_100426284 | 3300005329 | Bacteria | 1266 |
| 6 | Ga0070690_100220633 | 3300005330 | Bacteria | 1328 |
| 7 | Ga0068869_100055969 | 3300005334 | Bacteria | 2875 |
| 8 | Ga0070680_100167508 | 3300005336 | Bacteria | 1848 |
| 9 | Ga0070682_100124198 | 3300005337 | Bacteria | 1737 |
| 10 | Ga0068868_100030488 | 3300005338 | Bacteria | 4136 |
| 11 | Ga0070668_100326753 | 3300005347 | Bacteria | 1292 |
| 12 | Ga0070669_100120823 | 3300005353 | Bacteria | 1998 |
| 13 | Ga0070669_100475705 | 3300005353 | Bacteria | 1033 |
| 14 | Ga0070674_100280002 | 3300005356 | Bacteria | 1321 |
| 15 | Ga0070673_100579406 | 3300005364 | Bacteria | 1022 |
| 16 | Ga0070659_100145991 | 3300005366 | Bacteria | 1927 |
| 17 | Ga0070667_100000223 | 3300005367 | Bacteria | 65543 |
| 18 | Ga0070709_10263492 | 3300005434 | Bacteria | 1246 |
| 19 | Ga0070714_100177698 | 3300005435 | Bacteria | 1935 |
| 20 | Ga0070713_100873452 | 3300005436 | Bacteria | 864 |
| 21 | Ga0070701_10072885 | 3300005438 | Bacteria | 1840 |
| 22 | Ga0070705_100096968 | 3300005440 | Bacteria | 1852 |
| 23 | Ga0070700_100168651 | 3300005441 | Bacteria | 1514 |
| 24 | Ga0070694_100018986 | 3300005444 | Bacteria | 4369 |
| 25 | Ga0070708_100364018 | 3300005445 | Bacteria | 1363 |
| 26 | Ga0070663_100406052 | 3300005455 | Bacteria | 1115 |
| 27 | Ga0070663_100497112 | 3300005455 | Bacteria | 1012 |
| 28 | Ga0070678_100088450 | 3300005456 | Bacteria | 2368 |
| 29 | Ga0070678_100174377 | 3300005456 | Bacteria | 1754 |
| 30 | Ga0070662_100279092 | 3300005457 | Bacteria | 1352 |
| 31 | Ga0070681_10039140 | 3300005458 | Bacteria | 4753 |
| 32 | Ga0068867_100158097 | 3300005459 | Bacteria | 1785 |
| 33 | Ga0070698_100000518 | 3300005471 | Bacteria | 41042 |
| 34 | Ga0070698_100011475 | 3300005471 | Bacteria | 9402 |
| 35 | Ga0070698_100128964 | 3300005471 | Bacteria | 2485 |
| 36 | Ga0070699_100003005 | 3300005518 | Bacteria | 14987 |
| 37 | Ga0070699_100756683 | 3300005518 | Bacteria | 889 |
| 38 | Ga0070679_100150861 | 3300005530 | Bacteria | 2301 |
| 39 | Ga0070684_100150171 | 3300005535 | Bacteria | 2110 |
| 40 | Ga0070684_100452029 | 3300005535 | Bacteria | 1187 |
| 41 | Ga0070684_100631378 | 3300005535 | Bacteria | 997 |
| 42 | Ga0070697_100110630 | 3300005536 | Bacteria | 2289 |
| 43 | Ga0070697_100274165 | 3300005536 | Bacteria | 1446 |
| 44 | Ga0070686_100002743 | 3300005544 | Bacteria | 9696 |
| 45 | Ga0070686_100070463 | 3300005544 | Bacteria | 2286 |
| 46 | Ga0070696_100081602 | 3300005546 | Bacteria | 2291 |
| 47 | Ga0070665_100005604 | 3300005548 | Bacteria | 12910 |
| 48 | Ga0070665_100309521 | 3300005548 | Bacteria | 1583 |
| 49 | Ga0070704_100077141 | 3300005549 | Bacteria | 2440 |
| 50 | Ga0070704_100110388 | 3300005549 | Bacteria | 2092 |
| 51 | Ga0070664_100475507 | 3300005564 | Bacteria | 1149 |
| 52 | Ga0068856_100197319 | 3300005614 | Bacteria | 2027 |
| 53 | Ga0068856_100913195 | 3300005614 | Bacteria | 897 |
| 54 | Ga0070702_100308501 | 3300005615 | Bacteria | 1098 |
| 55 | Ga0068852_100068387 | 3300005616 | Bacteria | 3108 |
| 56 | Ga0068852_100920085 | 3300005616 | Bacteria | 892 |
| 57 | Ga0068859_100000174 | 3300005617 | Bacteria | 62740 |
| 58 | Ga0068859_100254743 | 3300005617 | Bacteria | 1846 |
| 59 | Ga0068859_100308206 | 3300005617 | Bacteria | 1677 |
| 60 | Ga0068859_100568932 | 3300005617 | Bacteria | 1227 |
| 61 | Ga0068864_100333323 | 3300005618 | Bacteria | 1428 |
| 62 | Ga0068861_100458385 | 3300005719 | Bacteria | 1144 |
| 63 | Ga0068870_10069329 | 3300005840 | Bacteria | 1918 |
| 64 | Ga0068863_100032761 | 3300005841 | Bacteria | 4951 |
| 65 | Ga0068863_100848734 | 3300005841 | Bacteria | 912 |
| 66 | Ga0068858_100003020 | 3300005842 | Bacteria | 16880 |
| 67 | Ga0068858_100765347 | 3300005842 | Bacteria | 941 |
| 68 | Ga0068860_100000044 | 3300005843 | Bacteria | 225595 |
| 69 | Ga0068862_100000003 | 3300005844 | Bacteria | 369793 |
| 70 | Ga0068862_100188980 | 3300005844 | Bacteria | 1852 |
| 71 | Ga0081455_10048160 | 3300005937 | Bacteria | 3685 |
| 72 | Ga0081455_10052144 | 3300005937 | Bacteria | 3504 |
| 73 | Ga0081455_10085651 | 3300005937 | Bacteria | 2569 |
| 74 | Ga0081455_10087914 | 3300005937 | Bacteria | 2527 |
| 75 | Ga0081455_10217123 | 3300005937 | Bacteria | 1420 |
| 76 | Ga0081538_10000058 | 3300005981 | Bacteria | 102121 |
| 77 | Ga0081538_10000068 | 3300005981 | Bacteria | 97659 |
| 78 | Ga0081538_10009031 | 3300005981 | Bacteria | 8371 |
| 79 | Ga0081538_10045943 | 3300005981 | Bacteria | 2701 |
| 80 | Ga0081538_10058172 | 3300005981 | Bacteria | 2245 |
| 81 | Ga0081538_10089618 | 3300005981 | Bacteria | 1596 |
| 82 | Ga0081540_1008210 | 3300005983 | Bacteria | 7311 |
| 83 | Ga0081540_1123603 | 3300005983 | Bacteria | 1069 |
| 84 | Ga0081539_10000062 | 3300005985 | Bacteria | 249871 |
| 85 | Ga0081539_10003738 | 3300005985 | Bacteria | 18103 |
| 86 | Ga0081539_10076839 | 3300005985 | Bacteria | 1768 |
| 87 | Ga0075365_10001599 | 3300006038 | Bacteria | 10423 |
| 88 | Ga0075365_10004931 | 3300006038 | Bacteria | 7139 |
| 89 | Ga0075364_10025626 | 3300006051 | Bacteria | 3754 |
| 90 | Ga0075432_10001916 | 3300006058 | Bacteria | 6895 |
| 91 | Ga0070715_10050541 | 3300006163 | Bacteria | 1785 |
| 92 | Ga0070716_100019767 | 3300006173 | Bacteria | 3525 |
| 93 | Ga0070716_100026506 | 3300006173 | Bacteria | 3105 |
| 94 | Ga0070712_100004298 | 3300006175 | Bacteria | 8773 |
| 95 | Ga0070712_100144546 | 3300006175 | Bacteria | 1819 |
| 96 | Ga0070712_100252379 | 3300006175 | Bacteria | 1410 |
| 97 | Ga0075427_10010851 | 3300006194 | Bacteria | 1368 |
| 98 | Ga0097621_100254557 | 3300006237 | Bacteria | 1539 |
| 99 | Ga0075428_100166500 | 3300006844 | Bacteria | 2391 |
| 100 | Ga0075428_100203234 | 3300006844 | Bacteria | 2141 |
| 101 | Ga0075430_100017770 | 3300006846 | Bacteria | 6054 |
| 102 | Ga0075431_100035185 | 3300006847 | Bacteria | 5157 |
| 103 | Ga0075431_100091392 | 3300006847 | Bacteria | 3142 |
| 104 | Ga0075431_100137307 | 3300006847 | Bacteria | 2521 |
| 105 | Ga0075431_100245311 | 3300006847 | Bacteria | 1821 |
| 106 | Ga0075433_10000057 | 3300006852 | Bacteria | 48581 |
| 107 | Ga0075433_10000692 | 3300006852 | Bacteria | 22971 |
| 108 | Ga0075433_10000817 | 3300006852 | Bacteria | 21667 |
| 109 | Ga0075433_10060813 | 3300006852 | Bacteria | 3308 |
| 110 | Ga0075433_10073546 | 3300006852 | Bacteria | 3006 |
| 111 | Ga0075433_10677539 | 3300006852 | Bacteria | 904 |
| 112 | Ga0075434_100000070 | 3300006871 | Bacteria | 53323 |
| 113 | Ga0075434_100001271 | 3300006871 | Bacteria | 21016 |
| 114 | Ga0075434_100016441 | 3300006871 | Bacteria | 7112 |
| 115 | Ga0075434_100041745 | 3300006871 | Bacteria | 4545 |
| 116 | Ga0075434_100227155 | 3300006871 | Bacteria | 1886 |
| 117 | Ga0075434_100313659 | 3300006871 | Bacteria | 1588 |
| 118 | Ga0075429_100000551 | 3300006880 | Bacteria | 28615 |
| 119 | Ga0075429_100269171 | 3300006880 | Bacteria | 1492 |
| 120 | Ga0075436_100009326 | 3300006914 | Bacteria | 6712 |
| 121 | Ga0075436_100274265 | 3300006914 | Bacteria | 1205 |
| 122 | Ga0097620_100000174 | 3300006931 | Bacteria | 62740 |
| 123 | Ga0097620_100254750 | 3300006931 | Bacteria | 1846 |
| 124 | Ga0097620_100308234 | 3300006931 | Bacteria | 1677 |
| 125 | Ga0097620_100568864 | 3300006931 | Bacteria | 1227 |
| 126 | Ga0075435_100003936 | 3300007076 | Bacteria | 10154 |
| 127 | Ga0075435_100128729 | 3300007076 | Bacteria | 2117 |
| 128 | Ga0075435_100147833 | 3300007076 | Bacteria | 1974 |
| 129 | Ga0075435_100161829 | 3300007076 | Bacteria | 1885 |
| 130 | Ga0105240_10003784 | 3300009093 | Bacteria | 23373 |
| 131 | Ga0111539_10006167 | 3300009094 | Bacteria | 15472 |
| 132 | Ga0111539_10043947 | 3300009094 | Bacteria | 5354 |
| 133 | Ga0111539_10194210 | 3300009094 | Bacteria | 2368 |
| 134 | Ga0111539_10960808 | 3300009094 | Bacteria | 993 |
| 135 | Ga0111539_11308523 | 3300009094 | Bacteria | 841 |
| 136 | Ga0105245_10256364 | 3300009098 | Bacteria | 1701 |
| 137 | Ga0105245_10473949 | 3300009098 | Bacteria | 1264 |
| 138 | Ga0105247_10000006 | 3300009101 | Bacteria | 416061 |
| 139 | Ga0105247_10564892 | 3300009101 | Bacteria | 838 |
| 140 | Ga0105247_10705981 | 3300009101 | Bacteria | 760 |
| 141 | Ga0114129_10003427 | 3300009147 | Bacteria | 22298 |
| 142 | Ga0114129_10020642 | 3300009147 | Bacteria | 9366 |
| 143 | Ga0114129_10039391 | 3300009147 | Bacteria | 6662 |
| 144 | Ga0114129_10056028 | 3300009147 | Bacteria | 5524 |
| 145 | Ga0114129_10162497 | 3300009147 | Bacteria | 3049 |
| 146 | Ga0114129_10177752 | 3300009147 | Bacteria | 2898 |
| 147 | Ga0114129_10191292 | 3300009147 | Bacteria | 2778 |
| 148 | Ga0114129_10463333 | 3300009147 | Bacteria | 1661 |
| 149 | Ga0114129_10621532 | 3300009147 | Bacteria | 1397 |
| 150 | Ga0105248_10000042 | 3300009177 | Bacteria | 167583 |
| 151 | Ga0105237_10003213 | 3300009545 | Bacteria | 19575 |
| 152 | Ga0105238_10139425 | 3300009551 | Bacteria | 2402 |
| 153 | Ga0105249_10000008 | 3300009553 | Bacteria | 341271 |
| 154 | Ga0105249_10042148 | 3300009553 | Bacteria | 4150 |
| 155 | Ga0105239_10002098 | 3300010375 | Bacteria | 25810 |
| 156 | Ga0105239_10264408 | 3300010375 | Bacteria | 1934 |
| 157 | Ga0105239_10686263 | 3300010375 | Bacteria | 1171 |
| 158 | Ga0105246_10698399 | 3300011119 | Bacteria | 889 |
| 159 | Ga0105246_10926369 | 3300011119 | Bacteria | 783 |
| 160 | Ga0157373_10589954 | 3300013100 | Bacteria | 808 |
| 161 | Ga0157369_10652771 | 3300013105 | Bacteria | 1085 |
| 162 | Ga0157374_10911282 | 3300013296 | Bacteria | 897 |
| 163 | Ga0157378_10115802 | 3300013297 | Bacteria | 2464 |
| 164 | Ga0163162_10075007 | 3300013306 | Bacteria | 3442 |
| 165 | Ga0163162_10748547 | 3300013306 | Bacteria | 1097 |
| 166 | Ga0157372_10102699 | 3300013307 | Bacteria | 3266 |
| 167 | Ga0157372_10493931 | 3300013307 | Bacteria | 1427 |
| 168 | Ga0157375_10085668 | 3300013308 | Bacteria | 3201 |
| 169 | Ga0157375_10607816 | 3300013308 | Bacteria | 1252 |
| 170 | Ga0163163_10026112 | 3300014325 | Bacteria | 5578 |
| 171 | Ga0163163_10539231 | 3300014325 | Bacteria | 1229 |
| 172 | Ga0157377_10281418 | 3300014745 | Bacteria | 1090 |
| 173 | Ga0157379_10064509 | 3300014968 | Bacteria | 3273 |
| 174 | Ga0157379_10091350 | 3300014968 | Bacteria | 2731 |
| 175 | Ga0157379_10098519 | 3300014968 | Bacteria | 2624 |
| 176 | Ga0157376_10807614 | 3300014969 | Bacteria | 951 |
| 177 | Ga0213874_10149487 | 3300021377 | Bacteria | 814 |
| 178 | Ga0213876_10002484 | 3300021384 | Bacteria | 10824 |
| 179 | Ga0213876_10008534 | 3300021384 | Bacteria | 5547 |
| 180 | Ga0213875_10010077 | 3300021388 | Bacteria | 4749 |
| 181 | Ga0224712_10151098 | 3300022467 | Bacteria | 1029 |
| 182 | Ga0207710_10000025 | 3300025900 | Bacteria | 314658 |
| 183 | Ga0207688_10026271 | 3300025901 | Bacteria | 3201 |
| 184 | Ga0207688_10032083 | 3300025901 | Bacteria | 2902 |
| 185 | Ga0207685_10017601 | 3300025905 | Bacteria | 2315 |
| 186 | Ga0207699_10068340 | 3300025906 | Bacteria | 2163 |
| 187 | Ga0207705_10148417 | 3300025909 | Bacteria | 1755 |
| 188 | Ga0207707_10080111 | 3300025912 | Bacteria | 2851 |
| 189 | Ga0207695_10021148 | 3300025913 | Bacteria | 7432 |
| 190 | Ga0207671_10254159 | 3300025914 | Bacteria | 1382 |
| 191 | Ga0207693_10003509 | 3300025915 | Bacteria | 13395 |
| 192 | Ga0207663_10020210 | 3300025916 | Bacteria | 3768 |
| 193 | Ga0207660_10089411 | 3300025917 | Bacteria | 2280 |
| 194 | Ga0207662_10395429 | 3300025918 | Bacteria | 936 |
| 195 | Ga0207657_10471073 | 3300025919 | Bacteria | 985 |
| 196 | Ga0207649_10189872 | 3300025920 | Bacteria | 1444 |
| 197 | Ga0207652_10063291 | 3300025921 | Bacteria | 3199 |
| 198 | Ga0207646_10029718 | 3300025922 | Bacteria | 4963 |
| 199 | Ga0207681_10003522 | 3300025923 | Bacteria | 9749 |
| 200 | Ga0207681_10039925 | 3300025923 | Bacteria | 3120 |
| 201 | Ga0207694_10038810 | 3300025924 | Bacteria | 3662 |
| 202 | Ga0207700_10536007 | 3300025928 | Bacteria | 1038 |
| 203 | Ga0207690_10140429 | 3300025932 | Bacteria | 1779 |
| 204 | Ga0207706_10755230 | 3300025933 | Bacteria | 828 |
| 205 | Ga0207709_10337115 | 3300025935 | Bacteria | 1134 |
| 206 | Ga0207670_10785840 | 3300025936 | Bacteria | 792 |
| 207 | Ga0207665_10002519 | 3300025939 | Bacteria | 12318 |
| 208 | Ga0207691_10121496 | 3300025940 | Bacteria | 2314 |
| 209 | Ga0207711_10000697 | 3300025941 | Bacteria | 33164 |
| 210 | Ga0207689_10211621 | 3300025942 | Bacteria | 1602 |
| 211 | Ga0207661_10000165 | 3300025944 | Bacteria | 43066 |
| 212 | Ga0207661_10318622 | 3300025944 | Bacteria | 1397 |
| 213 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 214 | Ga0207658_10000307 | 3300025986 | Bacteria | 50415 |
| 215 | Ga0207677_10349080 | 3300026023 | Bacteria | 1239 |
| 216 | Ga0207703_10006939 | 3300026035 | Bacteria | 9013 |
| 217 | Ga0207703_10784658 | 3300026035 | Bacteria | 909 |
| 218 | Ga0207702_10086087 | 3300026078 | Bacteria | 2740 |
| 219 | Ga0207641_10005680 | 3300026088 | Bacteria | 10618 |
| 220 | Ga0207641_10174683 | 3300026088 | Bacteria | 1964 |
| 221 | Ga0207641_10489469 | 3300026088 | Bacteria | 1193 |
| 222 | Ga0207674_10342550 | 3300026116 | Bacteria | 1445 |
| 223 | Ga0207675_100337725 | 3300026118 | Bacteria | 1474 |
| 224 | Ga0207675_100474986 | 3300026118 | Bacteria | 1242 |
| 225 | Ga0207683_10094478 | 3300026121 | Bacteria | 2665 |
| 226 | Ga0207683_10135838 | 3300026121 | Bacteria | 2214 |
| 227 | Ga0207683_10456413 | 3300026121 | Bacteria | 1178 |
| 228 | Ga0207698_11124577 | 3300026142 | Bacteria | 798 |
| 229 | Ga0207428_10004233 | 3300027907 | Bacteria | 13743 |
| 230 | Ga0207428_10064722 | 3300027907 | Bacteria | 2886 |
| 231 | Ga0207428_10222926 | 3300027907 | Bacteria | 1412 |
| 232 | Ga0268266_11116063 | 3300028379 | Bacteria | 763 |
| 233 | Ga0268265_10000010 | 3300028380 | Bacteria | 370129 |
| 234 | Ga0268265_10171061 | 3300028380 | Bacteria | 1857 |
| 235 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 236 | Ga0268264_10248645 | 3300028381 | Bacteria | 1651 |
| 237 | Ga0307517_10012865 | 3300028786 | Bacteria | 11430 |
| 238 | Ga0307517_10032621 | 3300028786 | Bacteria | 6012 |
| 239 | Ga0307515_10000163 | 3300028794 | Bacteria | 163159 |
| 240 | Ga0307515_10164805 | 3300028794 | Bacteria | 2240 |
| 241 | Ga0307515_10234109 | 3300028794 | Bacteria | 1622 |
| 242 | Ga0307511_10000494 | 3300030521 | Bacteria | 42578 |
| 243 | Ga0307511_10000801 | 3300030521 | Bacteria | 33509 |
| 244 | Ga0307511_10120475 | 3300030521 | Bacteria | 1625 |
| 245 | Ga0307512_10001435 | 3300030522 | Bacteria | 33817 |
| 246 | Ga0307512_10058755 | 3300030522 | Bacteria | 2992 |
| 247 | Ga0307513_10034717 | 3300031456 | Bacteria | 5654 |
| 248 | Ga0307513_10050056 | 3300031456 | Bacteria | 4520 |
| 249 | Ga0307513_10123893 | 3300031456 | Bacteria | 2545 |
| 250 | Ga0307513_10161848 | 3300031456 | Bacteria | 2129 |
| 251 | Ga0307509_10020007 | 3300031507 | Bacteria | 7610 |
| 252 | Ga0307509_10039639 | 3300031507 | Bacteria | 5130 |
| 253 | Ga0307408_100082670 | 3300031548 | Bacteria | 2404 |
| 254 | Ga0307508_10014309 | 3300031616 | Bacteria | 7236 |
| 255 | Ga0307508_10052288 | 3300031616 | Bacteria | 3629 |
| 256 | Ga0307508_10099898 | 3300031616 | Bacteria | 2496 |
| 257 | Ga0307514_10023148 | 3300031649 | Bacteria | 5044 |
| 258 | Ga0316576_10056436 | 3300031727 | Bacteria | 2868 |
| 259 | Ga0307516_10015329 | 3300031730 | Bacteria | 8066 |
| 260 | Ga0307405_10589755 | 3300031731 | Bacteria | 905 |
| 261 | Ga0307413_10405346 | 3300031824 | Bacteria | 1070 |
| 262 | Ga0307406_10105694 | 3300031901 | Bacteria | 1927 |
| 263 | Ga0307409_101036879 | 3300031995 | Bacteria | 839 |
| 264 | Ga0307415_100669090 | 3300032126 | Bacteria | 933 |
| 265 | Ga0307507_10005111 | 3300033179 | Bacteria | 22037 |
| 266 | Ga0307507_10025071 | 3300033179 | Bacteria | 6476 |
| 267 | Ga0307510_10017005 | 3300033180 | Bacteria | 8581 |
| 268 | Ga0373945_0055237 | 3300035116 | Bacteria | 1470 |
| 269 | Ga0373955_0062090 | 3300035172 | Bacteria | 2066 |
| 270 | Ga0316584_0131404 | 3300036712 | Bacteria | 1870 |
| 271 | Ga0395899_0040078 | 3300037312 | Bacteria | 3504 |
| 272 | Ga0395899_0323239 | 3300037312 | Bacteria | 1039 |
| 273 | Ga0395899_0370446 | 3300037312 | Bacteria | 954 |
| 274 | Ga0395900_0006221 | 3300037418 | Bacteria | 12464 |
| 275 | Ga0395900_0056291 | 3300037418 | Bacteria | 4048 |
| 276 | Ga0395900_0102383 | 3300037418 | Bacteria | 2942 |
| 277 | Ga0395900_0224038 | 3300037418 | Bacteria | 1894 |
| 278 | Ga0395900_0235542 | 3300037418 | Bacteria | 1839 |
| 279 | Ga0395900_0253799 | 3300037418 | Bacteria | 1759 |
| 280 | Ga0395900_0773571 | 3300037418 | Bacteria | 889 |
| 281 | Ga0395898_0002063 | 3300037466 | Bacteria | 25012 |
| 282 | Ga0395898_0015070 | 3300037466 | Bacteria | 7936 |
| 283 | Ga0395898_0068716 | 3300037466 | Bacteria | 3428 |
| 284 | Ga0395898_0106523 | 3300037466 | Bacteria | 2689 |
| 285 | Ga0395898_0306852 | 3300037466 | Bacteria | 1514 |
| 286 | Ga0395898_0755317 | 3300037466 | Bacteria | 914 |
| 287 | Ga0395905_0008033 | 3300037471 | Bacteria | 10426 |
| 288 | Ga0395905_0075385 | 3300037471 | Bacteria | 3162 |
| 289 | Ga0395905_0128247 | 3300037471 | Bacteria | 2386 |
| 290 | Ga0395905_0214925 | 3300037471 | Bacteria | 1801 |
| 291 | Ga0436364_0034902 | 3300037853 | Bacteria | 12619 |
| 292 | Ga0395901_0008507 | 3300038443 | Bacteria | 10370 |
| 293 | Ga0395901_0009883 | 3300038443 | Bacteria | 9672 |
| 294 | Ga0395901_0011587 | 3300038443 | Bacteria | 8934 |
| 295 | Ga0395901_0021241 | 3300038443 | Bacteria | 6649 |
| 296 | Ga0395901_0137204 | 3300038443 | Bacteria | 2570 |
| 297 | Ga0395901_0190780 | 3300038443 | Bacteria | 2149 |
| 298 | Ga0395901_0439690 | 3300038443 | Bacteria | 1335 |
| 299 | Ga0395901_0510093 | 3300038443 | Bacteria | 1223 |
| 300 | Ga0242420_026583 | 3300038996 | Bacteria | 1057 |
| 301 | Ga0400483_143088 | 3300039062 | Bacteria | 1250 |
| 302 | Ga0436365_0418544 | 3300039437 | Bacteria | 5953 |
| 303 | Ga0436365_1447684 | 3300039437 | Bacteria | 34467 |
| 304 | Ga0436363_0708183 | 3300039450 | Bacteria | 1614 |
| 305 | Ga0436363_0743096 | 3300039450 | Bacteria | 1030 |
| 306 | Ga0436363_0936359 | 3300039450 | Bacteria | 1228 |
| 307 | Ga0436363_1563078 | 3300039450 | Bacteria | 742 |
| 308 | Ga0436362_0942942 | 3300039453 | Bacteria | 2294 |
| 309 | Ga0451837_0199012 | 3300041494 | Bacteria | 3502 |
| 310 | Ga0451837_1576622 | 3300041494 | Bacteria | 1113 |
| 311 | Ga0450892_008350 | 3300042130 | Bacteria | 883 |
| 312 | Ga0450916_004973 | 3300042530 | Bacteria | 1520 |
| 313 | Ga0451577_0039770 | 3300042876 | Bacteria | 4225 |
| 314 | Ga0451577_0607297 | 3300042876 | Bacteria | 993 |
| 315 | Ga0466965_0005651 | 3300044683 | Bacteria | 5642 |
| 316 | Ga0466965_0153501 | 3300044683 | Bacteria | 1204 |
| 317 | Ga0466966_0010361 | 3300044684 | Bacteria | 6188 |
| 318 | Ga0466966_0303688 | 3300044684 | Bacteria | 959 |
| 319 | Ga0466961_0040499 | 3300044693 | Bacteria | 2987 |
| 320 | Ga0466961_0084742 | 3300044693 | Bacteria | 2004 |
| 321 | Ga0466963_0011503 | 3300044694 | Bacteria | 5390 |
| 322 | Ga0466963_0023198 | 3300044694 | Bacteria | 3936 |
| 323 | Ga0466963_0032705 | 3300044694 | Bacteria | 3370 |
| 324 | Ga0466963_0035507 | 3300044694 | Bacteria | 3248 |
| 325 | Ga0466963_0039164 | 3300044694 | Bacteria | 3103 |
| 326 | Ga0466963_0069974 | 3300044694 | Bacteria | 2360 |
| 327 | Ga0466963_0135672 | 3300044694 | Bacteria | 1702 |
| 328 | Ga0466963_0222415 | 3300044694 | Bacteria | 1322 |
| 329 | Ga0466963_0605066 | 3300044694 | Bacteria | 774 |
| 330 | Ga0466964_0015320 | 3300044706 | Bacteria | 2917 |
| 331 | Ga0466971_0003662 | 3300044719 | Bacteria | 6572 |
| 332 | Ga0466971_0036214 | 3300044719 | Bacteria | 2213 |
| 333 | Ga0466971_0056136 | 3300044719 | Bacteria | 1776 |
| 334 | Ga0466968_0029833 | 3300044735 | Bacteria | 2257 |
| 335 | Ga0466968_0032795 | 3300044735 | Bacteria | 2162 |
| 336 | Ga0466968_0147930 | 3300044735 | Bacteria | 1078 |
| 337 | Ga0466970_0168959 | 3300044765 | Bacteria | 1211 |
| 338 | Ga0466970_0259865 | 3300044765 | Bacteria | 974 |
| 339 | Ga0466957_0003743 | 3300044842 | Bacteria | 8406 |
| 340 | Ga0466957_0286027 | 3300044842 | Bacteria | 1104 |
| 341 | Ga0466960_0025585 | 3300044901 | Bacteria | 2672 |
| 342 | Ga0466960_0131085 | 3300044901 | Bacteria | 1323 |
| 343 | Ga0466960_0163557 | 3300044901 | Bacteria | 1196 |
| 344 | Ga0466959_0278242 | 3300045049 | Bacteria | 1149 |
| 345 | Ga0466959_0319021 | 3300045049 | Bacteria | 1062 |
| 346 | Ga0466959_0364863 | 3300045049 | Bacteria | 984 |
| 347 | Ga0466958_0003197 | 3300045836 | Bacteria | 8449 |
| 348 | Ga0466958_0059539 | 3300045836 | Bacteria | 2323 |
| 349 | Ga0466958_0175435 | 3300045836 | Bacteria | 1359 |
| 350 | Ga0466967_0011207 | 3300045976 | Bacteria | 6776 |
| 351 | Ga0466967_0031038 | 3300045976 | Bacteria | 4493 |
| 352 | Ga0466967_0050443 | 3300045976 | Bacteria | 3644 |
| 353 | Ga0466967_0195130 | 3300045976 | Bacteria | 1915 |
| 354 | Ga0466967_0307203 | 3300045976 | Bacteria | 1527 |
| 355 | Ga0466967_0695030 | 3300045976 | Bacteria | 1007 |
| 356 | Ga0466967_0723810 | 3300045976 | Bacteria | 986 |
| 357 | Ga0495592_0001429 | 3300046454 | Bacteria | 16573 |
| 358 | Ga0495592_0011840 | 3300046454 | Bacteria | 6607 |
| 359 | Ga0495603_0099638 | 3300046455 | Bacteria | 1697 |
| 360 | Ga0495629_0100871 | 3300046459 | Bacteria | 2014 |
| 361 | Ga0495629_0153332 | 3300046459 | Bacteria | 1601 |
| 362 | Ga0495629_0178483 | 3300046459 | Bacteria | 1472 |
| 363 | Ga0495638_0016925 | 3300046460 | Bacteria | 4874 |
| 364 | Ga0495638_0458505 | 3300046460 | Bacteria | 649 |
| 365 | Ga0495641_0036246 | 3300046461 | Bacteria | 2319 |
| 366 | Ga0495641_0050692 | 3300046461 | Bacteria | 1897 |
| 367 | Ga0495641_0161695 | 3300046461 | Bacteria | 1001 |
| 368 | Ga0495651_0003189 | 3300046462 | Bacteria | 12609 |
| 369 | Ga0495651_0020082 | 3300046462 | Bacteria | 5185 |
| 370 | Ga0495651_0047909 | 3300046462 | Bacteria | 3301 |
| 371 | Ga0495653_0010780 | 3300046463 | Bacteria | 7484 |
| 372 | Ga0495653_0265686 | 3300046463 | Bacteria | 1132 |
| 373 | Ga0495582_0054187 | 3300046473 | Bacteria | 2212 |
| 374 | Ga0495662_0006967 | 3300046476 | Bacteria | 5617 |
| 375 | Ga0495662_0024405 | 3300046476 | Bacteria | 2917 |
| 376 | Ga0495664_0000570 | 3300046477 | Bacteria | 18511 |
| 377 | Ga0495664_0003276 | 3300046477 | Bacteria | 8801 |
| 378 | Ga0495584_0199194 | 3300046491 | Bacteria | 1018 |
| 379 | Ga0495608_0033506 | 3300046511 | Bacteria | 3470 |
| 380 | Ga0495608_0035457 | 3300046511 | Bacteria | 3365 |
| 381 | Ga0495618_0144431 | 3300046514 | Bacteria | 1521 |
| 382 | Ga0495628_0013118 | 3300046516 | Bacteria | 6977 |
| 383 | Ga0495628_0030865 | 3300046516 | Bacteria | 4337 |
| 384 | Ga0495628_0082218 | 3300046516 | Bacteria | 2501 |
| 385 | Ga0495630_0001009 | 3300046517 | Bacteria | 19504 |
| 386 | Ga0495630_0173220 | 3300046517 | Bacteria | 1644 |
| 387 | Ga0495630_0176522 | 3300046517 | Bacteria | 1628 |
| 388 | Ga0495632_0078164 | 3300046519 | Bacteria | 1581 |
| 389 | Ga0495643_0002747 | 3300046522 | Bacteria | 13517 |
| 390 | Ga0495666_0001180 | 3300046526 | Bacteria | 12574 |
| 391 | Ga0495652_0174380 | 3300046529 | Bacteria | 1656 |
| 392 | Ga0495652_0363247 | 3300046529 | Bacteria | 1034 |
| 393 | Ga0495665_0124723 | 3300046531 | Bacteria | 1348 |
| 394 | Ga0495640_0010017 | 3300046533 | Bacteria | 7349 |
| 395 | Ga0495640_0010089 | 3300046533 | Bacteria | 7321 |
| 396 | Ga0495640_0025254 | 3300046533 | Bacteria | 4312 |
| 397 | Ga0495586_0085245 | 3300046535 | Bacteria | 1740 |
| 398 | Ga0495587_0020918 | 3300046536 | Bacteria | 4036 |
| 399 | Ga0495587_0022547 | 3300046536 | Bacteria | 3876 |
| 400 | Ga0495645_0009902 | 3300046543 | Bacteria | 6670 |
| 401 | Ga0495645_0032965 | 3300046543 | Bacteria | 3778 |
| 402 | Ga0495622_0086664 | 3300046557 | Bacteria | 1440 |
| 403 | Ga0495667_0011057 | 3300046559 | Bacteria | 6103 |
| 404 | Ga0495667_0115710 | 3300046559 | Bacteria | 1732 |
| 405 | Ga0495656_0053442 | 3300046615 | Bacteria | 1736 |
| 406 | Ga0495634_0002883 | 3300046642 | Bacteria | 14108 |
| 407 | Ga0495634_0015084 | 3300046642 | Bacteria | 5554 |
| 408 | Ga0495634_0029640 | 3300046642 | Bacteria | 3787 |
| 409 | Ga0495635_0004228 | 3300046663 | Bacteria | 9957 |
| 410 | Ga0495635_0038686 | 3300046663 | Bacteria | 3301 |
| 411 | Ga0495588_0038469 | 3300046674 | Bacteria | 2433 |
| 412 | Ga0495588_0069978 | 3300046674 | Bacteria | 1824 |
| 413 | Ga0495657_0011045 | 3300046675 | Bacteria | 6771 |
| 414 | Ga0495657_0033976 | 3300046675 | Bacteria | 3545 |
| 415 | Ga0495657_0175477 | 3300046675 | Bacteria | 1318 |
| 416 | Ga0495657_0265421 | 3300046675 | Bacteria | 1030 |
| 417 | Ga0495599_0079066 | 3300046678 | Bacteria | 2053 |
| 418 | Ga0495599_0170704 | 3300046678 | Bacteria | 1342 |
| 419 | Ga0495599_0461554 | 3300046678 | Bacteria | 751 |
| 420 | Ga0495623_0024618 | 3300046679 | Bacteria | 3876 |
| 421 | Ga0495646_0002533 | 3300046680 | Bacteria | 11230 |
| 422 | Ga0495646_0004122 | 3300046680 | Bacteria | 9123 |
| 423 | Ga0495646_0193009 | 3300046680 | Bacteria | 1112 |
| 424 | Ga0495658_0069007 | 3300046683 | Bacteria | 2048 |
| 425 | Ga0495658_0461387 | 3300046683 | Bacteria | 812 |
| 426 | Ga0495613_0001149 | 3300046689 | Bacteria | 20199 |
| 427 | Ga0495613_0001262 | 3300046689 | Bacteria | 19287 |
| 428 | Ga0495613_0115036 | 3300046689 | Bacteria | 1936 |
| 429 | Ga0495624_0090309 | 3300046690 | Bacteria | 1890 |
| 430 | Ga0495670_0022785 | 3300046691 | Bacteria | 3093 |
| 431 | Ga0495671_0006048 | 3300046692 | Bacteria | 7034 |
| 432 | Ga0495600_0025515 | 3300046809 | Bacteria | 3809 |
| 433 | Ga0495600_0046346 | 3300046809 | Bacteria | 2836 |
| 434 | Ga0495600_0203305 | 3300046809 | Bacteria | 1271 |
| 435 | Ga0495660_0061919 | 3300046810 | Bacteria | 2007 |
| 436 | Ga0495581_0029246 | 3300047315 | Bacteria | 3194 |
| 437 | Ga0495604_0001320 | 3300047317 | Bacteria | 20245 |
| 438 | Ga0495604_0003274 | 3300047317 | Bacteria | 12943 |
| 439 | Ga0495604_0070049 | 3300047317 | Bacteria | 2657 |
| 440 | Ga0495636_0008797 | 3300047318 | Bacteria | 3979 |
| 441 | Ga0495674_0000568 | 3300047319 | Bacteria | 34477 |
| 442 | Ga0495674_0017715 | 3300047319 | Bacteria | 6631 |
| 443 | Ga0495676_0011223 | 3300047321 | Bacteria | 8099 |
| 444 | Ga0495676_0117228 | 3300047321 | Bacteria | 1943 |
| 445 | Ga0495680_0000393 | 3300047322 | Bacteria | 48867 |
| 446 | Ga0495683_0230133 | 3300047323 | Bacteria | 822 |
| 447 | Ga0495687_003574 | 3300047443 | Bacteria | 11151 |
| 448 | Ga0495687_019625 | 3300047443 | Bacteria | 3311 |
| 449 | Ga0495685_002401 | 3300047447 | Bacteria | 5871 |
| 450 | Ga0495681_0003284 | 3300047470 | Bacteria | 11278 |
| 451 | Ga0495684_0014945 | 3300047471 | Bacteria | 5979 |
| 452 | Ga0495684_0018965 | 3300047471 | Bacteria | 5296 |
| 453 | Ga0495684_0022203 | 3300047471 | Bacteria | 4886 |
| 454 | Ga0495686_0117098 | 3300047472 | Bacteria | 1592 |
| 455 | Ga0495686_0287729 | 3300047472 | Bacteria | 911 |
| 456 | Ga0495593_0008831 | 3300047673 | Bacteria | 5850 |
| 457 | Ga0495593_0031569 | 3300047673 | Bacteria | 2893 |
| 458 | Ga0495602_0049695 | 3300048088 | Bacteria | 3754 |
| 459 | Ga0495614_0017478 | 3300048089 | Bacteria | 3115 |
| 460 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 461 | Ga0496100_0010810 | 3300048903 | Bacteria | 5179 |
| 462 | Ga0496100_0098453 | 3300048903 | Bacteria | 2010 |
| 463 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 464 | Ga0496101_0020411 | 3300048904 | Bacteria | 4535 |
| 465 | Ga0496101_0080653 | 3300048904 | Bacteria | 2404 |
| 466 | Ga0496102_0000060 | 3300048905 | Bacteria | 167774 |
| 467 | Ga0496102_0015718 | 3300048905 | Bacteria | 6594 |
| 468 | Ga0496102_0139345 | 3300048905 | Bacteria | 2274 |
| 469 | Ga0496103_0000500 | 3300048906 | Bacteria | 32364 |
| 470 | Ga0496103_0003635 | 3300048906 | Bacteria | 9395 |
| 471 | Ga0496104_0537280 | 3300048907 | Bacteria | 1080 |
| 472 | Ga0496105_0011383 | 3300048908 | Bacteria | 7027 |
| 473 | Ga0496105_0529556 | 3300048908 | Bacteria | 922 |
| 474 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 475 | Ga0496106_0008284 | 3300048909 | Bacteria | 7692 |
| 476 | Ga0496106_0355496 | 3300048909 | Bacteria | 1177 |
| 477 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 478 | Ga0496107_0083153 | 3300048910 | Bacteria | 2334 |
| 479 | Ga0496107_0283088 | 3300048910 | Bacteria | 1234 |
| 480 | Ga0496108_0032225 | 3300048911 | Bacteria | 4352 |
| 481 | Ga0496108_0330652 | 3300048911 | Bacteria | 1329 |
| 482 | Ga0496110_0174763 | 3300048913 | Bacteria | 1949 |
| 483 | Ga0496110_0844618 | 3300048913 | Bacteria | 821 |
| 484 | Ga0496111_0020922 | 3300048914 | Bacteria | 4561 |
| 485 | Ga0496111_0064521 | 3300048914 | Bacteria | 2657 |
| 486 | Ga0496111_0298048 | 3300048914 | Bacteria | 1195 |
| 487 | Ga0496111_0688734 | 3300048914 | Bacteria | 744 |
| 488 | Ga0496112_0037377 | 3300048915 | Bacteria | 4739 |
| 489 | Ga0496112_1017341 | 3300048915 | Bacteria | 748 |
| 490 | Ga0496113_0006265 | 3300048916 | Bacteria | 7518 |
| 491 | Ga0496113_0089085 | 3300048916 | Bacteria | 2375 |
| 492 | Ga0496114_0002542 | 3300048917 | Bacteria | 13922 |
| 493 | Ga0496114_0241857 | 3300048917 | Bacteria | 1587 |
| 494 | Ga0496115_0000815 | 3300048918 | Bacteria | 22850 |
| 495 | Ga0496115_0270508 | 3300048918 | Bacteria | 1396 |
| 496 | Ga0496116_0046069 | 3300048919 | Bacteria | 2946 |
| 497 | Ga0496117_0002026 | 3300048920 | Bacteria | 26844 |
| 498 | Ga0496118_0001179 | 3300048921 | Bacteria | 40343 |
| 499 | Ga0496119_0016754 | 3300048922 | Bacteria | 5554 |
| 500 | Ga0496120_0004413 | 3300048923 | Bacteria | 11807 |
| 501 | Ga0496121_0085248 | 3300048924 | Bacteria | 2487 |
| 502 | Ga0496121_0181465 | 3300048924 | Bacteria | 1519 |
| 503 | Ga0496124_0088633 | 3300048927 | Bacteria | 2528 |
| 504 | Ga0496125_0003753 | 3300048928 | Bacteria | 18091 |
| 505 | Ga0496125_0012912 | 3300048928 | Bacteria | 8246 |
| 506 | Ga0496126_0008248 | 3300048929 | Bacteria | 11251 |
| 507 | Ga0501031_0073698 | 3300049568 | Bacteria | 2223 |
| 508 | Ga0501031_0389206 | 3300049568 | Bacteria | 902 |
| 509 | Ga0501032_0031810 | 3300049569 | Bacteria | 3617 |
| 510 | Ga0501033_0102558 | 3300049570 | Bacteria | 2087 |
| 511 | Ga0501033_0210416 | 3300049570 | Bacteria | 1387 |
| 512 | Ga0501034_0326431 | 3300049571 | Bacteria | 1467 |
| 513 | Ga0501036_0001457 | 3300049572 | Bacteria | 18189 |
| 514 | Ga0501036_0017262 | 3300049572 | Bacteria | 6032 |
| 515 | Ga0501036_0045229 | 3300049572 | Bacteria | 3730 |
| 516 | Ga0501036_0064238 | 3300049572 | Bacteria | 3107 |
| 517 | Ga0501036_0298324 | 3300049572 | Bacteria | 1348 |
| 518 | Ga0501036_0352087 | 3300049572 | Bacteria | 1230 |
| 519 | Ga0501037_0049852 | 3300049573 | Bacteria | 3065 |
| 520 | Ga0501038_0055443 | 3300049574 | Bacteria | 3404 |
| 521 | Ga0501039_0003396 | 3300049575 | Bacteria | 11900 |
| 522 | Ga0501039_0003643 | 3300049575 | Bacteria | 11549 |
| 523 | Ga0501039_0101275 | 3300049575 | Bacteria | 2248 |
| 524 | Ga0501040_0000515 | 3300049576 | Bacteria | 23152 |
| 525 | Ga0501040_0006488 | 3300049576 | Bacteria | 7598 |
| 526 | Ga0501040_0048027 | 3300049576 | Bacteria | 2916 |
| 527 | Ga0501040_0056481 | 3300049576 | Bacteria | 2694 |
| 528 | Ga0501040_0130371 | 3300049576 | Bacteria | 1768 |
| 529 | Ga0501041_0017542 | 3300049577 | Bacteria | 4259 |
| 530 | Ga0501041_0023411 | 3300049577 | Bacteria | 3704 |
| 531 | Ga0501041_0025760 | 3300049577 | Bacteria | 3535 |
| 532 | Ga0501041_0154381 | 3300049577 | Bacteria | 1434 |
| 533 | Ga0501042_0019543 | 3300049578 | Bacteria | 4706 |
| 534 | Ga0501042_0039878 | 3300049578 | Bacteria | 3338 |
| 535 | Ga0501042_0096001 | 3300049578 | Bacteria | 2130 |
| 536 | Ga0501042_0112336 | 3300049578 | Bacteria | 1962 |
| 537 | Ga0501043_0170030 | 3300049579 | Bacteria | 1700 |
| 538 | Ga0501046_0019768 | 3300049580 | Bacteria | 5580 |
| 539 | Ga0501046_0103554 | 3300049580 | Bacteria | 2181 |
| 540 | Ga0501046_0137248 | 3300049580 | Bacteria | 1852 |
| 541 | Ga0501046_0501763 | 3300049580 | Bacteria | 869 |
| 542 | Ga0501048_0009811 | 3300049582 | Bacteria | 7178 |
| 543 | Ga0501048_0109180 | 3300049582 | Bacteria | 1953 |
| 544 | Ga0501048_0144990 | 3300049582 | Bacteria | 1679 |
| 545 | Ga0501067_0001773 | 3300049583 | Bacteria | 11851 |
| 546 | Ga0501068_0275327 | 3300049584 | Bacteria | 1075 |
| 547 | Ga0501068_0312935 | 3300049584 | Bacteria | 1006 |
| 548 | Ga0501069_0025346 | 3300049585 | Bacteria | 3240 |
| 549 | Ga0501069_0189605 | 3300049585 | Bacteria | 1189 |
| 550 | Ga0501070_0014832 | 3300049586 | Bacteria | 6556 |
| 551 | Ga0501071_0001164 | 3300049587 | Bacteria | 14751 |
| 552 | Ga0501071_0045033 | 3300049587 | Bacteria | 3166 |
| 553 | Ga0501071_0066901 | 3300049587 | Bacteria | 2612 |
| 554 | Ga0501071_0127405 | 3300049587 | Bacteria | 1890 |
| 555 | Ga0501072_0000894 | 3300049588 | Bacteria | 21861 |
| 556 | Ga0501072_0003415 | 3300049588 | Bacteria | 11964 |
| 557 | Ga0501072_0023500 | 3300049588 | Bacteria | 4789 |
| 558 | Ga0501072_0025305 | 3300049588 | Bacteria | 4623 |
| 559 | Ga0501072_0055650 | 3300049588 | Bacteria | 3117 |
| 560 | Ga0501073_0002737 | 3300049589 | Bacteria | 13216 |
| 561 | Ga0501073_0348937 | 3300049589 | Bacteria | 1022 |
| 562 | Ga0501074_0009393 | 3300049590 | Bacteria | 7108 |
| 563 | Ga0501074_0030239 | 3300049590 | Bacteria | 3925 |
| 564 | Ga0501074_0112760 | 3300049590 | Bacteria | 1946 |
| 565 | Ga0501074_0121445 | 3300049590 | Bacteria | 1868 |
| 566 | Ga0501075_0003952 | 3300049591 | Bacteria | 9988 |
| 567 | Ga0501075_0004349 | 3300049591 | Bacteria | 9582 |
| 568 | Ga0501075_0130354 | 3300049591 | Bacteria | 1916 |
| 569 | Ga0501075_0138435 | 3300049591 | Bacteria | 1854 |
| 570 | Ga0501075_0372971 | 3300049591 | Bacteria | 1088 |
| 571 | Ga0501076_0003103 | 3300049592 | Bacteria | 11568 |
| 572 | Ga0501076_0007818 | 3300049592 | Bacteria | 7792 |
| 573 | Ga0501076_0029116 | 3300049592 | Bacteria | 4293 |
| 574 | Ga0501076_0082896 | 3300049592 | Bacteria | 2574 |
| 575 | Ga0501076_0085597 | 3300049592 | Bacteria | 2533 |
| 576 | Ga0501076_0086792 | 3300049592 | Bacteria | 2515 |
| 577 | Ga0501076_0472224 | 3300049592 | Bacteria | 1033 |
| 578 | Ga0501077_0027075 | 3300049593 | Bacteria | 3640 |
| 579 | Ga0501077_0030118 | 3300049593 | Bacteria | 3452 |
| 580 | Ga0501077_0078121 | 3300049593 | Bacteria | 2097 |
| 581 | Ga0501077_0309307 | 3300049593 | Bacteria | 1007 |
| 582 | Ga0501079_0002701 | 3300049741 | Bacteria | 12919 |
| 583 | Ga0501079_0153559 | 3300049741 | Bacteria | 1794 |
| 584 | Ga0501079_0276149 | 3300049741 | Bacteria | 1314 |
| 585 | Ga0501079_0387385 | 3300049741 | Bacteria | 1096 |
| 586 | Ga0501079_0406984 | 3300049741 | Bacteria | 1067 |
| 587 | Ga0501080_0174268 | 3300049742 | Bacteria | 1982 |
| 588 | Ga0501080_0322871 | 3300049742 | Bacteria | 1397 |
| 589 | Ga0501081_0016708 | 3300049743 | Bacteria | 4852 |
| 590 | Ga0501081_0032249 | 3300049743 | Bacteria | 3553 |
| 591 | Ga0501081_0313777 | 3300049743 | Bacteria | 1151 |
| 592 | Ga0501083_0015377 | 3300049744 | Bacteria | 5360 |
| 593 | Ga0501035_0020722 | 3300049822 | Bacteria | 6042 |
| 594 | Ga0501035_0055381 | 3300049822 | Bacteria | 3541 |
| 595 | Ga0501035_0056570 | 3300049822 | Bacteria | 3499 |
| 596 | Ga0501035_0309722 | 3300049822 | Bacteria | 1329 |
| 597 | Ga0501044_0332749 | 3300049823 | Bacteria | 1441 |
| 598 | Ga0501045_0004075 | 3300049824 | Bacteria | 10084 |
| 599 | Ga0501045_0116512 | 3300049824 | Bacteria | 1982 |
| 600 | Ga0501045_0139177 | 3300049824 | Bacteria | 1805 |
| 601 | nmdc:mga0yw44_140119_c1 | 3300050492 | Bacteria | 1571 |
| 602 | nmdc:mga0yw44_51785_c1 | 3300050492 | Bacteria | 2487 |
| 603 | nmdc:mga0yw44_88951_c1 | 3300050492 | Bacteria | 1948 |
| 604 | nmdc:mga05p37_10310_c1 | 3300050507 | Bacteria | 11097 |
| 605 | nmdc:mga05p37_1215725_c1 | 3300050507 | Bacteria | 777 |
| 606 | nmdc:mga05p37_130523_c1 | 3300050507 | Bacteria | 3083 |
| 607 | nmdc:mga05p37_142939_c1 | 3300050507 | Bacteria | 2931 |
| 608 | nmdc:mga05p37_147460_c1 | 3300050507 | Bacteria | 2880 |
| 609 | nmdc:mga05p37_21214_c1 | 3300050507 | Bacteria | 7864 |
| 610 | nmdc:mga05p37_21516_c1 | 3300050507 | Bacteria | 7812 |
| 611 | nmdc:mga05p37_482142_c1 | 3300050507 | Bacteria | 1428 |
| 612 | nmdc:mga05p37_48686_c1 | 3300050507 | Bacteria | 5212 |
| 613 | nmdc:mga09592_169501_c1 | 3300050508 | Bacteria | 1888 |
| 614 | nmdc:mga0qj67_91666_c1 | 3300050509 | Bacteria | 2443 |
| 615 | nmdc:mga06r32_13499_c1 | 3300050510 | Bacteria | 7403 |
| 616 | nmdc:mga06r32_330200_c1 | 3300050510 | Bacteria | 1510 |
| 617 | nmdc:mga06r32_438984_c1 | 3300050510 | Bacteria | 1286 |
| 618 | nmdc:mga06r32_79753_c1 | 3300050510 | Bacteria | 3184 |
| 619 | nmdc:mga08y16_45205_c1 | 3300050511 | Bacteria | 4614 |
| 620 | nmdc:mga08y16_80546_c1 | 3300050511 | Bacteria | 3395 |
| 621 | nmdc:mga08y16_953155_c1 | 3300050511 | Bacteria | 841 |
| 622 | nmdc:mga0n895_320921_c1 | 3300050512 | Bacteria | 1570 |
| 623 | nmdc:mga0n895_56427_c1 | 3300050512 | Bacteria | 3869 |
| 624 | nmdc:mga0n895_57126_c1 | 3300050512 | Bacteria | 3846 |
| 625 | nmdc:mga0n895_63695_c1 | 3300050512 | Bacteria | 3646 |
| 626 | nmdc:mga0n895_743_c1 | 3300050512 | Bacteria | 23050 |
| 627 | nmdc:mga0n895_9556_c1 | 3300050512 | Bacteria | 8493 |
| 628 | nmdc:mga0rr50_135216_c1 | 3300050513 | Bacteria | 1978 |
| 629 | nmdc:mga0rr50_135655_c1 | 3300050513 | Bacteria | 1975 |
| 630 | nmdc:mga0rr50_333702_c1 | 3300050513 | Bacteria | 1273 |
| 631 | nmdc:mga0rr50_3537_c1 | 3300050513 | Bacteria | 9016 |
| 632 | nmdc:mga0rr50_43998_c1 | 3300050513 | Bacteria | 3272 |
| 633 | nmdc:mga08x19_3507_c1 | 3300050514 | Bacteria | 9335 |
| 634 | nmdc:mga08x19_636081_c1 | 3300050514 | Bacteria | 756 |
| 635 | nmdc:mga0a205_102371_c1 | 3300050515 | Bacteria | 2762 |
| 636 | nmdc:mga0a205_115185_c1 | 3300050515 | Bacteria | 2587 |
| 637 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 638 | nmdc:mga0a205_20197_c1 | 3300050515 | Bacteria | 6284 |
| 639 | nmdc:mga0a205_22022_c1 | 3300050515 | Bacteria | 2198 |
| 640 | nmdc:mga0a205_32312_c1 | 3300050515 | Bacteria | 5019 |
| 641 | nmdc:mga0a205_33485_c1 | 3300050515 | Bacteria | 4926 |
| 642 | nmdc:mga0a205_68679_c1 | 3300050515 | Bacteria | 3422 |
| 643 | Ga0495601_0087095 | 3300053077 | Bacteria | 2008 |
| 644 | Ga0495655_0113043 | 3300053083 | Bacteria | 818 |
| 645 | Ga0495619_0040632 | 3300053085 | Bacteria | 3040 |
| 646 | Ga0495619_0180766 | 3300053085 | Bacteria | 1459 |
| 647 | Ga0500578_0012444 | 3300053086 | Bacteria | 5489 |
| 648 | Ga0500640_023966 | 3300053095 | Bacteria | 2647 |
| 649 | Ga0500654_058339 | 3300053099 | Bacteria | 2002 |
| 650 | Ga0500660_039633 | 3300053100 | Bacteria | 2405 |
| 651 | Ga0500553_136757 | 3300053101 | Bacteria | 975 |
| 652 | Ga0500560_000468 | 3300053107 | Bacteria | 5622 |
| 653 | Ga0500569_001500 | 3300053109 | Bacteria | 4422 |
| 654 | Ga0500572_088713 | 3300053111 | Bacteria | 977 |
| 655 | Ga0500614_004794 | 3300053123 | Bacteria | 2845 |
| 656 | Ga0500614_018592 | 3300053123 | Bacteria | 1583 |
| 657 | Ga0500628_005693 | 3300053129 | Bacteria | 2089 |
| 658 | Ga0500652_007135 | 3300053131 | Bacteria | 3639 |
| 659 | Ga0500658_0033416 | 3300053134 | Bacteria | 2022 |
| 660 | Ga0500559_0165501 | 3300053136 | Bacteria | 1040 |
| 661 | Ga0500561_0000775 | 3300053137 | Bacteria | 5069 |
| 662 | Ga0500573_0114554 | 3300053140 | Bacteria | 1506 |
| 663 | Ga0500577_0068266 | 3300053142 | Bacteria | 1388 |
| 664 | Ga0500588_0126179 | 3300053146 | Bacteria | 907 |
| 665 | Ga0500600_0001718 | 3300053149 | Bacteria | 11846 |
| 666 | Ga0500603_036123 | 3300053150 | Bacteria | 1299 |
| 667 | Ga0500616_0106578 | 3300053153 | Bacteria | 1361 |
| 668 | Ga0500624_006191 | 3300053157 | Bacteria | 1613 |
| 669 | Ga0500633_0025426 | 3300053160 | Bacteria | 1851 |
| 670 | Ga0500634_0001300 | 3300053161 | Bacteria | 9512 |
| 671 | Ga0500656_001260 | 3300053732 | Bacteria | 2149 |
| 672 | Ga0501084_0004385 | 3300054114 | Bacteria | 11502 |
| 673 | Ga0501084_0029398 | 3300054114 | Bacteria | 4597 |
| 674 | Ga0501084_0081060 | 3300054114 | Bacteria | 2721 |
| 675 | Ga0501084_0660664 | 3300054114 | Bacteria | 882 |
| 676 | Ga0501082_0070632 | 3300060353 | Bacteria | 3006 |
| 677 | Ga0501082_0105889 | 3300060353 | Bacteria | 2433 |
| 678 | Ga0501082_0136813 | 3300060353 | Bacteria | 2125 |
| 679 | Ga0501082_0172521 | 3300060353 | Bacteria | 1880 |
| 680 | Ga0501082_0589463 | 3300060353 | Bacteria | 973 |
| 681 | Ga0466962_0001045 | 3300061719 | Bacteria | 12703 |
| 682 | Ga0466962_0004738 | 3300061719 | Bacteria | 6537 |
| 683 | Ga0466962_0070878 | 3300061719 | Bacteria | 1665 |
| 684 | Ga0466962_0118825 | 3300061719 | Bacteria | 1275 |
| 685 | Ga0530510_0005561 | 3300061734 | Bacteria | 8734 |
| 686 | Ga0530510_0009858 | 3300061734 | Bacteria | 6701 |
| 687 | Ga0530510_0020967 | 3300061734 | Bacteria | 4647 |
| 688 | Ga0530510_0035126 | 3300061734 | Bacteria | 3612 |
| 689 | Ga0530510_0184960 | 3300061734 | Bacteria | 1546 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300033179 | Ga0307507_10025071 | Ga0307507_100250711 | 193 |
| 2 | 3300046460 | Ga0495638_0458505 | Ga0495638_0458505_33_620 | 193 |
| 3 | 3300053150 | Ga0500603_036123 | Ga0500603_036123_685_1278 | 193 |
| 4 | 3300005937 | Ga0081455_10217123 | Ga0081455_102171232 | 208 |
| 5 | 3300005329 | Ga0070683_100001023 | Ga0070683_10000102312 | 209 |
| 6 | 3300049568 | Ga0501031_0389206 | Ga0501031_0389206_12_647 | 211 |
| 7 | 3300031727 | Ga0316576_10056436 | Ga0316576_100564363 | 213 |
| 8 | 3300036712 | Ga0316584_0131404 | Ga0316584_0131404_455_1111 | 213 |
| 9 | 3300005544 | Ga0070686_100002743 | Ga0070686_1000027439 | 214 |
| 10 | 3300021377 | Ga0213874_10149487 | Ga0213874_101494871 | 214 |
| 11 | 3300048928 | Ga0496125_0003753 | Ga0496125_0003753_584_1237 | 214 |
| 12 | 3300028381 | Ga0268264_10248645 | Ga0268264_102486452 | 215 |
| 13 | 3300031548 | Ga0307408_100082670 | Ga0307408_1000826702 | 215 |
| 14 | 3300031901 | Ga0307406_10105694 | Ga0307406_101056942 | 215 |
| 15 | iso_pu_bacteria | 8047710418 | 8047719701 | 215 |
| 16 | 3300028794 | Ga0307515_10164805 | Ga0307515_101648053 | 216 |
| 17 | 3300031456 | Ga0307513_10050056 | Ga0307513_100500564 | 216 |
| 18 | 3300031616 | Ga0307508_10099898 | Ga0307508_100998981 | 216 |
| 19 | 3300035116 | Ga0373945_0055237 | Ga0373945_0055237_437_1093 | 216 |
| 20 | 3300044694 | Ga0466963_0222415 | Ga0466963_0222415_420_1070 | 216 |
| 21 | 3300045836 | Ga0466958_0175435 | Ga0466958_0175435_22_672 | 216 |
| 22 | 3300046454 | Ga0495592_0011840 | Ga0495592_0011840_3392_4048 | 216 |
| 23 | 3300046459 | Ga0495629_0178483 | Ga0495629_0178483_263_919 | 216 |
| 24 | 3300046462 | Ga0495651_0003189 | Ga0495651_0003189_8735_9391 | 216 |
| 25 | 3300046473 | Ga0495582_0054187 | Ga0495582_0054187_1125_1781 | 216 |
| 26 | 3300046476 | Ga0495662_0024405 | Ga0495662_0024405_1349_2005 | 216 |
| 27 | 3300046477 | Ga0495664_0000570 | Ga0495664_0000570_1116_1772 | 216 |
| 28 | 3300046514 | Ga0495618_0144431 | Ga0495618_0144431_635_1291 | 216 |
| 29 | 3300046517 | Ga0495630_0176522 | Ga0495630_0176522_906_1562 | 216 |
| 30 | 3300046529 | Ga0495652_0174380 | Ga0495652_0174380_167_823 | 216 |
| 31 | 3300046533 | Ga0495640_0025254 | Ga0495640_0025254_3605_4261 | 216 |
| 32 | 3300046535 | Ga0495586_0085245 | Ga0495586_0085245_554_1210 | 216 |
| 33 | 3300046536 | Ga0495587_0020918 | Ga0495587_0020918_1957_2613 | 216 |
| 34 | 3300046543 | Ga0495645_0009902 | Ga0495645_0009902_738_1394 | 216 |
| 35 | 3300046557 | Ga0495622_0086664 | Ga0495622_0086664_744_1400 | 216 |
| 36 | 3300046642 | Ga0495634_0002883 | Ga0495634_0002883_7783_8439 | 216 |
| 37 | 3300046663 | Ga0495635_0004228 | Ga0495635_0004228_6120_6776 | 216 |
| 38 | 3300046674 | Ga0495588_0038469 | Ga0495588_0038469_310_966 | 216 |
| 39 | 3300046675 | Ga0495657_0011045 | Ga0495657_0011045_4742_5398 | 216 |
| 40 | 3300046678 | Ga0495599_0170704 | Ga0495599_0170704_350_1006 | 216 |
| 41 | 3300046680 | Ga0495646_0002533 | Ga0495646_0002533_9320_9976 | 216 |
| 42 | 3300046689 | Ga0495613_0001262 | Ga0495613_0001262_12683_13339 | 216 |
| 43 | 3300046690 | Ga0495624_0090309 | Ga0495624_0090309_55_711 | 216 |
| 44 | 3300046692 | Ga0495671_0006048 | Ga0495671_0006048_1154_1810 | 216 |
| 45 | 3300046809 | Ga0495600_0025515 | Ga0495600_0025515_1130_1786 | 216 |
| 46 | 3300047315 | Ga0495581_0029246 | Ga0495581_0029246_513_1169 | 216 |
| 47 | 3300047317 | Ga0495604_0003274 | Ga0495604_0003274_3182_3838 | 216 |
| 48 | 3300047321 | Ga0495676_0011223 | Ga0495676_0011223_6321_6977 | 216 |
| 49 | 3300047470 | Ga0495681_0003284 | Ga0495681_0003284_5965_6621 | 216 |
| 50 | 3300047471 | Ga0495684_0022203 | Ga0495684_0022203_3353_4009 | 216 |
| 51 | 3300047472 | Ga0495686_0287729 | Ga0495686_0287729_32_688 | 216 |
| 52 | 3300047673 | Ga0495593_0008831 | Ga0495593_0008831_3589_4245 | 216 |
| 53 | 3300048088 | Ga0495602_0049695 | Ga0495602_0049695_1424_2080 | 216 |
| 54 | 3300048089 | Ga0495614_0017478 | Ga0495614_0017478_1242_1898 | 216 |
| 55 | 3300053083 | Ga0495655_0113043 | Ga0495655_0113043_48_704 | 216 |
| 56 | 3300053085 | Ga0495619_0180766 | Ga0495619_0180766_156_812 | 216 |
| 57 | 3300053095 | Ga0500640_023966 | Ga0500640_023966_885_1541 | 216 |
| 58 | 3300053107 | Ga0500560_000468 | Ga0500560_000468_3905_4561 | 216 |
| 59 | 3300053111 | Ga0500572_088713 | Ga0500572_088713_51_707 | 216 |
| 60 | 3300053123 | Ga0500614_018592 | Ga0500614_018592_728_1384 | 216 |
| 61 | 3300053136 | Ga0500559_0165501 | Ga0500559_0165501_302_958 | 216 |
| 62 | 3300053140 | Ga0500573_0114554 | Ga0500573_0114554_120_776 | 216 |
| 63 | 3300053157 | Ga0500624_006191 | Ga0500624_006191_882_1538 | 216 |
| 64 | iso_pu_bacteria | 2899359706 | 2899368960 | 216 |
| 65 | iso_pu_bacteria | 2808606522 | 2809590728 | 217 |
| 66 | iso_pu_bacteria | 2867346516 | 2867347304 | 217 |
| 67 | 3300005434 | Ga0070709_10263492 | Ga0070709_102634921 | 218 |
| 68 | 3300005435 | Ga0070714_100177698 | Ga0070714_1001776982 | 218 |
| 69 | 3300005455 | Ga0070663_100497112 | Ga0070663_1004971121 | 218 |
| 70 | 3300005548 | Ga0070665_100309521 | Ga0070665_1003095212 | 218 |
| 71 | 3300005614 | Ga0068856_100197319 | Ga0068856_1001973192 | 218 |
| 72 | 3300006175 | Ga0070712_100252379 | Ga0070712_1002523792 | 218 |
| 73 | 3300009093 | Ga0105240_10003784 | Ga0105240_1000378414 | 218 |
| 74 | 3300009101 | Ga0105247_10564892 | Ga0105247_105648921 | 218 |
| 75 | 3300009545 | Ga0105237_10003213 | Ga0105237_1000321311 | 218 |
| 76 | 3300009551 | Ga0105238_10139425 | Ga0105238_101394252 | 218 |
| 77 | 3300010375 | Ga0105239_10002098 | Ga0105239_100020986 | 218 |
| 78 | 3300013307 | Ga0157372_10102699 | Ga0157372_101026992 | 218 |
| 79 | 3300013307 | Ga0157372_10493931 | Ga0157372_104939311 | 218 |
| 80 | 3300021388 | Ga0213875_10010077 | Ga0213875_100100774 | 218 |
| 81 | 3300022467 | Ga0224712_10151098 | Ga0224712_101510982 | 218 |
| 82 | 3300025913 | Ga0207695_10021148 | Ga0207695_100211482 | 218 |
| 83 | 3300025914 | Ga0207671_10254159 | Ga0207671_102541592 | 218 |
| 84 | 3300025924 | Ga0207694_10038810 | Ga0207694_100388102 | 218 |
| 85 | 3300026078 | Ga0207702_10086087 | Ga0207702_100860872 | 218 |
| 86 | 3300035172 | Ga0373955_0062090 | Ga0373955_0062090_995_1657 | 218 |
| 87 | 3300037853 | Ga0436364_0034902 | Ga0436364_0034902_935_1591 | 218 |
| 88 | 3300039450 | Ga0436363_0743096 | Ga0436363_0743096_241_897 | 218 |
| 89 | 3300046462 | Ga0495651_0020082 | Ga0495651_0020082_2012_2674 | 218 |
| 90 | 3300046463 | Ga0495653_0265686 | Ga0495653_0265686_230_892 | 218 |
| 91 | 3300046511 | Ga0495608_0035457 | Ga0495608_0035457_2359_3021 | 218 |
| 92 | 3300046516 | Ga0495628_0030865 | Ga0495628_0030865_2110_2772 | 218 |
| 93 | 3300046517 | Ga0495630_0001009 | Ga0495630_0001009_13463_14125 | 218 |
| 94 | 3300046533 | Ga0495640_0010017 | Ga0495640_0010017_2497_3159 | 218 |
| 95 | 3300046559 | Ga0495667_0011057 | Ga0495667_0011057_4053_4715 | 218 |
| 96 | 3300046642 | Ga0495634_0029640 | Ga0495634_0029640_2850_3512 | 218 |
| 97 | 3300046675 | Ga0495657_0265421 | Ga0495657_0265421_290_952 | 218 |
| 98 | 3300046678 | Ga0495599_0461554 | Ga0495599_0461554_25_687 | 218 |
| 99 | 3300046809 | Ga0495600_0203305 | Ga0495600_0203305_390_1052 | 218 |
| 100 | 3300047317 | Ga0495604_0070049 | Ga0495604_0070049_1952_2614 | 218 |
| 101 | 3300047319 | Ga0495674_0000568 | Ga0495674_0000568_31374_32036 | 218 |
| 102 | 3300047322 | Ga0495680_0000393 | Ga0495680_0000393_711_1373 | 218 |
| 103 | 3300047471 | Ga0495684_0014945 | Ga0495684_0014945_1469_2131 | 218 |
| 104 | 3300048913 | Ga0496110_0844618 | Ga0496110_0844618_44_700 | 218 |
| 105 | 3300048914 | Ga0496111_0688734 | Ga0496111_0688734_11_667 | 218 |
| 106 | 3300048916 | Ga0496113_0089085 | Ga0496113_0089085_842_1498 | 218 |
| 107 | 3300048918 | Ga0496115_0270508 | Ga0496115_0270508_509_1171 | 218 |
| 108 | 3300053077 | Ga0495601_0087095 | Ga0495601_0087095_1213_1875 | 218 |
| 109 | 3300061719 | Ga0466962_0118825 | Ga0466962_0118825_355_1011 | 218 |
| 110 | 3300028786 | Ga0307517_10012865 | Ga0307517_100128652 | 219 |
| 111 | 3300028786 | Ga0307517_10032621 | Ga0307517_100326213 | 219 |
| 112 | 3300028794 | Ga0307515_10000163 | Ga0307515_10000163141 | 219 |
| 113 | 3300028794 | Ga0307515_10234109 | Ga0307515_102341092 | 219 |
| 114 | 3300030521 | Ga0307511_10000801 | Ga0307511_1000080122 | 219 |
| 115 | 3300030521 | Ga0307511_10120475 | Ga0307511_101204752 | 219 |
| 116 | 3300030522 | Ga0307512_10001435 | Ga0307512_1000143527 | 219 |
| 117 | 3300030522 | Ga0307512_10058755 | Ga0307512_100587552 | 219 |
| 118 | 3300031456 | Ga0307513_10034717 | Ga0307513_100347173 | 219 |
| 119 | 3300031456 | Ga0307513_10161848 | Ga0307513_101618482 | 219 |
| 120 | 3300031507 | Ga0307509_10020007 | Ga0307509_100200075 | 219 |
| 121 | 3300031507 | Ga0307509_10039639 | Ga0307509_100396394 | 219 |
| 122 | 3300031616 | Ga0307508_10014309 | Ga0307508_100143092 | 219 |
| 123 | 3300031616 | Ga0307508_10052288 | Ga0307508_100522882 | 219 |
| 124 | 3300031649 | Ga0307514_10023148 | Ga0307514_100231484 | 219 |
| 125 | 3300031730 | Ga0307516_10015329 | Ga0307516_100153294 | 219 |
| 126 | 3300033179 | Ga0307507_10005111 | Ga0307507_1000511111 | 219 |
| 127 | 3300033180 | Ga0307510_10017005 | Ga0307510_100170056 | 219 |
| 128 | 3300046454 | Ga0495592_0001429 | Ga0495592_0001429_9482_10147 | 219 |
| 129 | 3300046459 | Ga0495629_0100871 | Ga0495629_0100871_819_1490 | 219 |
| 130 | 3300046459 | Ga0495629_0153332 | Ga0495629_0153332_458_1150 | 219 |
| 131 | 3300046461 | Ga0495641_0036246 | Ga0495641_0036246_1516_2181 | 219 |
| 132 | 3300046462 | Ga0495651_0047909 | Ga0495651_0047909_2263_2928 | 219 |
| 133 | 3300046463 | Ga0495653_0010780 | Ga0495653_0010780_3076_3741 | 219 |
| 134 | 3300046476 | Ga0495662_0006967 | Ga0495662_0006967_2497_3162 | 219 |
| 135 | 3300046477 | Ga0495664_0003276 | Ga0495664_0003276_7039_7704 | 219 |
| 136 | 3300046511 | Ga0495608_0033506 | Ga0495608_0033506_344_1009 | 219 |
| 137 | 3300046516 | Ga0495628_0013118 | Ga0495628_0013118_443_1108 | 219 |
| 138 | 3300046516 | Ga0495628_0082218 | Ga0495628_0082218_956_1621 | 219 |
| 139 | 3300046517 | Ga0495630_0173220 | Ga0495630_0173220_540_1205 | 219 |
| 140 | 3300046519 | Ga0495632_0078164 | Ga0495632_0078164_773_1444 | 219 |
| 141 | 3300046522 | Ga0495643_0002747 | Ga0495643_0002747_2542_3213 | 219 |
| 142 | 3300046526 | Ga0495666_0001180 | Ga0495666_0001180_2490_3155 | 219 |
| 143 | 3300046531 | Ga0495665_0124723 | Ga0495665_0124723_368_1033 | 219 |
| 144 | 3300046533 | Ga0495640_0010089 | Ga0495640_0010089_344_1009 | 219 |
| 145 | 3300046536 | Ga0495587_0022547 | Ga0495587_0022547_949_1614 | 219 |
| 146 | 3300046543 | Ga0495645_0032965 | Ga0495645_0032965_2270_2935 | 219 |
| 147 | 3300046559 | Ga0495667_0115710 | Ga0495667_0115710_583_1248 | 219 |
| 148 | 3300046642 | Ga0495634_0015084 | Ga0495634_0015084_3203_3868 | 219 |
| 149 | 3300046663 | Ga0495635_0038686 | Ga0495635_0038686_2263_2928 | 219 |
| 150 | 3300046675 | Ga0495657_0033976 | Ga0495657_0033976_2507_3172 | 219 |
| 151 | 3300046678 | Ga0495599_0079066 | Ga0495599_0079066_949_1614 | 219 |
| 152 | 3300046679 | Ga0495623_0024618 | Ga0495623_0024618_2263_2928 | 219 |
| 153 | 3300046680 | Ga0495646_0004122 | Ga0495646_0004122_2439_3104 | 219 |
| 154 | 3300046680 | Ga0495646_0193009 | Ga0495646_0193009_96_761 | 219 |
| 155 | 3300046683 | Ga0495658_0069007 | Ga0495658_0069007_291_962 | 219 |
| 156 | 3300046689 | Ga0495613_0001149 | Ga0495613_0001149_7634_8299 | 219 |
| 157 | 3300046689 | Ga0495613_0115036 | Ga0495613_0115036_183_854 | 219 |
| 158 | 3300046691 | Ga0495670_0022785 | Ga0495670_0022785_2376_3047 | 219 |
| 159 | 3300046809 | Ga0495600_0046346 | Ga0495600_0046346_485_1150 | 219 |
| 160 | 3300046810 | Ga0495660_0061919 | Ga0495660_0061919_1026_1697 | 219 |
| 161 | 3300047317 | Ga0495604_0001320 | Ga0495604_0001320_16187_16852 | 219 |
| 162 | 3300047318 | Ga0495636_0008797 | Ga0495636_0008797_683_1354 | 219 |
| 163 | 3300047319 | Ga0495674_0017715 | Ga0495674_0017715_3620_4285 | 219 |
| 164 | 3300047323 | Ga0495683_0230133 | Ga0495683_0230133_97_768 | 219 |
| 165 | 3300047443 | Ga0495687_003574 | Ga0495687_003574_6592_7257 | 219 |
| 166 | 3300047443 | Ga0495687_019625 | Ga0495687_019625_1584_2255 | 219 |
| 167 | 3300047447 | Ga0495685_002401 | Ga0495685_002401_5172_5843 | 219 |
| 168 | 3300047471 | Ga0495684_0018965 | Ga0495684_0018965_2704_3369 | 219 |
| 169 | 3300047673 | Ga0495593_0031569 | Ga0495593_0031569_813_1478 | 219 |
| 170 | 3300053085 | Ga0495619_0040632 | Ga0495619_0040632_32_697 | 219 |
| 171 | 3300053086 | Ga0500578_0012444 | Ga0500578_0012444_652_1323 | 219 |
| 172 | 3300053099 | Ga0500654_058339 | Ga0500654_058339_307_978 | 219 |
| 173 | 3300053100 | Ga0500660_039633 | Ga0500660_039633_498_1169 | 219 |
| 174 | 3300053101 | Ga0500553_136757 | Ga0500553_136757_273_944 | 219 |
| 175 | 3300053109 | Ga0500569_001500 | Ga0500569_001500_447_1118 | 219 |
| 176 | 3300053123 | Ga0500614_004794 | Ga0500614_004794_724_1395 | 219 |
| 177 | 3300053129 | Ga0500628_005693 | Ga0500628_005693_1122_1793 | 219 |
| 178 | 3300053131 | Ga0500652_007135 | Ga0500652_007135_2607_3278 | 219 |
| 179 | 3300053134 | Ga0500658_0033416 | Ga0500658_0033416_1324_1995 | 219 |
| 180 | 3300053137 | Ga0500561_0000775 | Ga0500561_0000775_3241_3912 | 219 |
| 181 | 3300053142 | Ga0500577_0068266 | Ga0500577_0068266_134_805 | 219 |
| 182 | 3300053149 | Ga0500600_0001718 | Ga0500600_0001718_389_1060 | 219 |
| 183 | 3300053160 | Ga0500633_0025426 | Ga0500633_0025426_210_881 | 219 |
| 184 | 3300053161 | Ga0500634_0001300 | Ga0500634_0001300_8197_8868 | 219 |
| 185 | 3300053732 | Ga0500656_001260 | Ga0500656_001260_1147_1818 | 219 |
| 186 | 3300005336 | Ga0070680_100167508 | Ga0070680_1001675083 | 220 |
| 187 | 3300005458 | Ga0070681_10039140 | Ga0070681_100391404 | 220 |
| 188 | 3300005530 | Ga0070679_100150861 | Ga0070679_1001508612 | 220 |
| 189 | 3300006847 | Ga0075431_100245311 | Ga0075431_1002453113 | 220 |
| 190 | 3300025912 | Ga0207707_10080111 | Ga0207707_100801112 | 220 |
| 191 | 3300025917 | Ga0207660_10089411 | Ga0207660_100894113 | 220 |
| 192 | 3300025921 | Ga0207652_10063291 | Ga0207652_100632914 | 220 |
| 193 | 3300025944 | Ga0207661_10000165 | Ga0207661_1000016529 | 220 |
| 194 | 3300037471 | Ga0395905_0128247 | Ga0395905_0128247_134_796 | 220 |
| 195 | 3300039437 | Ga0436365_0418544 | Ga0436365_0418544_587_1249 | 220 |
| 196 | 3300039450 | Ga0436363_0708183 | Ga0436363_0708183_523_1188 | 220 |
| 197 | 3300039453 | Ga0436362_0942942 | Ga0436362_0942942_417_1079 | 220 |
| 198 | 3300044683 | Ga0466965_0153501 | Ga0466965_0153501_209_877 | 220 |
| 199 | 3300044684 | Ga0466966_0303688 | Ga0466966_0303688_273_935 | 220 |
| 200 | 3300044694 | Ga0466963_0135672 | Ga0466963_0135672_756_1418 | 220 |
| 201 | 3300047472 | Ga0495686_0117098 | Ga0495686_0117098_455_1147 | 220 |
| 202 | 3300049591 | Ga0501075_0372971 | Ga0501075_0372971_155_823 | 220 |
| 203 | 3300049741 | Ga0501079_0276149 | Ga0501079_0276149_426_1094 | 220 |
| 204 | 3300005616 | Ga0068852_100920085 | Ga0068852_1009200851 | 221 |
| 205 | 3300005981 | Ga0081538_10009031 | Ga0081538_100090313 | 221 |
| 206 | 3300005981 | Ga0081538_10045943 | Ga0081538_100459433 | 221 |
| 207 | 3300021384 | Ga0213876_10002484 | Ga0213876_100024846 | 221 |
| 208 | 3300026088 | Ga0207641_10489469 | Ga0207641_104894692 | 221 |
| 209 | 3300031456 | Ga0307513_10123893 | Ga0307513_101238932 | 221 |
| 210 | 3300039437 | Ga0436365_1447684 | Ga0436365_1447684_17843_18520 | 221 |
| 211 | 3300044735 | Ga0466968_0029833 | Ga0466968_0029833_537_1202 | 221 |
| 212 | 3300045049 | Ga0466959_0364863 | Ga0466959_0364863_54_719 | 221 |
| 213 | 3300046529 | Ga0495652_0363247 | Ga0495652_0363247_327_998 | 221 |
| 214 | 3300049568 | Ga0501031_0073698 | Ga0501031_0073698_973_1638 | 221 |
| 215 | 3300049570 | Ga0501033_0102558 | Ga0501033_0102558_1373_2038 | 221 |
| 216 | 3300049570 | Ga0501033_0210416 | Ga0501033_0210416_596_1261 | 221 |
| 217 | 3300049572 | Ga0501036_0017262 | Ga0501036_0017262_5046_5711 | 221 |
| 218 | 3300049572 | Ga0501036_0045229 | Ga0501036_0045229_1244_1909 | 221 |
| 219 | 3300049575 | Ga0501039_0003396 | Ga0501039_0003396_9868_10533 | 221 |
| 220 | 3300049576 | Ga0501040_0000515 | Ga0501040_0000515_13834_14499 | 221 |
| 221 | 3300049576 | Ga0501040_0006488 | Ga0501040_0006488_5268_5933 | 221 |
| 222 | 3300049577 | Ga0501041_0017542 | Ga0501041_0017542_1272_1937 | 221 |
| 223 | 3300049577 | Ga0501041_0023411 | Ga0501041_0023411_2166_2831 | 221 |
| 224 | 3300049578 | Ga0501042_0019543 | Ga0501042_0019543_2662_3327 | 221 |
| 225 | 3300049580 | Ga0501046_0019768 | Ga0501046_0019768_1301_1966 | 221 |
| 226 | 3300049580 | Ga0501046_0137248 | Ga0501046_0137248_994_1659 | 221 |
| 227 | 3300049582 | Ga0501048_0009811 | Ga0501048_0009811_1348_2013 | 221 |
| 228 | 3300049582 | Ga0501048_0109180 | Ga0501048_0109180_1236_1901 | 221 |
| 229 | 3300049587 | Ga0501071_0001164 | Ga0501071_0001164_8180_8845 | 221 |
| 230 | 3300049587 | Ga0501071_0045033 | Ga0501071_0045033_1189_1854 | 221 |
| 231 | 3300049588 | Ga0501072_0000894 | Ga0501072_0000894_7908_8573 | 221 |
| 232 | 3300049588 | Ga0501072_0003415 | Ga0501072_0003415_8831_9496 | 221 |
| 233 | 3300049589 | Ga0501073_0348937 | Ga0501073_0348937_36_701 | 221 |
| 234 | 3300049590 | Ga0501074_0009393 | Ga0501074_0009393_5550_6215 | 221 |
| 235 | 3300049590 | Ga0501074_0030239 | Ga0501074_0030239_1891_2556 | 221 |
| 236 | 3300049591 | Ga0501075_0003952 | Ga0501075_0003952_3265_3930 | 221 |
| 237 | 3300049591 | Ga0501075_0004349 | Ga0501075_0004349_8064_8729 | 221 |
| 238 | 3300049592 | Ga0501076_0003103 | Ga0501076_0003103_1800_2465 | 221 |
| 239 | 3300049592 | Ga0501076_0007818 | Ga0501076_0007818_3674_4339 | 221 |
| 240 | 3300049593 | Ga0501077_0027075 | Ga0501077_0027075_853_1518 | 221 |
| 241 | 3300049593 | Ga0501077_0078121 | Ga0501077_0078121_183_848 | 221 |
| 242 | 3300049741 | Ga0501079_0002701 | Ga0501079_0002701_7865_8530 | 221 |
| 243 | 3300049742 | Ga0501080_0322871 | Ga0501080_0322871_615_1280 | 221 |
| 244 | 3300049743 | Ga0501081_0016708 | Ga0501081_0016708_2371_3036 | 221 |
| 245 | 3300049743 | Ga0501081_0032249 | Ga0501081_0032249_1176_1841 | 221 |
| 246 | 3300049822 | Ga0501035_0055381 | Ga0501035_0055381_2859_3524 | 221 |
| 247 | 3300049822 | Ga0501035_0056570 | Ga0501035_0056570_1122_1787 | 221 |
| 248 | 3300049824 | Ga0501045_0004075 | Ga0501045_0004075_1611_2276 | 221 |
| 249 | 3300054114 | Ga0501084_0004385 | Ga0501084_0004385_1840_2505 | 221 |
| 250 | 3300054114 | Ga0501084_0081060 | Ga0501084_0081060_685_1350 | 221 |
| 251 | 3300060353 | Ga0501082_0070632 | Ga0501082_0070632_439_1104 | 221 |
| 252 | 3300060353 | Ga0501082_0105889 | Ga0501082_0105889_1248_1913 | 221 |
| 253 | 3300061734 | Ga0530510_0009858 | Ga0530510_0009858_2005_2670 | 221 |
| 254 | 3300061734 | Ga0530510_0020967 | Ga0530510_0020967_1354_2019 | 221 |
| 255 | iso_pu_bacteria | 2791355406 | 2793975290 | 221 |
| 256 | iso_pu_bacteria | 8047893842 | 8047900553 | 221 |
| 257 | iso_pu_bacteria | 8048356638 | 8048358349 | 221 |
| 258 | iso_pu_bacteria | 8048369669 | 8048377493 | 221 |
| 259 | iso_pu_bacteria | 8048379754 | 8048386591 | 221 |
| 260 | 3300005327 | Ga0070658_10167205 | Ga0070658_101672052 | 222 |
| 261 | 3300005329 | Ga0070683_100426284 | Ga0070683_1004262842 | 222 |
| 262 | 3300005356 | Ga0070674_100280002 | Ga0070674_1002800022 | 222 |
| 263 | 3300005366 | Ga0070659_100145991 | Ga0070659_1001459912 | 222 |
| 264 | 3300005436 | Ga0070713_100873452 | Ga0070713_1008734521 | 222 |
| 265 | 3300005455 | Ga0070663_100406052 | Ga0070663_1004060521 | 222 |
| 266 | 3300005457 | Ga0070662_100279092 | Ga0070662_1002790921 | 222 |
| 267 | 3300005518 | Ga0070699_100756683 | Ga0070699_1007566832 | 222 |
| 268 | 3300005535 | Ga0070684_100150171 | Ga0070684_1001501713 | 222 |
| 269 | 3300005535 | Ga0070684_100631378 | Ga0070684_1006313782 | 222 |
| 270 | 3300005536 | Ga0070697_100110630 | Ga0070697_1001106302 | 222 |
| 271 | 3300005615 | Ga0070702_100308501 | Ga0070702_1003085012 | 222 |
| 272 | 3300005616 | Ga0068852_100068387 | Ga0068852_1000683874 | 222 |
| 273 | 3300005719 | Ga0068861_100458385 | Ga0068861_1004583852 | 222 |
| 274 | 3300005937 | Ga0081455_10087914 | Ga0081455_100879142 | 222 |
| 275 | 3300011119 | Ga0105246_10926369 | Ga0105246_109263691 | 222 |
| 276 | 3300025909 | Ga0207705_10148417 | Ga0207705_101484172 | 222 |
| 277 | 3300025919 | Ga0207657_10471073 | Ga0207657_104710731 | 222 |
| 278 | 3300025920 | Ga0207649_10189872 | Ga0207649_101898723 | 222 |
| 279 | 3300025928 | Ga0207700_10536007 | Ga0207700_105360072 | 222 |
| 280 | 3300025944 | Ga0207661_10318622 | Ga0207661_103186222 | 222 |
| 281 | 3300026023 | Ga0207677_10349080 | Ga0207677_103490802 | 222 |
| 282 | 3300026116 | Ga0207674_10342550 | Ga0207674_103425502 | 222 |
| 283 | 3300026118 | Ga0207675_100474986 | Ga0207675_1004749862 | 222 |
| 284 | 3300026121 | Ga0207683_10456413 | Ga0207683_104564132 | 222 |
| 285 | 3300026142 | Ga0207698_11124577 | Ga0207698_111245771 | 222 |
| 286 | 3300031731 | Ga0307405_10589755 | Ga0307405_105897551 | 222 |
| 287 | 3300031824 | Ga0307413_10405346 | Ga0307413_104053462 | 222 |
| 288 | 3300031995 | Ga0307409_101036879 | Ga0307409_1010368791 | 222 |
| 289 | 3300032126 | Ga0307415_100669090 | Ga0307415_1006690901 | 222 |
| 290 | 3300037418 | Ga0395900_0235542 | Ga0395900_0235542_369_1043 | 222 |
| 291 | 3300037466 | Ga0395898_0068716 | Ga0395898_0068716_2693_3367 | 222 |
| 292 | 3300038443 | Ga0395901_0021241 | Ga0395901_0021241_1244_1918 | 222 |
| 293 | 3300039450 | Ga0436363_0936359 | Ga0436363_0936359_375_1046 | 222 |
| 294 | 3300041494 | Ga0451837_0199012 | Ga0451837_0199012_646_1353 | 222 |
| 295 | 3300044694 | Ga0466963_0069974 | Ga0466963_0069974_342_1010 | 222 |
| 296 | 3300044706 | Ga0466964_0015320 | Ga0466964_0015320_2190_2858 | 222 |
| 297 | 3300044735 | Ga0466968_0032795 | Ga0466968_0032795_1218_1892 | 222 |
| 298 | 3300044765 | Ga0466970_0259865 | Ga0466970_0259865_27_695 | 222 |
| 299 | 3300044901 | Ga0466960_0163557 | Ga0466960_0163557_225_899 | 222 |
| 300 | 3300045976 | Ga0466967_0011207 | Ga0466967_0011207_130_798 | 222 |
| 301 | 3300045976 | Ga0466967_0050443 | Ga0466967_0050443_581_1249 | 222 |
| 302 | 3300045976 | Ga0466967_0723810 | Ga0466967_0723810_268_936 | 222 |
| 303 | 3300046674 | Ga0495588_0069978 | Ga0495588_0069978_736_1404 | 222 |
| 304 | 3300048915 | Ga0496112_1017341 | Ga0496112_1017341_55_723 | 222 |
| 305 | 3300048924 | Ga0496121_0181465 | Ga0496121_0181465_792_1460 | 222 |
| 306 | 3300049571 | Ga0501034_0326431 | Ga0501034_0326431_336_1004 | 222 |
| 307 | 3300049575 | Ga0501039_0003643 | Ga0501039_0003643_5125_5793 | 222 |
| 308 | 3300049576 | Ga0501040_0056481 | Ga0501040_0056481_511_1179 | 222 |
| 309 | 3300049576 | Ga0501040_0130371 | Ga0501040_0130371_297_971 | 222 |
| 310 | 3300049578 | Ga0501042_0096001 | Ga0501042_0096001_762_1430 | 222 |
| 311 | 3300049588 | Ga0501072_0025305 | Ga0501072_0025305_1726_2394 | 222 |
| 312 | 3300049592 | Ga0501076_0086792 | Ga0501076_0086792_555_1223 | 222 |
| 313 | 3300049822 | Ga0501035_0309722 | Ga0501035_0309722_75_743 | 222 |
| 314 | 3300049824 | Ga0501045_0139177 | Ga0501045_0139177_886_1554 | 222 |
| 315 | 3300050514 | nmdc:mga08x19_636081_c1 | nmdc:mga08x19_636081_c1_62_730 | 222 |
| 316 | 3300053146 | Ga0500588_0126179 | Ga0500588_0126179_10_678 | 222 |
| 317 | 3300053153 | Ga0500616_0106578 | Ga0500616_0106578_103_771 | 222 |
| 318 | 3300005290 | Ga0065712_10134679 | Ga0065712_101346792 | 223 |
| 319 | 3300005617 | Ga0068859_100568932 | Ga0068859_1005689322 | 223 |
| 320 | 3300005842 | Ga0068858_100765347 | Ga0068858_1007653472 | 223 |
| 321 | 3300006914 | Ga0075436_100274265 | Ga0075436_1002742652 | 223 |
| 322 | 3300006931 | Ga0097620_100568864 | Ga0097620_1005688642 | 223 |
| 323 | 3300007076 | Ga0075435_100161829 | Ga0075435_1001618291 | 223 |
| 324 | 3300009094 | Ga0111539_11308523 | Ga0111539_113085232 | 223 |
| 325 | 3300009147 | Ga0114129_10177752 | Ga0114129_101777522 | 223 |
| 326 | 3300009147 | Ga0114129_10463333 | Ga0114129_104633332 | 223 |
| 327 | 3300014968 | Ga0157379_10098519 | Ga0157379_100985192 | 223 |
| 328 | 3300026035 | Ga0207703_10784658 | Ga0207703_107846581 | 223 |
| 329 | 3300039450 | Ga0436363_1563078 | Ga0436363_1563078_34_705 | 223 |
| 330 | 3300048913 | Ga0496110_0174763 | Ga0496110_0174763_408_1088 | 223 |
| 331 | 3300049569 | Ga0501032_0031810 | Ga0501032_0031810_2478_3149 | 223 |
| 332 | 3300049572 | Ga0501036_0001457 | Ga0501036_0001457_2243_2914 | 223 |
| 333 | 3300049573 | Ga0501037_0049852 | Ga0501037_0049852_255_926 | 223 |
| 334 | 3300049574 | Ga0501038_0055443 | Ga0501038_0055443_590_1261 | 223 |
| 335 | 3300049575 | Ga0501039_0101275 | Ga0501039_0101275_894_1565 | 223 |
| 336 | 3300049576 | Ga0501040_0048027 | Ga0501040_0048027_230_901 | 223 |
| 337 | 3300049577 | Ga0501041_0025760 | Ga0501041_0025760_2552_3223 | 223 |
| 338 | 3300049578 | Ga0501042_0039878 | Ga0501042_0039878_116_787 | 223 |
| 339 | 3300049579 | Ga0501043_0170030 | Ga0501043_0170030_128_799 | 223 |
| 340 | 3300049580 | Ga0501046_0103554 | Ga0501046_0103554_155_826 | 223 |
| 341 | 3300049582 | Ga0501048_0144990 | Ga0501048_0144990_115_786 | 223 |
| 342 | 3300049585 | Ga0501069_0189605 | Ga0501069_0189605_423_1094 | 223 |
| 343 | 3300049586 | Ga0501070_0014832 | Ga0501070_0014832_428_1099 | 223 |
| 344 | 3300049587 | Ga0501071_0066901 | Ga0501071_0066901_1484_2155 | 223 |
| 345 | 3300049588 | Ga0501072_0055650 | Ga0501072_0055650_230_901 | 223 |
| 346 | 3300049589 | Ga0501073_0002737 | Ga0501073_0002737_12126_12797 | 223 |
| 347 | 3300049590 | Ga0501074_0121445 | Ga0501074_0121445_1082_1753 | 223 |
| 348 | 3300049591 | Ga0501075_0138435 | Ga0501075_0138435_1082_1753 | 223 |
| 349 | 3300049592 | Ga0501076_0082896 | Ga0501076_0082896_1484_2155 | 223 |
| 350 | 3300049593 | Ga0501077_0030118 | Ga0501077_0030118_2552_3223 | 223 |
| 351 | 3300049741 | Ga0501079_0153559 | Ga0501079_0153559_894_1565 | 223 |
| 352 | 3300049742 | Ga0501080_0174268 | Ga0501080_0174268_1082_1753 | 223 |
| 353 | 3300049743 | Ga0501081_0313777 | Ga0501081_0313777_251_922 | 223 |
| 354 | 3300049744 | Ga0501083_0015377 | Ga0501083_0015377_2323_2994 | 223 |
| 355 | 3300049822 | Ga0501035_0020722 | Ga0501035_0020722_384_1055 | 223 |
| 356 | 3300049823 | Ga0501044_0332749 | Ga0501044_0332749_689_1360 | 223 |
| 357 | 3300049824 | Ga0501045_0116512 | Ga0501045_0116512_230_901 | 223 |
| 358 | 3300050507 | nmdc:mga05p37_482142_c1 | nmdc:mga05p37_482142_c1_185_865 | 223 |
| 359 | 3300050511 | nmdc:mga08y16_953155_c1 | nmdc:mga08y16_953155_c1_100_780 | 223 |
| 360 | 3300050512 | nmdc:mga0n895_57126_c1 | nmdc:mga0n895_57126_c1_2415_3086 | 223 |
| 361 | 3300050513 | nmdc:mga0rr50_135216_c1 | nmdc:mga0rr50_135216_c1_538_1209 | 223 |
| 362 | 3300050515 | nmdc:mga0a205_102371_c1 | nmdc:mga0a205_102371_c1_1238_1909 | 223 |
| 363 | 3300060353 | Ga0501082_0136813 | Ga0501082_0136813_1356_2027 | 223 |
| 364 | 3300005353 | Ga0070669_100475705 | Ga0070669_1004757051 | 224 |
| 365 | 3300005367 | Ga0070667_100000223 | Ga0070667_10000022326 | 224 |
| 366 | 3300005440 | Ga0070705_100096968 | Ga0070705_1000969682 | 224 |
| 367 | 3300005445 | Ga0070708_100364018 | Ga0070708_1003640181 | 224 |
| 368 | 3300005471 | Ga0070698_100000518 | Ga0070698_10000051834 | 224 |
| 369 | 3300005518 | Ga0070699_100003005 | Ga0070699_10000300514 | 224 |
| 370 | 3300005536 | Ga0070697_100274165 | Ga0070697_1002741652 | 224 |
| 371 | 3300005548 | Ga0070665_100005604 | Ga0070665_1000056045 | 224 |
| 372 | 3300005617 | Ga0068859_100000174 | Ga0068859_10000017417 | 224 |
| 373 | 3300005841 | Ga0068863_100032761 | Ga0068863_1000327612 | 224 |
| 374 | 3300005841 | Ga0068863_100848734 | Ga0068863_1008487342 | 224 |
| 375 | 3300005842 | Ga0068858_100003020 | Ga0068858_10000302018 | 224 |
| 376 | 3300005843 | Ga0068860_100000044 | Ga0068860_100000044134 | 224 |
| 377 | 3300005844 | Ga0068862_100000003 | Ga0068862_10000000398 | 224 |
| 378 | 3300005981 | Ga0081538_10000058 | Ga0081538_1000005896 | 224 |
| 379 | 3300006163 | Ga0070715_10050541 | Ga0070715_100505412 | 224 |
| 380 | 3300006173 | Ga0070716_100019767 | Ga0070716_1000197673 | 224 |
| 381 | 3300006175 | Ga0070712_100144546 | Ga0070712_1001445462 | 224 |
| 382 | 3300006852 | Ga0075433_10000817 | Ga0075433_100008177 | 224 |
| 383 | 3300006871 | Ga0075434_100001271 | Ga0075434_10000127117 | 224 |
| 384 | 3300006871 | Ga0075434_100227155 | Ga0075434_1002271552 | 224 |
| 385 | 3300006914 | Ga0075436_100009326 | Ga0075436_1000093265 | 224 |
| 386 | 3300006931 | Ga0097620_100000174 | Ga0097620_10000017417 | 224 |
| 387 | 3300007076 | Ga0075435_100003936 | Ga0075435_1000039365 | 224 |
| 388 | 3300009101 | Ga0105247_10000006 | Ga0105247_10000006223 | 224 |
| 389 | 3300009147 | Ga0114129_10162497 | Ga0114129_101624971 | 224 |
| 390 | 3300009177 | Ga0105248_10000042 | Ga0105248_10000042143 | 224 |
| 391 | 3300009553 | Ga0105249_10000008 | Ga0105249_10000008190 | 224 |
| 392 | 3300013306 | Ga0163162_10075007 | Ga0163162_100750073 | 224 |
| 393 | 3300014325 | Ga0163163_10026112 | Ga0163163_100261122 | 224 |
| 394 | 3300014968 | Ga0157379_10064509 | Ga0157379_100645092 | 224 |
| 395 | 3300025900 | Ga0207710_10000025 | Ga0207710_1000002565 | 224 |
| 396 | 3300025905 | Ga0207685_10017601 | Ga0207685_100176011 | 224 |
| 397 | 3300025906 | Ga0207699_10068340 | Ga0207699_100683402 | 224 |
| 398 | 3300025922 | Ga0207646_10029718 | Ga0207646_100297185 | 224 |
| 399 | 3300025923 | Ga0207681_10003522 | Ga0207681_100035222 | 224 |
| 400 | 3300025939 | Ga0207665_10002519 | Ga0207665_1000251910 | 224 |
| 401 | 3300025941 | Ga0207711_10000697 | Ga0207711_1000069718 | 224 |
| 402 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011131 | 224 |
| 403 | 3300025986 | Ga0207658_10000307 | Ga0207658_1000030732 | 224 |
| 404 | 3300026035 | Ga0207703_10006939 | Ga0207703_100069399 | 224 |
| 405 | 3300026088 | Ga0207641_10005680 | Ga0207641_100056805 | 224 |
| 406 | 3300026088 | Ga0207641_10174683 | Ga0207641_101746832 | 224 |
| 407 | 3300026118 | Ga0207675_100337725 | Ga0207675_1003377251 | 224 |
| 408 | 3300028380 | Ga0268265_10000010 | Ga0268265_1000001099 | 224 |
| 409 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007633 | 224 |
| 410 | 3300030521 | Ga0307511_10000494 | Ga0307511_1000049428 | 224 |
| 411 | 3300037466 | Ga0395898_0755317 | Ga0395898_0755317_140_826 | 224 |
| 412 | 3300038443 | Ga0395901_0190780 | Ga0395901_0190780_16_702 | 224 |
| 413 | 3300042876 | Ga0451577_0039770 | Ga0451577_0039770_996_1676 | 224 |
| 414 | 3300044683 | Ga0466965_0005651 | Ga0466965_0005651_3031_3705 | 224 |
| 415 | 3300044693 | Ga0466961_0084742 | Ga0466961_0084742_112_786 | 224 |
| 416 | 3300044694 | Ga0466963_0011503 | Ga0466963_0011503_1503_2177 | 224 |
| 417 | 3300044694 | Ga0466963_0032705 | Ga0466963_0032705_1551_2225 | 224 |
| 418 | 3300044719 | Ga0466971_0036214 | Ga0466971_0036214_1352_2026 | 224 |
| 419 | 3300044765 | Ga0466970_0168959 | Ga0466970_0168959_189_863 | 224 |
| 420 | 3300044842 | Ga0466957_0286027 | Ga0466957_0286027_198_872 | 224 |
| 421 | 3300044901 | Ga0466960_0025585 | Ga0466960_0025585_143_817 | 224 |
| 422 | 3300045049 | Ga0466959_0319021 | Ga0466959_0319021_152_826 | 224 |
| 423 | 3300046491 | Ga0495584_0199194 | Ga0495584_0199194_64_738 | 224 |
| 424 | 3300046615 | Ga0495656_0053442 | Ga0495656_0053442_417_1091 | 224 |
| 425 | 3300048903 | Ga0496100_0098453 | Ga0496100_0098453_57_746 | 224 |
| 426 | 3300048904 | Ga0496101_0020411 | Ga0496101_0020411_700_1389 | 224 |
| 427 | 3300048905 | Ga0496102_0000060 | Ga0496102_0000060_88042_88731 | 224 |
| 428 | 3300048906 | Ga0496103_0000500 | Ga0496103_0000500_19294_19983 | 224 |
| 429 | 3300048910 | Ga0496107_0083153 | Ga0496107_0083153_743_1432 | 224 |
| 430 | 3300048911 | Ga0496108_0330652 | Ga0496108_0330652_456_1145 | 224 |
| 431 | 3300048917 | Ga0496114_0241857 | Ga0496114_0241857_393_1082 | 224 |
| 432 | 3300048919 | Ga0496116_0046069 | Ga0496116_0046069_1484_2173 | 224 |
| 433 | 3300048920 | Ga0496117_0002026 | Ga0496117_0002026_4521_5210 | 224 |
| 434 | 3300048921 | Ga0496118_0001179 | Ga0496118_0001179_30290_30979 | 224 |
| 435 | 3300048922 | Ga0496119_0016754 | Ga0496119_0016754_718_1407 | 224 |
| 436 | 3300048923 | Ga0496120_0004413 | Ga0496120_0004413_7804_8493 | 224 |
| 437 | 3300048924 | Ga0496121_0085248 | Ga0496121_0085248_787_1476 | 224 |
| 438 | 3300048927 | Ga0496124_0088633 | Ga0496124_0088633_260_949 | 224 |
| 439 | 3300048928 | Ga0496125_0012912 | Ga0496125_0012912_5472_6161 | 224 |
| 440 | 3300048929 | Ga0496126_0008248 | Ga0496126_0008248_2044_2733 | 224 |
| 441 | 3300049583 | Ga0501067_0001773 | Ga0501067_0001773_9519_10202 | 224 |
| 442 | 3300049585 | Ga0501069_0025346 | Ga0501069_0025346_2208_2891 | 224 |
| 443 | 3300050507 | nmdc:mga05p37_10310_c1 | nmdc:mga05p37_10310_c1_9355_10032 | 224 |
| 444 | 3300050510 | nmdc:mga06r32_330200_c1 | nmdc:mga06r32_330200_c1_764_1438 | 224 |
| 445 | 3300050512 | nmdc:mga0n895_9556_c1 | nmdc:mga0n895_9556_c1_1070_1747 | 224 |
| 446 | 3300050513 | nmdc:mga0rr50_3537_c1 | nmdc:mga0rr50_3537_c1_5548_6225 | 224 |
| 447 | 3300050514 | nmdc:mga08x19_3507_c1 | nmdc:mga08x19_3507_c1_6234_6911 | 224 |
| 448 | 3300050515 | nmdc:mga0a205_20197_c1 | nmdc:mga0a205_20197_c1_5194_5871 | 224 |
| 449 | 3300061719 | Ga0466962_0004738 | Ga0466962_0004738_2391_3065 | 224 |
| 450 | 3300061734 | Ga0530510_0035126 | Ga0530510_0035126_2078_2761 | 224 |
| 451 | 3300005471 | Ga0070698_100011475 | Ga0070698_1000114754 | 225 |
| 452 | 3300005535 | Ga0070684_100452029 | Ga0070684_1004520291 | 225 |
| 453 | 3300005614 | Ga0068856_100913195 | Ga0068856_1009131952 | 225 |
| 454 | 3300005985 | Ga0081539_10003738 | Ga0081539_100037387 | 225 |
| 455 | 3300005985 | Ga0081539_10076839 | Ga0081539_100768392 | 225 |
| 456 | 3300006058 | Ga0075432_10001916 | Ga0075432_100019163 | 225 |
| 457 | 3300006194 | Ga0075427_10010851 | Ga0075427_100108512 | 225 |
| 458 | 3300006237 | Ga0097621_100254557 | Ga0097621_1002545572 | 225 |
| 459 | 3300006844 | Ga0075428_100203234 | Ga0075428_1002032342 | 225 |
| 460 | 3300006846 | Ga0075430_100017770 | Ga0075430_1000177702 | 225 |
| 461 | 3300006847 | Ga0075431_100137307 | Ga0075431_1001373072 | 225 |
| 462 | 3300006852 | Ga0075433_10060813 | Ga0075433_100608131 | 225 |
| 463 | 3300006871 | Ga0075434_100313659 | Ga0075434_1003136592 | 225 |
| 464 | 3300007076 | Ga0075435_100128729 | Ga0075435_1001287292 | 225 |
| 465 | 3300009094 | Ga0111539_10043947 | Ga0111539_100439474 | 225 |
| 466 | 3300009101 | Ga0105247_10705981 | Ga0105247_107059811 | 225 |
| 467 | 3300009147 | Ga0114129_10039391 | Ga0114129_100393914 | 225 |
| 468 | 3300009147 | Ga0114129_10621532 | Ga0114129_106215322 | 225 |
| 469 | 3300011119 | Ga0105246_10698399 | Ga0105246_106983991 | 225 |
| 470 | 3300013100 | Ga0157373_10589954 | Ga0157373_105899541 | 225 |
| 471 | 3300013105 | Ga0157369_10652771 | Ga0157369_106527711 | 225 |
| 472 | 3300013296 | Ga0157374_10911282 | Ga0157374_109112822 | 225 |
| 473 | 3300013308 | Ga0157375_10607816 | Ga0157375_106078162 | 225 |
| 474 | 3300014969 | Ga0157376_10807614 | Ga0157376_108076141 | 225 |
| 475 | 3300027907 | Ga0207428_10004233 | Ga0207428_100042335 | 225 |
| 476 | 3300037312 | Ga0395899_0040078 | Ga0395899_0040078_1112_1795 | 225 |
| 477 | 3300037312 | Ga0395899_0323239 | Ga0395899_0323239_306_983 | 225 |
| 478 | 3300037418 | Ga0395900_0056291 | Ga0395900_0056291_2205_2888 | 225 |
| 479 | 3300037466 | Ga0395898_0106523 | Ga0395898_0106523_1966_2643 | 225 |
| 480 | 3300037471 | Ga0395905_0075385 | Ga0395905_0075385_1878_2561 | 225 |
| 481 | 3300038443 | Ga0395901_0011587 | Ga0395901_0011587_3905_4588 | 225 |
| 482 | 3300039062 | Ga0400483_143088 | Ga0400483_143088_81_758 | 225 |
| 483 | 3300044694 | Ga0466963_0035507 | Ga0466963_0035507_1855_2532 | 225 |
| 484 | 3300044694 | Ga0466963_0605066 | Ga0466963_0605066_83_760 | 225 |
| 485 | 3300044719 | Ga0466971_0056136 | Ga0466971_0056136_204_881 | 225 |
| 486 | 3300044901 | Ga0466960_0131085 | Ga0466960_0131085_32_709 | 225 |
| 487 | 3300045049 | Ga0466959_0278242 | Ga0466959_0278242_382_1059 | 225 |
| 488 | 3300045836 | Ga0466958_0059539 | Ga0466958_0059539_785_1462 | 225 |
| 489 | 3300045976 | Ga0466967_0031038 | Ga0466967_0031038_1960_2637 | 225 |
| 490 | 3300045976 | Ga0466967_0195130 | Ga0466967_0195130_134_811 | 225 |
| 491 | 3300048907 | Ga0496104_0537280 | Ga0496104_0537280_70_747 | 225 |
| 492 | 3300048908 | Ga0496105_0529556 | Ga0496105_0529556_15_692 | 225 |
| 493 | 3300048914 | Ga0496111_0298048 | Ga0496111_0298048_41_718 | 225 |
| 494 | 3300049578 | Ga0501042_0112336 | Ga0501042_0112336_243_920 | 225 |
| 495 | 3300049592 | Ga0501076_0472224 | Ga0501076_0472224_154_831 | 225 |
| 496 | 3300050507 | nmdc:mga05p37_130523_c1 | nmdc:mga05p37_130523_c1_2139_2816 | 225 |
| 497 | 3300050507 | nmdc:mga05p37_142939_c1 | nmdc:mga05p37_142939_c1_1636_2313 | 225 |
| 498 | 3300050507 | nmdc:mga05p37_21214_c1 | nmdc:mga05p37_21214_c1_5617_6294 | 225 |
| 499 | 3300050508 | nmdc:mga09592_169501_c1 | nmdc:mga09592_169501_c1_402_1079 | 225 |
| 500 | 3300050509 | nmdc:mga0qj67_91666_c1 | nmdc:mga0qj67_91666_c1_98_775 | 225 |
| 501 | 3300050510 | nmdc:mga06r32_438984_c1 | nmdc:mga06r32_438984_c1_208_885 | 225 |
| 502 | 3300050511 | nmdc:mga08y16_45205_c1 | nmdc:mga08y16_45205_c1_1833_2510 | 225 |
| 503 | 3300050512 | nmdc:mga0n895_320921_c1 | nmdc:mga0n895_320921_c1_360_1037 | 225 |
| 504 | 3300050512 | nmdc:mga0n895_63695_c1 | nmdc:mga0n895_63695_c1_1264_1941 | 225 |
| 505 | 3300050513 | nmdc:mga0rr50_43998_c1 | nmdc:mga0rr50_43998_c1_1465_2142 | 225 |
| 506 | 3300050515 | nmdc:mga0a205_32312_c1 | nmdc:mga0a205_32312_c1_1264_1941 | 225 |
| 507 | 3300050515 | nmdc:mga0a205_33485_c1 | nmdc:mga0a205_33485_c1_2871_3548 | 225 |
| 508 | 3300061719 | Ga0466962_0070878 | Ga0466962_0070878_735_1412 | 225 |
| 509 | 3300005330 | Ga0070690_100220633 | Ga0070690_1002206331 | 226 |
| 510 | 3300005334 | Ga0068869_100055969 | Ga0068869_1000559691 | 226 |
| 511 | 3300005337 | Ga0070682_100124198 | Ga0070682_1001241982 | 226 |
| 512 | 3300005338 | Ga0068868_100030488 | Ga0068868_1000304882 | 226 |
| 513 | 3300005347 | Ga0070668_100326753 | Ga0070668_1003267532 | 226 |
| 514 | 3300005353 | Ga0070669_100120823 | Ga0070669_1001208232 | 226 |
| 515 | 3300005364 | Ga0070673_100579406 | Ga0070673_1005794062 | 226 |
| 516 | 3300005438 | Ga0070701_10072885 | Ga0070701_100728852 | 226 |
| 517 | 3300005441 | Ga0070700_100168651 | Ga0070700_1001686511 | 226 |
| 518 | 3300005444 | Ga0070694_100018986 | Ga0070694_1000189866 | 226 |
| 519 | 3300005456 | Ga0070678_100088450 | Ga0070678_1000884502 | 226 |
| 520 | 3300005456 | Ga0070678_100174377 | Ga0070678_1001743772 | 226 |
| 521 | 3300005459 | Ga0068867_100158097 | Ga0068867_1001580972 | 226 |
| 522 | 3300005471 | Ga0070698_100128964 | Ga0070698_1001289642 | 226 |
| 523 | 3300005544 | Ga0070686_100070463 | Ga0070686_1000704632 | 226 |
| 524 | 3300005546 | Ga0070696_100081602 | Ga0070696_1000816022 | 226 |
| 525 | 3300005549 | Ga0070704_100077141 | Ga0070704_1000771412 | 226 |
| 526 | 3300005549 | Ga0070704_100110388 | Ga0070704_1001103882 | 226 |
| 527 | 3300005564 | Ga0070664_100475507 | Ga0070664_1004755071 | 226 |
| 528 | 3300005617 | Ga0068859_100254743 | Ga0068859_1002547431 | 226 |
| 529 | 3300005617 | Ga0068859_100308206 | Ga0068859_1003082062 | 226 |
| 530 | 3300005618 | Ga0068864_100333323 | Ga0068864_1003333232 | 226 |
| 531 | 3300005840 | Ga0068870_10069329 | Ga0068870_100693292 | 226 |
| 532 | 3300005844 | Ga0068862_100188980 | Ga0068862_1001889802 | 226 |
| 533 | 3300005937 | Ga0081455_10048160 | Ga0081455_100481602 | 226 |
| 534 | 3300005937 | Ga0081455_10052144 | Ga0081455_100521442 | 226 |
| 535 | 3300005937 | Ga0081455_10085651 | Ga0081455_100856512 | 226 |
| 536 | 3300005981 | Ga0081538_10000068 | Ga0081538_1000006870 | 226 |
| 537 | 3300005981 | Ga0081538_10058172 | Ga0081538_100581723 | 226 |
| 538 | 3300005981 | Ga0081538_10089618 | Ga0081538_100896182 | 226 |
| 539 | 3300005983 | Ga0081540_1008210 | Ga0081540_100821010 | 226 |
| 540 | 3300005983 | Ga0081540_1123603 | Ga0081540_11236032 | 226 |
| 541 | 3300006038 | Ga0075365_10001599 | Ga0075365_100015992 | 226 |
| 542 | 3300006038 | Ga0075365_10004931 | Ga0075365_100049316 | 226 |
| 543 | 3300006051 | Ga0075364_10025626 | Ga0075364_100256262 | 226 |
| 544 | 3300006173 | Ga0070716_100026506 | Ga0070716_1000265062 | 226 |
| 545 | 3300006175 | Ga0070712_100004298 | Ga0070712_1000042985 | 226 |
| 546 | 3300006844 | Ga0075428_100166500 | Ga0075428_1001665002 | 226 |
| 547 | 3300006847 | Ga0075431_100035185 | Ga0075431_1000351852 | 226 |
| 548 | 3300006847 | Ga0075431_100091392 | Ga0075431_1000913922 | 226 |
| 549 | 3300006852 | Ga0075433_10000057 | Ga0075433_1000005732 | 226 |
| 550 | 3300006852 | Ga0075433_10000692 | Ga0075433_1000069215 | 226 |
| 551 | 3300006852 | Ga0075433_10073546 | Ga0075433_100735462 | 226 |
| 552 | 3300006852 | Ga0075433_10677539 | Ga0075433_106775392 | 226 |
| 553 | 3300006871 | Ga0075434_100000070 | Ga0075434_10000007041 | 226 |
| 554 | 3300006871 | Ga0075434_100016441 | Ga0075434_1000164414 | 226 |
| 555 | 3300006871 | Ga0075434_100041745 | Ga0075434_1000417453 | 226 |
| 556 | 3300006880 | Ga0075429_100000551 | Ga0075429_10000055110 | 226 |
| 557 | 3300006880 | Ga0075429_100269171 | Ga0075429_1002691712 | 226 |
| 558 | 3300006931 | Ga0097620_100254750 | Ga0097620_1002547501 | 226 |
| 559 | 3300006931 | Ga0097620_100308234 | Ga0097620_1003082342 | 226 |
| 560 | 3300007076 | Ga0075435_100147833 | Ga0075435_1001478332 | 226 |
| 561 | 3300009094 | Ga0111539_10006167 | Ga0111539_1000616716 | 226 |
| 562 | 3300009094 | Ga0111539_10194210 | Ga0111539_101942102 | 226 |
| 563 | 3300009094 | Ga0111539_10960808 | Ga0111539_109608081 | 226 |
| 564 | 3300009098 | Ga0105245_10256364 | Ga0105245_102563642 | 226 |
| 565 | 3300009098 | Ga0105245_10473949 | Ga0105245_104739492 | 226 |
| 566 | 3300009147 | Ga0114129_10003427 | Ga0114129_100034278 | 226 |
| 567 | 3300009147 | Ga0114129_10020642 | Ga0114129_100206426 | 226 |
| 568 | 3300009147 | Ga0114129_10056028 | Ga0114129_100560287 | 226 |
| 569 | 3300009147 | Ga0114129_10191292 | Ga0114129_101912922 | 226 |
| 570 | 3300009553 | Ga0105249_10042148 | Ga0105249_100421483 | 226 |
| 571 | 3300010375 | Ga0105239_10264408 | Ga0105239_102644083 | 226 |
| 572 | 3300010375 | Ga0105239_10686263 | Ga0105239_106862632 | 226 |
| 573 | 3300013297 | Ga0157378_10115802 | Ga0157378_101158022 | 226 |
| 574 | 3300013306 | Ga0163162_10748547 | Ga0163162_107485471 | 226 |
| 575 | 3300013308 | Ga0157375_10085668 | Ga0157375_100856684 | 226 |
| 576 | 3300014325 | Ga0163163_10539231 | Ga0163163_105392311 | 226 |
| 577 | 3300014745 | Ga0157377_10281418 | Ga0157377_102814181 | 226 |
| 578 | 3300014968 | Ga0157379_10091350 | Ga0157379_100913502 | 226 |
| 579 | 3300021384 | Ga0213876_10008534 | Ga0213876_100085341 | 226 |
| 580 | 3300025901 | Ga0207688_10026271 | Ga0207688_100262713 | 226 |
| 581 | 3300025901 | Ga0207688_10032083 | Ga0207688_100320832 | 226 |
| 582 | 3300025915 | Ga0207693_10003509 | Ga0207693_100035098 | 226 |
| 583 | 3300025916 | Ga0207663_10020210 | Ga0207663_100202102 | 226 |
| 584 | 3300025918 | Ga0207662_10395429 | Ga0207662_103954291 | 226 |
| 585 | 3300025923 | Ga0207681_10039925 | Ga0207681_100399252 | 226 |
| 586 | 3300025932 | Ga0207690_10140429 | Ga0207690_101404292 | 226 |
| 587 | 3300025933 | Ga0207706_10755230 | Ga0207706_107552301 | 226 |
| 588 | 3300025935 | Ga0207709_10337115 | Ga0207709_103371152 | 226 |
| 589 | 3300025940 | Ga0207691_10121496 | Ga0207691_101214962 | 226 |
| 590 | 3300025942 | Ga0207689_10211621 | Ga0207689_102116212 | 226 |
| 591 | 3300026121 | Ga0207683_10094478 | Ga0207683_100944783 | 226 |
| 592 | 3300026121 | Ga0207683_10135838 | Ga0207683_101358382 | 226 |
| 593 | 3300027907 | Ga0207428_10064722 | Ga0207428_100647223 | 226 |
| 594 | 3300027907 | Ga0207428_10222926 | Ga0207428_102229262 | 226 |
| 595 | 3300028379 | Ga0268266_11116063 | Ga0268266_111160631 | 226 |
| 596 | 3300028380 | Ga0268265_10171061 | Ga0268265_101710611 | 226 |
| 597 | 3300037312 | Ga0395899_0370446 | Ga0395899_0370446_100_783 | 226 |
| 598 | 3300037418 | Ga0395900_0006221 | Ga0395900_0006221_11605_12285 | 226 |
| 599 | 3300037418 | Ga0395900_0102383 | Ga0395900_0102383_1935_2615 | 226 |
| 600 | 3300037418 | Ga0395900_0224038 | Ga0395900_0224038_335_1015 | 226 |
| 601 | 3300037418 | Ga0395900_0253799 | Ga0395900_0253799_852_1535 | 226 |
| 602 | 3300037418 | Ga0395900_0773571 | Ga0395900_0773571_13_693 | 226 |
| 603 | 3300037466 | Ga0395898_0002063 | Ga0395898_0002063_23655_24335 | 226 |
| 604 | 3300037466 | Ga0395898_0015070 | Ga0395898_0015070_1972_2652 | 226 |
| 605 | 3300037466 | Ga0395898_0306852 | Ga0395898_0306852_568_1251 | 226 |
| 606 | 3300037471 | Ga0395905_0008033 | Ga0395905_0008033_3673_4353 | 226 |
| 607 | 3300037471 | Ga0395905_0214925 | Ga0395905_0214925_372_1052 | 226 |
| 608 | 3300038443 | Ga0395901_0008507 | Ga0395901_0008507_4637_5317 | 226 |
| 609 | 3300038443 | Ga0395901_0009883 | Ga0395901_0009883_2803_3483 | 226 |
| 610 | 3300038443 | Ga0395901_0137204 | Ga0395901_0137204_1661_2344 | 226 |
| 611 | 3300038443 | Ga0395901_0439690 | Ga0395901_0439690_513_1196 | 226 |
| 612 | 3300038443 | Ga0395901_0510093 | Ga0395901_0510093_109_792 | 226 |
| 613 | 3300038996 | Ga0242420_026583 | Ga0242420_026583_340_1026 | 226 |
| 614 | 3300042130 | Ga0450892_008350 | Ga0450892_008350_13_702 | 226 |
| 615 | 3300042530 | Ga0450916_004973 | Ga0450916_004973_446_1135 | 226 |
| 616 | 3300042876 | Ga0451577_0607297 | Ga0451577_0607297_229_924 | 226 |
| 617 | 3300044694 | Ga0466963_0023198 | Ga0466963_0023198_1982_2674 | 226 |
| 618 | 3300044735 | Ga0466968_0147930 | Ga0466968_0147930_13_744 | 226 |
| 619 | 3300045976 | Ga0466967_0307203 | Ga0466967_0307203_72_752 | 226 |
| 620 | 3300045976 | Ga0466967_0695030 | Ga0466967_0695030_167_895 | 226 |
| 621 | 3300046455 | Ga0495603_0099638 | Ga0495603_0099638_31_711 | 226 |
| 622 | 3300046460 | Ga0495638_0016925 | Ga0495638_0016925_1346_2026 | 226 |
| 623 | 3300046461 | Ga0495641_0050692 | Ga0495641_0050692_1167_1847 | 226 |
| 624 | 3300046461 | Ga0495641_0161695 | Ga0495641_0161695_53_733 | 226 |
| 625 | 3300046675 | Ga0495657_0175477 | Ga0495657_0175477_24_710 | 226 |
| 626 | 3300046683 | Ga0495658_0461387 | Ga0495658_0461387_110_790 | 226 |
| 627 | 3300047321 | Ga0495676_0117228 | Ga0495676_0117228_706_1386 | 226 |
| 628 | 3300048903 | Ga0496100_0000004 | Ga0496100_0000004_235336_236016 | 226 |
| 629 | 3300048903 | Ga0496100_0010810 | Ga0496100_0010810_1862_2542 | 226 |
| 630 | 3300048904 | Ga0496101_0000007 | Ga0496101_0000007_235336_236016 | 226 |
| 631 | 3300048904 | Ga0496101_0080653 | Ga0496101_0080653_939_1619 | 226 |
| 632 | 3300048905 | Ga0496102_0015718 | Ga0496102_0015718_3382_4062 | 226 |
| 633 | 3300048905 | Ga0496102_0139345 | Ga0496102_0139345_419_1099 | 226 |
| 634 | 3300048906 | Ga0496103_0003635 | Ga0496103_0003635_3505_4185 | 226 |
| 635 | 3300048908 | Ga0496105_0011383 | Ga0496105_0011383_4866_5546 | 226 |
| 636 | 3300048909 | Ga0496106_0000004 | Ga0496106_0000004_196750_197430 | 226 |
| 637 | 3300048909 | Ga0496106_0008284 | Ga0496106_0008284_3419_4099 | 226 |
| 638 | 3300048909 | Ga0496106_0355496 | Ga0496106_0355496_201_881 | 226 |
| 639 | 3300048910 | Ga0496107_0000001 | Ga0496107_0000001_235336_236016 | 226 |
| 640 | 3300048910 | Ga0496107_0283088 | Ga0496107_0283088_248_928 | 226 |
| 641 | 3300048911 | Ga0496108_0032225 | Ga0496108_0032225_1687_2367 | 226 |
| 642 | 3300048914 | Ga0496111_0020922 | Ga0496111_0020922_2493_3173 | 226 |
| 643 | 3300048914 | Ga0496111_0064521 | Ga0496111_0064521_734_1414 | 226 |
| 644 | 3300048915 | Ga0496112_0037377 | Ga0496112_0037377_293_973 | 226 |
| 645 | 3300048916 | Ga0496113_0006265 | Ga0496113_0006265_439_1119 | 226 |
| 646 | 3300048917 | Ga0496114_0002542 | Ga0496114_0002542_8098_8778 | 226 |
| 647 | 3300048918 | Ga0496115_0000815 | Ga0496115_0000815_16979_17659 | 226 |
| 648 | 3300049572 | Ga0501036_0064238 | Ga0501036_0064238_888_1577 | 226 |
| 649 | 3300049572 | Ga0501036_0298324 | Ga0501036_0298324_139_819 | 226 |
| 650 | 3300049572 | Ga0501036_0352087 | Ga0501036_0352087_537_1217 | 226 |
| 651 | 3300049577 | Ga0501041_0154381 | Ga0501041_0154381_728_1417 | 226 |
| 652 | 3300049580 | Ga0501046_0501763 | Ga0501046_0501763_151_840 | 226 |
| 653 | 3300049584 | Ga0501068_0275327 | Ga0501068_0275327_174_854 | 226 |
| 654 | 3300049584 | Ga0501068_0312935 | Ga0501068_0312935_73_756 | 226 |
| 655 | 3300049587 | Ga0501071_0127405 | Ga0501071_0127405_954_1643 | 226 |
| 656 | 3300049590 | Ga0501074_0112760 | Ga0501074_0112760_776_1465 | 226 |
| 657 | 3300049591 | Ga0501075_0130354 | Ga0501075_0130354_772_1452 | 226 |
| 658 | 3300049592 | Ga0501076_0029116 | Ga0501076_0029116_2127_2816 | 226 |
| 659 | 3300049592 | Ga0501076_0085597 | Ga0501076_0085597_1463_2152 | 226 |
| 660 | 3300049593 | Ga0501077_0309307 | Ga0501077_0309307_179_868 | 226 |
| 661 | 3300049741 | Ga0501079_0387385 | Ga0501079_0387385_232_921 | 226 |
| 662 | 3300049741 | Ga0501079_0406984 | Ga0501079_0406984_351_1031 | 226 |
| 663 | 3300050492 | nmdc:mga0yw44_140119_c1 | nmdc:mga0yw44_140119_c1_139_819 | 226 |
| 664 | 3300050492 | nmdc:mga0yw44_51785_c1 | nmdc:mga0yw44_51785_c1_1194_1874 | 226 |
| 665 | 3300050492 | nmdc:mga0yw44_88951_c1 | nmdc:mga0yw44_88951_c1_618_1298 | 226 |
| 666 | 3300050507 | nmdc:mga05p37_1215725_c1 | nmdc:mga05p37_1215725_c1_77_757 | 226 |
| 667 | 3300050507 | nmdc:mga05p37_147460_c1 | nmdc:mga05p37_147460_c1_1585_2271 | 226 |
| 668 | 3300050507 | nmdc:mga05p37_21516_c1 | nmdc:mga05p37_21516_c1_4916_5596 | 226 |
| 669 | 3300050507 | nmdc:mga05p37_48686_c1 | nmdc:mga05p37_48686_c1_2299_2979 | 226 |
| 670 | 3300050510 | nmdc:mga06r32_13499_c1 | nmdc:mga06r32_13499_c1_6209_6889 | 226 |
| 671 | 3300050510 | nmdc:mga06r32_79753_c1 | nmdc:mga06r32_79753_c1_885_1571 | 226 |
| 672 | 3300050511 | nmdc:mga08y16_80546_c1 | nmdc:mga08y16_80546_c1_519_1199 | 226 |
| 673 | 3300050512 | nmdc:mga0n895_56427_c1 | nmdc:mga0n895_56427_c1_1461_2141 | 226 |
| 674 | 3300050512 | nmdc:mga0n895_743_c1 | nmdc:mga0n895_743_c1_6235_6921 | 226 |
| 675 | 3300050513 | nmdc:mga0rr50_135655_c1 | nmdc:mga0rr50_135655_c1_524_1210 | 226 |
| 676 | 3300050513 | nmdc:mga0rr50_333702_c1 | nmdc:mga0rr50_333702_c1_375_1055 | 226 |
| 677 | 3300050515 | nmdc:mga0a205_115185_c1 | nmdc:mga0a205_115185_c1_781_1467 | 226 |
| 678 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_132895_133575 | 226 |
| 679 | 3300050515 | nmdc:mga0a205_22022_c1 | nmdc:mga0a205_22022_c1_1442_2122 | 226 |
| 680 | 3300050515 | nmdc:mga0a205_68679_c1 | nmdc:mga0a205_68679_c1_1529_2209 | 226 |
| 681 | 3300054114 | Ga0501084_0029398 | Ga0501084_0029398_285_974 | 226 |
| 682 | 3300054114 | Ga0501084_0660664 | Ga0501084_0660664_13_693 | 226 |
| 683 | 3300060353 | Ga0501082_0172521 | Ga0501082_0172521_158_847 | 226 |
| 684 | 3300061734 | Ga0530510_0005561 | Ga0530510_0005561_7676_8365 | 226 |
| 685 | 3300061734 | Ga0530510_0184960 | Ga0530510_0184960_399_1079 | 226 |
| 686 | 3300025936 | Ga0207670_10785840 | Ga0207670_107858401 | 227 |
| 687 | 3300041494 | Ga0451837_1576622 | Ga0451837_1576622_197_925 | 227 |
| 688 | 3300044684 | Ga0466966_0010361 | Ga0466966_0010361_2707_3432 | 228 |
| 689 | 3300044693 | Ga0466961_0040499 | Ga0466961_0040499_2169_2894 | 228 |
| 690 | 3300044694 | Ga0466963_0039164 | Ga0466963_0039164_2367_3092 | 228 |
| 691 | 3300044719 | Ga0466971_0003662 | Ga0466971_0003662_5797_6522 | 228 |
| 692 | 3300044842 | Ga0466957_0003743 | Ga0466957_0003743_388_1113 | 228 |
| 693 | 3300045836 | Ga0466958_0003197 | Ga0466958_0003197_4654_5379 | 228 |
| 694 | 3300060353 | Ga0501082_0589463 | Ga0501082_0589463_159_854 | 228 |
| 695 | 3300061719 | Ga0466962_0001045 | Ga0466962_0001045_6707_7432 | 228 |
| 696 | 3300003203 | JGI25406J46586_10016300 | JGI25406J46586_100163003 | 231 |
| 697 | 3300005985 | Ga0081539_10000062 | Ga0081539_10000062147 | 231 |
| 698 | 3300049588 | Ga0501072_0023500 | Ga0501072_0023500_2579_3355 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9807 | 5 | 123 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.979 | 7 | 124 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9787 | 5 | 123 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9786 | 7 | 124 |
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9776 | 5 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9987 | 6 | 85 | 3.40.50.2300 |
| af_O07776_147_246_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.989 | 131 | 228 | 1.10.10.10 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9818 | 6 | 85 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9806 | 5 | 85 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9787 | 3 | 122 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T3N0B4-F1-model_v4 | Response regulatory domain-containing protein | 0.9868 | 6 | 123 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C4IG96-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9827 | 7 | 120 |
GO:0000155
GO:0005886 GO:0009927 |
| AF-A0A6I5QSI8-F1-model_v4 | Response regulator | 0.9822 | 5 | 122 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A5C6EQA2-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9811 | 7 | 122 |
GO:0000155
GO:0005886 |
| AF-A0A3C0Z4C2-F1-model_v4 | DNA-binding response regulator | 0.979 | 6 | 122 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar