F475987

General Info

Members Datasets Scaffolds Average Seq Length
698 349 689 224

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0023500|Ga0501072_0023500_2579_3355
Length 258
Sequence VNATVGQGRVDLRNRLTAPNPAFHFSFILRRSLWCEDEVKMASLIRRGLRREGIAADVAIKGEDALWMAEATEYDAIVLDLMLPGIDGLEVCRRLRAEGVWSPILMLTARDAVRDRVAGLDGGADDYVTKPFSYAELLARLRALVRRGPAERPTQLEVGDLRLDPATRRVWRDDTEIELSAKEFAILEIFMRRAGEVLSRFQLLEHAWDYDYENRSNVVDSYVRFLRRKIDKPFGVESIETVRGAGYRLRDDGGGRES

Samples

Sample ID Description Type Environment
1 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
2 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
3 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
4 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
319 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
320 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
321 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
322 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
323 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
324 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
325 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
326 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
327 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
334 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
335 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
338 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
339 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
340 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
346 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
347 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
348 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
349 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.14
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 5.3
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016300 3300003203 Bacteria 3101
2 Ga0065712_10134679 3300005290 Bacteria 1487
3 Ga0070658_10167205 3300005327 Bacteria 1847
4 Ga0070683_100001023 3300005329 Bacteria 20987
5 Ga0070683_100426284 3300005329 Bacteria 1266
6 Ga0070690_100220633 3300005330 Bacteria 1328
7 Ga0068869_100055969 3300005334 Bacteria 2875
8 Ga0070680_100167508 3300005336 Bacteria 1848
9 Ga0070682_100124198 3300005337 Bacteria 1737
10 Ga0068868_100030488 3300005338 Bacteria 4136
11 Ga0070668_100326753 3300005347 Bacteria 1292
12 Ga0070669_100120823 3300005353 Bacteria 1998
13 Ga0070669_100475705 3300005353 Bacteria 1033
14 Ga0070674_100280002 3300005356 Bacteria 1321
15 Ga0070673_100579406 3300005364 Bacteria 1022
16 Ga0070659_100145991 3300005366 Bacteria 1927
17 Ga0070667_100000223 3300005367 Bacteria 65543
18 Ga0070709_10263492 3300005434 Bacteria 1246
19 Ga0070714_100177698 3300005435 Bacteria 1935
20 Ga0070713_100873452 3300005436 Bacteria 864
21 Ga0070701_10072885 3300005438 Bacteria 1840
22 Ga0070705_100096968 3300005440 Bacteria 1852
23 Ga0070700_100168651 3300005441 Bacteria 1514
24 Ga0070694_100018986 3300005444 Bacteria 4369
25 Ga0070708_100364018 3300005445 Bacteria 1363
26 Ga0070663_100406052 3300005455 Bacteria 1115
27 Ga0070663_100497112 3300005455 Bacteria 1012
28 Ga0070678_100088450 3300005456 Bacteria 2368
29 Ga0070678_100174377 3300005456 Bacteria 1754
30 Ga0070662_100279092 3300005457 Bacteria 1352
31 Ga0070681_10039140 3300005458 Bacteria 4753
32 Ga0068867_100158097 3300005459 Bacteria 1785
33 Ga0070698_100000518 3300005471 Bacteria 41042
34 Ga0070698_100011475 3300005471 Bacteria 9402
35 Ga0070698_100128964 3300005471 Bacteria 2485
36 Ga0070699_100003005 3300005518 Bacteria 14987
37 Ga0070699_100756683 3300005518 Bacteria 889
38 Ga0070679_100150861 3300005530 Bacteria 2301
39 Ga0070684_100150171 3300005535 Bacteria 2110
40 Ga0070684_100452029 3300005535 Bacteria 1187
41 Ga0070684_100631378 3300005535 Bacteria 997
42 Ga0070697_100110630 3300005536 Bacteria 2289
43 Ga0070697_100274165 3300005536 Bacteria 1446
44 Ga0070686_100002743 3300005544 Bacteria 9696
45 Ga0070686_100070463 3300005544 Bacteria 2286
46 Ga0070696_100081602 3300005546 Bacteria 2291
47 Ga0070665_100005604 3300005548 Bacteria 12910
48 Ga0070665_100309521 3300005548 Bacteria 1583
49 Ga0070704_100077141 3300005549 Bacteria 2440
50 Ga0070704_100110388 3300005549 Bacteria 2092
51 Ga0070664_100475507 3300005564 Bacteria 1149
52 Ga0068856_100197319 3300005614 Bacteria 2027
53 Ga0068856_100913195 3300005614 Bacteria 897
54 Ga0070702_100308501 3300005615 Bacteria 1098
55 Ga0068852_100068387 3300005616 Bacteria 3108
56 Ga0068852_100920085 3300005616 Bacteria 892
57 Ga0068859_100000174 3300005617 Bacteria 62740
58 Ga0068859_100254743 3300005617 Bacteria 1846
59 Ga0068859_100308206 3300005617 Bacteria 1677
60 Ga0068859_100568932 3300005617 Bacteria 1227
61 Ga0068864_100333323 3300005618 Bacteria 1428
62 Ga0068861_100458385 3300005719 Bacteria 1144
63 Ga0068870_10069329 3300005840 Bacteria 1918
64 Ga0068863_100032761 3300005841 Bacteria 4951
65 Ga0068863_100848734 3300005841 Bacteria 912
66 Ga0068858_100003020 3300005842 Bacteria 16880
67 Ga0068858_100765347 3300005842 Bacteria 941
68 Ga0068860_100000044 3300005843 Bacteria 225595
69 Ga0068862_100000003 3300005844 Bacteria 369793
70 Ga0068862_100188980 3300005844 Bacteria 1852
71 Ga0081455_10048160 3300005937 Bacteria 3685
72 Ga0081455_10052144 3300005937 Bacteria 3504
73 Ga0081455_10085651 3300005937 Bacteria 2569
74 Ga0081455_10087914 3300005937 Bacteria 2527
75 Ga0081455_10217123 3300005937 Bacteria 1420
76 Ga0081538_10000058 3300005981 Bacteria 102121
77 Ga0081538_10000068 3300005981 Bacteria 97659
78 Ga0081538_10009031 3300005981 Bacteria 8371
79 Ga0081538_10045943 3300005981 Bacteria 2701
80 Ga0081538_10058172 3300005981 Bacteria 2245
81 Ga0081538_10089618 3300005981 Bacteria 1596
82 Ga0081540_1008210 3300005983 Bacteria 7311
83 Ga0081540_1123603 3300005983 Bacteria 1069
84 Ga0081539_10000062 3300005985 Bacteria 249871
85 Ga0081539_10003738 3300005985 Bacteria 18103
86 Ga0081539_10076839 3300005985 Bacteria 1768
87 Ga0075365_10001599 3300006038 Bacteria 10423
88 Ga0075365_10004931 3300006038 Bacteria 7139
89 Ga0075364_10025626 3300006051 Bacteria 3754
90 Ga0075432_10001916 3300006058 Bacteria 6895
91 Ga0070715_10050541 3300006163 Bacteria 1785
92 Ga0070716_100019767 3300006173 Bacteria 3525
93 Ga0070716_100026506 3300006173 Bacteria 3105
94 Ga0070712_100004298 3300006175 Bacteria 8773
95 Ga0070712_100144546 3300006175 Bacteria 1819
96 Ga0070712_100252379 3300006175 Bacteria 1410
97 Ga0075427_10010851 3300006194 Bacteria 1368
98 Ga0097621_100254557 3300006237 Bacteria 1539
99 Ga0075428_100166500 3300006844 Bacteria 2391
100 Ga0075428_100203234 3300006844 Bacteria 2141
101 Ga0075430_100017770 3300006846 Bacteria 6054
102 Ga0075431_100035185 3300006847 Bacteria 5157
103 Ga0075431_100091392 3300006847 Bacteria 3142
104 Ga0075431_100137307 3300006847 Bacteria 2521
105 Ga0075431_100245311 3300006847 Bacteria 1821
106 Ga0075433_10000057 3300006852 Bacteria 48581
107 Ga0075433_10000692 3300006852 Bacteria 22971
108 Ga0075433_10000817 3300006852 Bacteria 21667
109 Ga0075433_10060813 3300006852 Bacteria 3308
110 Ga0075433_10073546 3300006852 Bacteria 3006
111 Ga0075433_10677539 3300006852 Bacteria 904
112 Ga0075434_100000070 3300006871 Bacteria 53323
113 Ga0075434_100001271 3300006871 Bacteria 21016
114 Ga0075434_100016441 3300006871 Bacteria 7112
115 Ga0075434_100041745 3300006871 Bacteria 4545
116 Ga0075434_100227155 3300006871 Bacteria 1886
117 Ga0075434_100313659 3300006871 Bacteria 1588
118 Ga0075429_100000551 3300006880 Bacteria 28615
119 Ga0075429_100269171 3300006880 Bacteria 1492
120 Ga0075436_100009326 3300006914 Bacteria 6712
121 Ga0075436_100274265 3300006914 Bacteria 1205
122 Ga0097620_100000174 3300006931 Bacteria 62740
123 Ga0097620_100254750 3300006931 Bacteria 1846
124 Ga0097620_100308234 3300006931 Bacteria 1677
125 Ga0097620_100568864 3300006931 Bacteria 1227
126 Ga0075435_100003936 3300007076 Bacteria 10154
127 Ga0075435_100128729 3300007076 Bacteria 2117
128 Ga0075435_100147833 3300007076 Bacteria 1974
129 Ga0075435_100161829 3300007076 Bacteria 1885
130 Ga0105240_10003784 3300009093 Bacteria 23373
131 Ga0111539_10006167 3300009094 Bacteria 15472
132 Ga0111539_10043947 3300009094 Bacteria 5354
133 Ga0111539_10194210 3300009094 Bacteria 2368
134 Ga0111539_10960808 3300009094 Bacteria 993
135 Ga0111539_11308523 3300009094 Bacteria 841
136 Ga0105245_10256364 3300009098 Bacteria 1701
137 Ga0105245_10473949 3300009098 Bacteria 1264
138 Ga0105247_10000006 3300009101 Bacteria 416061
139 Ga0105247_10564892 3300009101 Bacteria 838
140 Ga0105247_10705981 3300009101 Bacteria 760
141 Ga0114129_10003427 3300009147 Bacteria 22298
142 Ga0114129_10020642 3300009147 Bacteria 9366
143 Ga0114129_10039391 3300009147 Bacteria 6662
144 Ga0114129_10056028 3300009147 Bacteria 5524
145 Ga0114129_10162497 3300009147 Bacteria 3049
146 Ga0114129_10177752 3300009147 Bacteria 2898
147 Ga0114129_10191292 3300009147 Bacteria 2778
148 Ga0114129_10463333 3300009147 Bacteria 1661
149 Ga0114129_10621532 3300009147 Bacteria 1397
150 Ga0105248_10000042 3300009177 Bacteria 167583
151 Ga0105237_10003213 3300009545 Bacteria 19575
152 Ga0105238_10139425 3300009551 Bacteria 2402
153 Ga0105249_10000008 3300009553 Bacteria 341271
154 Ga0105249_10042148 3300009553 Bacteria 4150
155 Ga0105239_10002098 3300010375 Bacteria 25810
156 Ga0105239_10264408 3300010375 Bacteria 1934
157 Ga0105239_10686263 3300010375 Bacteria 1171
158 Ga0105246_10698399 3300011119 Bacteria 889
159 Ga0105246_10926369 3300011119 Bacteria 783
160 Ga0157373_10589954 3300013100 Bacteria 808
161 Ga0157369_10652771 3300013105 Bacteria 1085
162 Ga0157374_10911282 3300013296 Bacteria 897
163 Ga0157378_10115802 3300013297 Bacteria 2464
164 Ga0163162_10075007 3300013306 Bacteria 3442
165 Ga0163162_10748547 3300013306 Bacteria 1097
166 Ga0157372_10102699 3300013307 Bacteria 3266
167 Ga0157372_10493931 3300013307 Bacteria 1427
168 Ga0157375_10085668 3300013308 Bacteria 3201
169 Ga0157375_10607816 3300013308 Bacteria 1252
170 Ga0163163_10026112 3300014325 Bacteria 5578
171 Ga0163163_10539231 3300014325 Bacteria 1229
172 Ga0157377_10281418 3300014745 Bacteria 1090
173 Ga0157379_10064509 3300014968 Bacteria 3273
174 Ga0157379_10091350 3300014968 Bacteria 2731
175 Ga0157379_10098519 3300014968 Bacteria 2624
176 Ga0157376_10807614 3300014969 Bacteria 951
177 Ga0213874_10149487 3300021377 Bacteria 814
178 Ga0213876_10002484 3300021384 Bacteria 10824
179 Ga0213876_10008534 3300021384 Bacteria 5547
180 Ga0213875_10010077 3300021388 Bacteria 4749
181 Ga0224712_10151098 3300022467 Bacteria 1029
182 Ga0207710_10000025 3300025900 Bacteria 314658
183 Ga0207688_10026271 3300025901 Bacteria 3201
184 Ga0207688_10032083 3300025901 Bacteria 2902
185 Ga0207685_10017601 3300025905 Bacteria 2315
186 Ga0207699_10068340 3300025906 Bacteria 2163
187 Ga0207705_10148417 3300025909 Bacteria 1755
188 Ga0207707_10080111 3300025912 Bacteria 2851
189 Ga0207695_10021148 3300025913 Bacteria 7432
190 Ga0207671_10254159 3300025914 Bacteria 1382
191 Ga0207693_10003509 3300025915 Bacteria 13395
192 Ga0207663_10020210 3300025916 Bacteria 3768
193 Ga0207660_10089411 3300025917 Bacteria 2280
194 Ga0207662_10395429 3300025918 Bacteria 936
195 Ga0207657_10471073 3300025919 Bacteria 985
196 Ga0207649_10189872 3300025920 Bacteria 1444
197 Ga0207652_10063291 3300025921 Bacteria 3199
198 Ga0207646_10029718 3300025922 Bacteria 4963
199 Ga0207681_10003522 3300025923 Bacteria 9749
200 Ga0207681_10039925 3300025923 Bacteria 3120
201 Ga0207694_10038810 3300025924 Bacteria 3662
202 Ga0207700_10536007 3300025928 Bacteria 1038
203 Ga0207690_10140429 3300025932 Bacteria 1779
204 Ga0207706_10755230 3300025933 Bacteria 828
205 Ga0207709_10337115 3300025935 Bacteria 1134
206 Ga0207670_10785840 3300025936 Bacteria 792
207 Ga0207665_10002519 3300025939 Bacteria 12318
208 Ga0207691_10121496 3300025940 Bacteria 2314
209 Ga0207711_10000697 3300025941 Bacteria 33164
210 Ga0207689_10211621 3300025942 Bacteria 1602
211 Ga0207661_10000165 3300025944 Bacteria 43066
212 Ga0207661_10318622 3300025944 Bacteria 1397
213 Ga0207712_10000011 3300025961 Bacteria 412321
214 Ga0207658_10000307 3300025986 Bacteria 50415
215 Ga0207677_10349080 3300026023 Bacteria 1239
216 Ga0207703_10006939 3300026035 Bacteria 9013
217 Ga0207703_10784658 3300026035 Bacteria 909
218 Ga0207702_10086087 3300026078 Bacteria 2740
219 Ga0207641_10005680 3300026088 Bacteria 10618
220 Ga0207641_10174683 3300026088 Bacteria 1964
221 Ga0207641_10489469 3300026088 Bacteria 1193
222 Ga0207674_10342550 3300026116 Bacteria 1445
223 Ga0207675_100337725 3300026118 Bacteria 1474
224 Ga0207675_100474986 3300026118 Bacteria 1242
225 Ga0207683_10094478 3300026121 Bacteria 2665
226 Ga0207683_10135838 3300026121 Bacteria 2214
227 Ga0207683_10456413 3300026121 Bacteria 1178
228 Ga0207698_11124577 3300026142 Bacteria 798
229 Ga0207428_10004233 3300027907 Bacteria 13743
230 Ga0207428_10064722 3300027907 Bacteria 2886
231 Ga0207428_10222926 3300027907 Bacteria 1412
232 Ga0268266_11116063 3300028379 Bacteria 763
233 Ga0268265_10000010 3300028380 Bacteria 370129
234 Ga0268265_10171061 3300028380 Bacteria 1857
235 Ga0268264_10000007 3300028381 Bacteria 815790
236 Ga0268264_10248645 3300028381 Bacteria 1651
237 Ga0307517_10012865 3300028786 Bacteria 11430
238 Ga0307517_10032621 3300028786 Bacteria 6012
239 Ga0307515_10000163 3300028794 Bacteria 163159
240 Ga0307515_10164805 3300028794 Bacteria 2240
241 Ga0307515_10234109 3300028794 Bacteria 1622
242 Ga0307511_10000494 3300030521 Bacteria 42578
243 Ga0307511_10000801 3300030521 Bacteria 33509
244 Ga0307511_10120475 3300030521 Bacteria 1625
245 Ga0307512_10001435 3300030522 Bacteria 33817
246 Ga0307512_10058755 3300030522 Bacteria 2992
247 Ga0307513_10034717 3300031456 Bacteria 5654
248 Ga0307513_10050056 3300031456 Bacteria 4520
249 Ga0307513_10123893 3300031456 Bacteria 2545
250 Ga0307513_10161848 3300031456 Bacteria 2129
251 Ga0307509_10020007 3300031507 Bacteria 7610
252 Ga0307509_10039639 3300031507 Bacteria 5130
253 Ga0307408_100082670 3300031548 Bacteria 2404
254 Ga0307508_10014309 3300031616 Bacteria 7236
255 Ga0307508_10052288 3300031616 Bacteria 3629
256 Ga0307508_10099898 3300031616 Bacteria 2496
257 Ga0307514_10023148 3300031649 Bacteria 5044
258 Ga0316576_10056436 3300031727 Bacteria 2868
259 Ga0307516_10015329 3300031730 Bacteria 8066
260 Ga0307405_10589755 3300031731 Bacteria 905
261 Ga0307413_10405346 3300031824 Bacteria 1070
262 Ga0307406_10105694 3300031901 Bacteria 1927
263 Ga0307409_101036879 3300031995 Bacteria 839
264 Ga0307415_100669090 3300032126 Bacteria 933
265 Ga0307507_10005111 3300033179 Bacteria 22037
266 Ga0307507_10025071 3300033179 Bacteria 6476
267 Ga0307510_10017005 3300033180 Bacteria 8581
268 Ga0373945_0055237 3300035116 Bacteria 1470
269 Ga0373955_0062090 3300035172 Bacteria 2066
270 Ga0316584_0131404 3300036712 Bacteria 1870
271 Ga0395899_0040078 3300037312 Bacteria 3504
272 Ga0395899_0323239 3300037312 Bacteria 1039
273 Ga0395899_0370446 3300037312 Bacteria 954
274 Ga0395900_0006221 3300037418 Bacteria 12464
275 Ga0395900_0056291 3300037418 Bacteria 4048
276 Ga0395900_0102383 3300037418 Bacteria 2942
277 Ga0395900_0224038 3300037418 Bacteria 1894
278 Ga0395900_0235542 3300037418 Bacteria 1839
279 Ga0395900_0253799 3300037418 Bacteria 1759
280 Ga0395900_0773571 3300037418 Bacteria 889
281 Ga0395898_0002063 3300037466 Bacteria 25012
282 Ga0395898_0015070 3300037466 Bacteria 7936
283 Ga0395898_0068716 3300037466 Bacteria 3428
284 Ga0395898_0106523 3300037466 Bacteria 2689
285 Ga0395898_0306852 3300037466 Bacteria 1514
286 Ga0395898_0755317 3300037466 Bacteria 914
287 Ga0395905_0008033 3300037471 Bacteria 10426
288 Ga0395905_0075385 3300037471 Bacteria 3162
289 Ga0395905_0128247 3300037471 Bacteria 2386
290 Ga0395905_0214925 3300037471 Bacteria 1801
291 Ga0436364_0034902 3300037853 Bacteria 12619
292 Ga0395901_0008507 3300038443 Bacteria 10370
293 Ga0395901_0009883 3300038443 Bacteria 9672
294 Ga0395901_0011587 3300038443 Bacteria 8934
295 Ga0395901_0021241 3300038443 Bacteria 6649
296 Ga0395901_0137204 3300038443 Bacteria 2570
297 Ga0395901_0190780 3300038443 Bacteria 2149
298 Ga0395901_0439690 3300038443 Bacteria 1335
299 Ga0395901_0510093 3300038443 Bacteria 1223
300 Ga0242420_026583 3300038996 Bacteria 1057
301 Ga0400483_143088 3300039062 Bacteria 1250
302 Ga0436365_0418544 3300039437 Bacteria 5953
303 Ga0436365_1447684 3300039437 Bacteria 34467
304 Ga0436363_0708183 3300039450 Bacteria 1614
305 Ga0436363_0743096 3300039450 Bacteria 1030
306 Ga0436363_0936359 3300039450 Bacteria 1228
307 Ga0436363_1563078 3300039450 Bacteria 742
308 Ga0436362_0942942 3300039453 Bacteria 2294
309 Ga0451837_0199012 3300041494 Bacteria 3502
310 Ga0451837_1576622 3300041494 Bacteria 1113
311 Ga0450892_008350 3300042130 Bacteria 883
312 Ga0450916_004973 3300042530 Bacteria 1520
313 Ga0451577_0039770 3300042876 Bacteria 4225
314 Ga0451577_0607297 3300042876 Bacteria 993
315 Ga0466965_0005651 3300044683 Bacteria 5642
316 Ga0466965_0153501 3300044683 Bacteria 1204
317 Ga0466966_0010361 3300044684 Bacteria 6188
318 Ga0466966_0303688 3300044684 Bacteria 959
319 Ga0466961_0040499 3300044693 Bacteria 2987
320 Ga0466961_0084742 3300044693 Bacteria 2004
321 Ga0466963_0011503 3300044694 Bacteria 5390
322 Ga0466963_0023198 3300044694 Bacteria 3936
323 Ga0466963_0032705 3300044694 Bacteria 3370
324 Ga0466963_0035507 3300044694 Bacteria 3248
325 Ga0466963_0039164 3300044694 Bacteria 3103
326 Ga0466963_0069974 3300044694 Bacteria 2360
327 Ga0466963_0135672 3300044694 Bacteria 1702
328 Ga0466963_0222415 3300044694 Bacteria 1322
329 Ga0466963_0605066 3300044694 Bacteria 774
330 Ga0466964_0015320 3300044706 Bacteria 2917
331 Ga0466971_0003662 3300044719 Bacteria 6572
332 Ga0466971_0036214 3300044719 Bacteria 2213
333 Ga0466971_0056136 3300044719 Bacteria 1776
334 Ga0466968_0029833 3300044735 Bacteria 2257
335 Ga0466968_0032795 3300044735 Bacteria 2162
336 Ga0466968_0147930 3300044735 Bacteria 1078
337 Ga0466970_0168959 3300044765 Bacteria 1211
338 Ga0466970_0259865 3300044765 Bacteria 974
339 Ga0466957_0003743 3300044842 Bacteria 8406
340 Ga0466957_0286027 3300044842 Bacteria 1104
341 Ga0466960_0025585 3300044901 Bacteria 2672
342 Ga0466960_0131085 3300044901 Bacteria 1323
343 Ga0466960_0163557 3300044901 Bacteria 1196
344 Ga0466959_0278242 3300045049 Bacteria 1149
345 Ga0466959_0319021 3300045049 Bacteria 1062
346 Ga0466959_0364863 3300045049 Bacteria 984
347 Ga0466958_0003197 3300045836 Bacteria 8449
348 Ga0466958_0059539 3300045836 Bacteria 2323
349 Ga0466958_0175435 3300045836 Bacteria 1359
350 Ga0466967_0011207 3300045976 Bacteria 6776
351 Ga0466967_0031038 3300045976 Bacteria 4493
352 Ga0466967_0050443 3300045976 Bacteria 3644
353 Ga0466967_0195130 3300045976 Bacteria 1915
354 Ga0466967_0307203 3300045976 Bacteria 1527
355 Ga0466967_0695030 3300045976 Bacteria 1007
356 Ga0466967_0723810 3300045976 Bacteria 986
357 Ga0495592_0001429 3300046454 Bacteria 16573
358 Ga0495592_0011840 3300046454 Bacteria 6607
359 Ga0495603_0099638 3300046455 Bacteria 1697
360 Ga0495629_0100871 3300046459 Bacteria 2014
361 Ga0495629_0153332 3300046459 Bacteria 1601
362 Ga0495629_0178483 3300046459 Bacteria 1472
363 Ga0495638_0016925 3300046460 Bacteria 4874
364 Ga0495638_0458505 3300046460 Bacteria 649
365 Ga0495641_0036246 3300046461 Bacteria 2319
366 Ga0495641_0050692 3300046461 Bacteria 1897
367 Ga0495641_0161695 3300046461 Bacteria 1001
368 Ga0495651_0003189 3300046462 Bacteria 12609
369 Ga0495651_0020082 3300046462 Bacteria 5185
370 Ga0495651_0047909 3300046462 Bacteria 3301
371 Ga0495653_0010780 3300046463 Bacteria 7484
372 Ga0495653_0265686 3300046463 Bacteria 1132
373 Ga0495582_0054187 3300046473 Bacteria 2212
374 Ga0495662_0006967 3300046476 Bacteria 5617
375 Ga0495662_0024405 3300046476 Bacteria 2917
376 Ga0495664_0000570 3300046477 Bacteria 18511
377 Ga0495664_0003276 3300046477 Bacteria 8801
378 Ga0495584_0199194 3300046491 Bacteria 1018
379 Ga0495608_0033506 3300046511 Bacteria 3470
380 Ga0495608_0035457 3300046511 Bacteria 3365
381 Ga0495618_0144431 3300046514 Bacteria 1521
382 Ga0495628_0013118 3300046516 Bacteria 6977
383 Ga0495628_0030865 3300046516 Bacteria 4337
384 Ga0495628_0082218 3300046516 Bacteria 2501
385 Ga0495630_0001009 3300046517 Bacteria 19504
386 Ga0495630_0173220 3300046517 Bacteria 1644
387 Ga0495630_0176522 3300046517 Bacteria 1628
388 Ga0495632_0078164 3300046519 Bacteria 1581
389 Ga0495643_0002747 3300046522 Bacteria 13517
390 Ga0495666_0001180 3300046526 Bacteria 12574
391 Ga0495652_0174380 3300046529 Bacteria 1656
392 Ga0495652_0363247 3300046529 Bacteria 1034
393 Ga0495665_0124723 3300046531 Bacteria 1348
394 Ga0495640_0010017 3300046533 Bacteria 7349
395 Ga0495640_0010089 3300046533 Bacteria 7321
396 Ga0495640_0025254 3300046533 Bacteria 4312
397 Ga0495586_0085245 3300046535 Bacteria 1740
398 Ga0495587_0020918 3300046536 Bacteria 4036
399 Ga0495587_0022547 3300046536 Bacteria 3876
400 Ga0495645_0009902 3300046543 Bacteria 6670
401 Ga0495645_0032965 3300046543 Bacteria 3778
402 Ga0495622_0086664 3300046557 Bacteria 1440
403 Ga0495667_0011057 3300046559 Bacteria 6103
404 Ga0495667_0115710 3300046559 Bacteria 1732
405 Ga0495656_0053442 3300046615 Bacteria 1736
406 Ga0495634_0002883 3300046642 Bacteria 14108
407 Ga0495634_0015084 3300046642 Bacteria 5554
408 Ga0495634_0029640 3300046642 Bacteria 3787
409 Ga0495635_0004228 3300046663 Bacteria 9957
410 Ga0495635_0038686 3300046663 Bacteria 3301
411 Ga0495588_0038469 3300046674 Bacteria 2433
412 Ga0495588_0069978 3300046674 Bacteria 1824
413 Ga0495657_0011045 3300046675 Bacteria 6771
414 Ga0495657_0033976 3300046675 Bacteria 3545
415 Ga0495657_0175477 3300046675 Bacteria 1318
416 Ga0495657_0265421 3300046675 Bacteria 1030
417 Ga0495599_0079066 3300046678 Bacteria 2053
418 Ga0495599_0170704 3300046678 Bacteria 1342
419 Ga0495599_0461554 3300046678 Bacteria 751
420 Ga0495623_0024618 3300046679 Bacteria 3876
421 Ga0495646_0002533 3300046680 Bacteria 11230
422 Ga0495646_0004122 3300046680 Bacteria 9123
423 Ga0495646_0193009 3300046680 Bacteria 1112
424 Ga0495658_0069007 3300046683 Bacteria 2048
425 Ga0495658_0461387 3300046683 Bacteria 812
426 Ga0495613_0001149 3300046689 Bacteria 20199
427 Ga0495613_0001262 3300046689 Bacteria 19287
428 Ga0495613_0115036 3300046689 Bacteria 1936
429 Ga0495624_0090309 3300046690 Bacteria 1890
430 Ga0495670_0022785 3300046691 Bacteria 3093
431 Ga0495671_0006048 3300046692 Bacteria 7034
432 Ga0495600_0025515 3300046809 Bacteria 3809
433 Ga0495600_0046346 3300046809 Bacteria 2836
434 Ga0495600_0203305 3300046809 Bacteria 1271
435 Ga0495660_0061919 3300046810 Bacteria 2007
436 Ga0495581_0029246 3300047315 Bacteria 3194
437 Ga0495604_0001320 3300047317 Bacteria 20245
438 Ga0495604_0003274 3300047317 Bacteria 12943
439 Ga0495604_0070049 3300047317 Bacteria 2657
440 Ga0495636_0008797 3300047318 Bacteria 3979
441 Ga0495674_0000568 3300047319 Bacteria 34477
442 Ga0495674_0017715 3300047319 Bacteria 6631
443 Ga0495676_0011223 3300047321 Bacteria 8099
444 Ga0495676_0117228 3300047321 Bacteria 1943
445 Ga0495680_0000393 3300047322 Bacteria 48867
446 Ga0495683_0230133 3300047323 Bacteria 822
447 Ga0495687_003574 3300047443 Bacteria 11151
448 Ga0495687_019625 3300047443 Bacteria 3311
449 Ga0495685_002401 3300047447 Bacteria 5871
450 Ga0495681_0003284 3300047470 Bacteria 11278
451 Ga0495684_0014945 3300047471 Bacteria 5979
452 Ga0495684_0018965 3300047471 Bacteria 5296
453 Ga0495684_0022203 3300047471 Bacteria 4886
454 Ga0495686_0117098 3300047472 Bacteria 1592
455 Ga0495686_0287729 3300047472 Bacteria 911
456 Ga0495593_0008831 3300047673 Bacteria 5850
457 Ga0495593_0031569 3300047673 Bacteria 2893
458 Ga0495602_0049695 3300048088 Bacteria 3754
459 Ga0495614_0017478 3300048089 Bacteria 3115
460 Ga0496100_0000004 3300048903 Bacteria 321778
461 Ga0496100_0010810 3300048903 Bacteria 5179
462 Ga0496100_0098453 3300048903 Bacteria 2010
463 Ga0496101_0000007 3300048904 Bacteria 321778
464 Ga0496101_0020411 3300048904 Bacteria 4535
465 Ga0496101_0080653 3300048904 Bacteria 2404
466 Ga0496102_0000060 3300048905 Bacteria 167774
467 Ga0496102_0015718 3300048905 Bacteria 6594
468 Ga0496102_0139345 3300048905 Bacteria 2274
469 Ga0496103_0000500 3300048906 Bacteria 32364
470 Ga0496103_0003635 3300048906 Bacteria 9395
471 Ga0496104_0537280 3300048907 Bacteria 1080
472 Ga0496105_0011383 3300048908 Bacteria 7027
473 Ga0496105_0529556 3300048908 Bacteria 922
474 Ga0496106_0000004 3300048909 Bacteria 279896
475 Ga0496106_0008284 3300048909 Bacteria 7692
476 Ga0496106_0355496 3300048909 Bacteria 1177
477 Ga0496107_0000001 3300048910 Bacteria 321778
478 Ga0496107_0083153 3300048910 Bacteria 2334
479 Ga0496107_0283088 3300048910 Bacteria 1234
480 Ga0496108_0032225 3300048911 Bacteria 4352
481 Ga0496108_0330652 3300048911 Bacteria 1329
482 Ga0496110_0174763 3300048913 Bacteria 1949
483 Ga0496110_0844618 3300048913 Bacteria 821
484 Ga0496111_0020922 3300048914 Bacteria 4561
485 Ga0496111_0064521 3300048914 Bacteria 2657
486 Ga0496111_0298048 3300048914 Bacteria 1195
487 Ga0496111_0688734 3300048914 Bacteria 744
488 Ga0496112_0037377 3300048915 Bacteria 4739
489 Ga0496112_1017341 3300048915 Bacteria 748
490 Ga0496113_0006265 3300048916 Bacteria 7518
491 Ga0496113_0089085 3300048916 Bacteria 2375
492 Ga0496114_0002542 3300048917 Bacteria 13922
493 Ga0496114_0241857 3300048917 Bacteria 1587
494 Ga0496115_0000815 3300048918 Bacteria 22850
495 Ga0496115_0270508 3300048918 Bacteria 1396
496 Ga0496116_0046069 3300048919 Bacteria 2946
497 Ga0496117_0002026 3300048920 Bacteria 26844
498 Ga0496118_0001179 3300048921 Bacteria 40343
499 Ga0496119_0016754 3300048922 Bacteria 5554
500 Ga0496120_0004413 3300048923 Bacteria 11807
501 Ga0496121_0085248 3300048924 Bacteria 2487
502 Ga0496121_0181465 3300048924 Bacteria 1519
503 Ga0496124_0088633 3300048927 Bacteria 2528
504 Ga0496125_0003753 3300048928 Bacteria 18091
505 Ga0496125_0012912 3300048928 Bacteria 8246
506 Ga0496126_0008248 3300048929 Bacteria 11251
507 Ga0501031_0073698 3300049568 Bacteria 2223
508 Ga0501031_0389206 3300049568 Bacteria 902
509 Ga0501032_0031810 3300049569 Bacteria 3617
510 Ga0501033_0102558 3300049570 Bacteria 2087
511 Ga0501033_0210416 3300049570 Bacteria 1387
512 Ga0501034_0326431 3300049571 Bacteria 1467
513 Ga0501036_0001457 3300049572 Bacteria 18189
514 Ga0501036_0017262 3300049572 Bacteria 6032
515 Ga0501036_0045229 3300049572 Bacteria 3730
516 Ga0501036_0064238 3300049572 Bacteria 3107
517 Ga0501036_0298324 3300049572 Bacteria 1348
518 Ga0501036_0352087 3300049572 Bacteria 1230
519 Ga0501037_0049852 3300049573 Bacteria 3065
520 Ga0501038_0055443 3300049574 Bacteria 3404
521 Ga0501039_0003396 3300049575 Bacteria 11900
522 Ga0501039_0003643 3300049575 Bacteria 11549
523 Ga0501039_0101275 3300049575 Bacteria 2248
524 Ga0501040_0000515 3300049576 Bacteria 23152
525 Ga0501040_0006488 3300049576 Bacteria 7598
526 Ga0501040_0048027 3300049576 Bacteria 2916
527 Ga0501040_0056481 3300049576 Bacteria 2694
528 Ga0501040_0130371 3300049576 Bacteria 1768
529 Ga0501041_0017542 3300049577 Bacteria 4259
530 Ga0501041_0023411 3300049577 Bacteria 3704
531 Ga0501041_0025760 3300049577 Bacteria 3535
532 Ga0501041_0154381 3300049577 Bacteria 1434
533 Ga0501042_0019543 3300049578 Bacteria 4706
534 Ga0501042_0039878 3300049578 Bacteria 3338
535 Ga0501042_0096001 3300049578 Bacteria 2130
536 Ga0501042_0112336 3300049578 Bacteria 1962
537 Ga0501043_0170030 3300049579 Bacteria 1700
538 Ga0501046_0019768 3300049580 Bacteria 5580
539 Ga0501046_0103554 3300049580 Bacteria 2181
540 Ga0501046_0137248 3300049580 Bacteria 1852
541 Ga0501046_0501763 3300049580 Bacteria 869
542 Ga0501048_0009811 3300049582 Bacteria 7178
543 Ga0501048_0109180 3300049582 Bacteria 1953
544 Ga0501048_0144990 3300049582 Bacteria 1679
545 Ga0501067_0001773 3300049583 Bacteria 11851
546 Ga0501068_0275327 3300049584 Bacteria 1075
547 Ga0501068_0312935 3300049584 Bacteria 1006
548 Ga0501069_0025346 3300049585 Bacteria 3240
549 Ga0501069_0189605 3300049585 Bacteria 1189
550 Ga0501070_0014832 3300049586 Bacteria 6556
551 Ga0501071_0001164 3300049587 Bacteria 14751
552 Ga0501071_0045033 3300049587 Bacteria 3166
553 Ga0501071_0066901 3300049587 Bacteria 2612
554 Ga0501071_0127405 3300049587 Bacteria 1890
555 Ga0501072_0000894 3300049588 Bacteria 21861
556 Ga0501072_0003415 3300049588 Bacteria 11964
557 Ga0501072_0023500 3300049588 Bacteria 4789
558 Ga0501072_0025305 3300049588 Bacteria 4623
559 Ga0501072_0055650 3300049588 Bacteria 3117
560 Ga0501073_0002737 3300049589 Bacteria 13216
561 Ga0501073_0348937 3300049589 Bacteria 1022
562 Ga0501074_0009393 3300049590 Bacteria 7108
563 Ga0501074_0030239 3300049590 Bacteria 3925
564 Ga0501074_0112760 3300049590 Bacteria 1946
565 Ga0501074_0121445 3300049590 Bacteria 1868
566 Ga0501075_0003952 3300049591 Bacteria 9988
567 Ga0501075_0004349 3300049591 Bacteria 9582
568 Ga0501075_0130354 3300049591 Bacteria 1916
569 Ga0501075_0138435 3300049591 Bacteria 1854
570 Ga0501075_0372971 3300049591 Bacteria 1088
571 Ga0501076_0003103 3300049592 Bacteria 11568
572 Ga0501076_0007818 3300049592 Bacteria 7792
573 Ga0501076_0029116 3300049592 Bacteria 4293
574 Ga0501076_0082896 3300049592 Bacteria 2574
575 Ga0501076_0085597 3300049592 Bacteria 2533
576 Ga0501076_0086792 3300049592 Bacteria 2515
577 Ga0501076_0472224 3300049592 Bacteria 1033
578 Ga0501077_0027075 3300049593 Bacteria 3640
579 Ga0501077_0030118 3300049593 Bacteria 3452
580 Ga0501077_0078121 3300049593 Bacteria 2097
581 Ga0501077_0309307 3300049593 Bacteria 1007
582 Ga0501079_0002701 3300049741 Bacteria 12919
583 Ga0501079_0153559 3300049741 Bacteria 1794
584 Ga0501079_0276149 3300049741 Bacteria 1314
585 Ga0501079_0387385 3300049741 Bacteria 1096
586 Ga0501079_0406984 3300049741 Bacteria 1067
587 Ga0501080_0174268 3300049742 Bacteria 1982
588 Ga0501080_0322871 3300049742 Bacteria 1397
589 Ga0501081_0016708 3300049743 Bacteria 4852
590 Ga0501081_0032249 3300049743 Bacteria 3553
591 Ga0501081_0313777 3300049743 Bacteria 1151
592 Ga0501083_0015377 3300049744 Bacteria 5360
593 Ga0501035_0020722 3300049822 Bacteria 6042
594 Ga0501035_0055381 3300049822 Bacteria 3541
595 Ga0501035_0056570 3300049822 Bacteria 3499
596 Ga0501035_0309722 3300049822 Bacteria 1329
597 Ga0501044_0332749 3300049823 Bacteria 1441
598 Ga0501045_0004075 3300049824 Bacteria 10084
599 Ga0501045_0116512 3300049824 Bacteria 1982
600 Ga0501045_0139177 3300049824 Bacteria 1805
601 nmdc:mga0yw44_140119_c1 3300050492 Bacteria 1571
602 nmdc:mga0yw44_51785_c1 3300050492 Bacteria 2487
603 nmdc:mga0yw44_88951_c1 3300050492 Bacteria 1948
604 nmdc:mga05p37_10310_c1 3300050507 Bacteria 11097
605 nmdc:mga05p37_1215725_c1 3300050507 Bacteria 777
606 nmdc:mga05p37_130523_c1 3300050507 Bacteria 3083
607 nmdc:mga05p37_142939_c1 3300050507 Bacteria 2931
608 nmdc:mga05p37_147460_c1 3300050507 Bacteria 2880
609 nmdc:mga05p37_21214_c1 3300050507 Bacteria 7864
610 nmdc:mga05p37_21516_c1 3300050507 Bacteria 7812
611 nmdc:mga05p37_482142_c1 3300050507 Bacteria 1428
612 nmdc:mga05p37_48686_c1 3300050507 Bacteria 5212
613 nmdc:mga09592_169501_c1 3300050508 Bacteria 1888
614 nmdc:mga0qj67_91666_c1 3300050509 Bacteria 2443
615 nmdc:mga06r32_13499_c1 3300050510 Bacteria 7403
616 nmdc:mga06r32_330200_c1 3300050510 Bacteria 1510
617 nmdc:mga06r32_438984_c1 3300050510 Bacteria 1286
618 nmdc:mga06r32_79753_c1 3300050510 Bacteria 3184
619 nmdc:mga08y16_45205_c1 3300050511 Bacteria 4614
620 nmdc:mga08y16_80546_c1 3300050511 Bacteria 3395
621 nmdc:mga08y16_953155_c1 3300050511 Bacteria 841
622 nmdc:mga0n895_320921_c1 3300050512 Bacteria 1570
623 nmdc:mga0n895_56427_c1 3300050512 Bacteria 3869
624 nmdc:mga0n895_57126_c1 3300050512 Bacteria 3846
625 nmdc:mga0n895_63695_c1 3300050512 Bacteria 3646
626 nmdc:mga0n895_743_c1 3300050512 Bacteria 23050
627 nmdc:mga0n895_9556_c1 3300050512 Bacteria 8493
628 nmdc:mga0rr50_135216_c1 3300050513 Bacteria 1978
629 nmdc:mga0rr50_135655_c1 3300050513 Bacteria 1975
630 nmdc:mga0rr50_333702_c1 3300050513 Bacteria 1273
631 nmdc:mga0rr50_3537_c1 3300050513 Bacteria 9016
632 nmdc:mga0rr50_43998_c1 3300050513 Bacteria 3272
633 nmdc:mga08x19_3507_c1 3300050514 Bacteria 9335
634 nmdc:mga08x19_636081_c1 3300050514 Bacteria 756
635 nmdc:mga0a205_102371_c1 3300050515 Bacteria 2762
636 nmdc:mga0a205_115185_c1 3300050515 Bacteria 2587
637 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
638 nmdc:mga0a205_20197_c1 3300050515 Bacteria 6284
639 nmdc:mga0a205_22022_c1 3300050515 Bacteria 2198
640 nmdc:mga0a205_32312_c1 3300050515 Bacteria 5019
641 nmdc:mga0a205_33485_c1 3300050515 Bacteria 4926
642 nmdc:mga0a205_68679_c1 3300050515 Bacteria 3422
643 Ga0495601_0087095 3300053077 Bacteria 2008
644 Ga0495655_0113043 3300053083 Bacteria 818
645 Ga0495619_0040632 3300053085 Bacteria 3040
646 Ga0495619_0180766 3300053085 Bacteria 1459
647 Ga0500578_0012444 3300053086 Bacteria 5489
648 Ga0500640_023966 3300053095 Bacteria 2647
649 Ga0500654_058339 3300053099 Bacteria 2002
650 Ga0500660_039633 3300053100 Bacteria 2405
651 Ga0500553_136757 3300053101 Bacteria 975
652 Ga0500560_000468 3300053107 Bacteria 5622
653 Ga0500569_001500 3300053109 Bacteria 4422
654 Ga0500572_088713 3300053111 Bacteria 977
655 Ga0500614_004794 3300053123 Bacteria 2845
656 Ga0500614_018592 3300053123 Bacteria 1583
657 Ga0500628_005693 3300053129 Bacteria 2089
658 Ga0500652_007135 3300053131 Bacteria 3639
659 Ga0500658_0033416 3300053134 Bacteria 2022
660 Ga0500559_0165501 3300053136 Bacteria 1040
661 Ga0500561_0000775 3300053137 Bacteria 5069
662 Ga0500573_0114554 3300053140 Bacteria 1506
663 Ga0500577_0068266 3300053142 Bacteria 1388
664 Ga0500588_0126179 3300053146 Bacteria 907
665 Ga0500600_0001718 3300053149 Bacteria 11846
666 Ga0500603_036123 3300053150 Bacteria 1299
667 Ga0500616_0106578 3300053153 Bacteria 1361
668 Ga0500624_006191 3300053157 Bacteria 1613
669 Ga0500633_0025426 3300053160 Bacteria 1851
670 Ga0500634_0001300 3300053161 Bacteria 9512
671 Ga0500656_001260 3300053732 Bacteria 2149
672 Ga0501084_0004385 3300054114 Bacteria 11502
673 Ga0501084_0029398 3300054114 Bacteria 4597
674 Ga0501084_0081060 3300054114 Bacteria 2721
675 Ga0501084_0660664 3300054114 Bacteria 882
676 Ga0501082_0070632 3300060353 Bacteria 3006
677 Ga0501082_0105889 3300060353 Bacteria 2433
678 Ga0501082_0136813 3300060353 Bacteria 2125
679 Ga0501082_0172521 3300060353 Bacteria 1880
680 Ga0501082_0589463 3300060353 Bacteria 973
681 Ga0466962_0001045 3300061719 Bacteria 12703
682 Ga0466962_0004738 3300061719 Bacteria 6537
683 Ga0466962_0070878 3300061719 Bacteria 1665
684 Ga0466962_0118825 3300061719 Bacteria 1275
685 Ga0530510_0005561 3300061734 Bacteria 8734
686 Ga0530510_0009858 3300061734 Bacteria 6701
687 Ga0530510_0020967 3300061734 Bacteria 4647
688 Ga0530510_0035126 3300061734 Bacteria 3612
689 Ga0530510_0184960 3300061734 Bacteria 1546

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033179 Ga0307507_10025071 Ga0307507_100250711 193
2 3300046460 Ga0495638_0458505 Ga0495638_0458505_33_620 193
3 3300053150 Ga0500603_036123 Ga0500603_036123_685_1278 193
4 3300005937 Ga0081455_10217123 Ga0081455_102171232 208
5 3300005329 Ga0070683_100001023 Ga0070683_10000102312 209
6 3300049568 Ga0501031_0389206 Ga0501031_0389206_12_647 211
7 3300031727 Ga0316576_10056436 Ga0316576_100564363 213
8 3300036712 Ga0316584_0131404 Ga0316584_0131404_455_1111 213
9 3300005544 Ga0070686_100002743 Ga0070686_1000027439 214
10 3300021377 Ga0213874_10149487 Ga0213874_101494871 214
11 3300048928 Ga0496125_0003753 Ga0496125_0003753_584_1237 214
12 3300028381 Ga0268264_10248645 Ga0268264_102486452 215
13 3300031548 Ga0307408_100082670 Ga0307408_1000826702 215
14 3300031901 Ga0307406_10105694 Ga0307406_101056942 215
15 iso_pu_bacteria 8047710418 8047719701 215
16 3300028794 Ga0307515_10164805 Ga0307515_101648053 216
17 3300031456 Ga0307513_10050056 Ga0307513_100500564 216
18 3300031616 Ga0307508_10099898 Ga0307508_100998981 216
19 3300035116 Ga0373945_0055237 Ga0373945_0055237_437_1093 216
20 3300044694 Ga0466963_0222415 Ga0466963_0222415_420_1070 216
21 3300045836 Ga0466958_0175435 Ga0466958_0175435_22_672 216
22 3300046454 Ga0495592_0011840 Ga0495592_0011840_3392_4048 216
23 3300046459 Ga0495629_0178483 Ga0495629_0178483_263_919 216
24 3300046462 Ga0495651_0003189 Ga0495651_0003189_8735_9391 216
25 3300046473 Ga0495582_0054187 Ga0495582_0054187_1125_1781 216
26 3300046476 Ga0495662_0024405 Ga0495662_0024405_1349_2005 216
27 3300046477 Ga0495664_0000570 Ga0495664_0000570_1116_1772 216
28 3300046514 Ga0495618_0144431 Ga0495618_0144431_635_1291 216
29 3300046517 Ga0495630_0176522 Ga0495630_0176522_906_1562 216
30 3300046529 Ga0495652_0174380 Ga0495652_0174380_167_823 216
31 3300046533 Ga0495640_0025254 Ga0495640_0025254_3605_4261 216
32 3300046535 Ga0495586_0085245 Ga0495586_0085245_554_1210 216
33 3300046536 Ga0495587_0020918 Ga0495587_0020918_1957_2613 216
34 3300046543 Ga0495645_0009902 Ga0495645_0009902_738_1394 216
35 3300046557 Ga0495622_0086664 Ga0495622_0086664_744_1400 216
36 3300046642 Ga0495634_0002883 Ga0495634_0002883_7783_8439 216
37 3300046663 Ga0495635_0004228 Ga0495635_0004228_6120_6776 216
38 3300046674 Ga0495588_0038469 Ga0495588_0038469_310_966 216
39 3300046675 Ga0495657_0011045 Ga0495657_0011045_4742_5398 216
40 3300046678 Ga0495599_0170704 Ga0495599_0170704_350_1006 216
41 3300046680 Ga0495646_0002533 Ga0495646_0002533_9320_9976 216
42 3300046689 Ga0495613_0001262 Ga0495613_0001262_12683_13339 216
43 3300046690 Ga0495624_0090309 Ga0495624_0090309_55_711 216
44 3300046692 Ga0495671_0006048 Ga0495671_0006048_1154_1810 216
45 3300046809 Ga0495600_0025515 Ga0495600_0025515_1130_1786 216
46 3300047315 Ga0495581_0029246 Ga0495581_0029246_513_1169 216
47 3300047317 Ga0495604_0003274 Ga0495604_0003274_3182_3838 216
48 3300047321 Ga0495676_0011223 Ga0495676_0011223_6321_6977 216
49 3300047470 Ga0495681_0003284 Ga0495681_0003284_5965_6621 216
50 3300047471 Ga0495684_0022203 Ga0495684_0022203_3353_4009 216
51 3300047472 Ga0495686_0287729 Ga0495686_0287729_32_688 216
52 3300047673 Ga0495593_0008831 Ga0495593_0008831_3589_4245 216
53 3300048088 Ga0495602_0049695 Ga0495602_0049695_1424_2080 216
54 3300048089 Ga0495614_0017478 Ga0495614_0017478_1242_1898 216
55 3300053083 Ga0495655_0113043 Ga0495655_0113043_48_704 216
56 3300053085 Ga0495619_0180766 Ga0495619_0180766_156_812 216
57 3300053095 Ga0500640_023966 Ga0500640_023966_885_1541 216
58 3300053107 Ga0500560_000468 Ga0500560_000468_3905_4561 216
59 3300053111 Ga0500572_088713 Ga0500572_088713_51_707 216
60 3300053123 Ga0500614_018592 Ga0500614_018592_728_1384 216
61 3300053136 Ga0500559_0165501 Ga0500559_0165501_302_958 216
62 3300053140 Ga0500573_0114554 Ga0500573_0114554_120_776 216
63 3300053157 Ga0500624_006191 Ga0500624_006191_882_1538 216
64 iso_pu_bacteria 2899359706 2899368960 216
65 iso_pu_bacteria 2808606522 2809590728 217
66 iso_pu_bacteria 2867346516 2867347304 217
67 3300005434 Ga0070709_10263492 Ga0070709_102634921 218
68 3300005435 Ga0070714_100177698 Ga0070714_1001776982 218
69 3300005455 Ga0070663_100497112 Ga0070663_1004971121 218
70 3300005548 Ga0070665_100309521 Ga0070665_1003095212 218
71 3300005614 Ga0068856_100197319 Ga0068856_1001973192 218
72 3300006175 Ga0070712_100252379 Ga0070712_1002523792 218
73 3300009093 Ga0105240_10003784 Ga0105240_1000378414 218
74 3300009101 Ga0105247_10564892 Ga0105247_105648921 218
75 3300009545 Ga0105237_10003213 Ga0105237_1000321311 218
76 3300009551 Ga0105238_10139425 Ga0105238_101394252 218
77 3300010375 Ga0105239_10002098 Ga0105239_100020986 218
78 3300013307 Ga0157372_10102699 Ga0157372_101026992 218
79 3300013307 Ga0157372_10493931 Ga0157372_104939311 218
80 3300021388 Ga0213875_10010077 Ga0213875_100100774 218
81 3300022467 Ga0224712_10151098 Ga0224712_101510982 218
82 3300025913 Ga0207695_10021148 Ga0207695_100211482 218
83 3300025914 Ga0207671_10254159 Ga0207671_102541592 218
84 3300025924 Ga0207694_10038810 Ga0207694_100388102 218
85 3300026078 Ga0207702_10086087 Ga0207702_100860872 218
86 3300035172 Ga0373955_0062090 Ga0373955_0062090_995_1657 218
87 3300037853 Ga0436364_0034902 Ga0436364_0034902_935_1591 218
88 3300039450 Ga0436363_0743096 Ga0436363_0743096_241_897 218
89 3300046462 Ga0495651_0020082 Ga0495651_0020082_2012_2674 218
90 3300046463 Ga0495653_0265686 Ga0495653_0265686_230_892 218
91 3300046511 Ga0495608_0035457 Ga0495608_0035457_2359_3021 218
92 3300046516 Ga0495628_0030865 Ga0495628_0030865_2110_2772 218
93 3300046517 Ga0495630_0001009 Ga0495630_0001009_13463_14125 218
94 3300046533 Ga0495640_0010017 Ga0495640_0010017_2497_3159 218
95 3300046559 Ga0495667_0011057 Ga0495667_0011057_4053_4715 218
96 3300046642 Ga0495634_0029640 Ga0495634_0029640_2850_3512 218
97 3300046675 Ga0495657_0265421 Ga0495657_0265421_290_952 218
98 3300046678 Ga0495599_0461554 Ga0495599_0461554_25_687 218
99 3300046809 Ga0495600_0203305 Ga0495600_0203305_390_1052 218
100 3300047317 Ga0495604_0070049 Ga0495604_0070049_1952_2614 218
101 3300047319 Ga0495674_0000568 Ga0495674_0000568_31374_32036 218
102 3300047322 Ga0495680_0000393 Ga0495680_0000393_711_1373 218
103 3300047471 Ga0495684_0014945 Ga0495684_0014945_1469_2131 218
104 3300048913 Ga0496110_0844618 Ga0496110_0844618_44_700 218
105 3300048914 Ga0496111_0688734 Ga0496111_0688734_11_667 218
106 3300048916 Ga0496113_0089085 Ga0496113_0089085_842_1498 218
107 3300048918 Ga0496115_0270508 Ga0496115_0270508_509_1171 218
108 3300053077 Ga0495601_0087095 Ga0495601_0087095_1213_1875 218
109 3300061719 Ga0466962_0118825 Ga0466962_0118825_355_1011 218
110 3300028786 Ga0307517_10012865 Ga0307517_100128652 219
111 3300028786 Ga0307517_10032621 Ga0307517_100326213 219
112 3300028794 Ga0307515_10000163 Ga0307515_10000163141 219
113 3300028794 Ga0307515_10234109 Ga0307515_102341092 219
114 3300030521 Ga0307511_10000801 Ga0307511_1000080122 219
115 3300030521 Ga0307511_10120475 Ga0307511_101204752 219
116 3300030522 Ga0307512_10001435 Ga0307512_1000143527 219
117 3300030522 Ga0307512_10058755 Ga0307512_100587552 219
118 3300031456 Ga0307513_10034717 Ga0307513_100347173 219
119 3300031456 Ga0307513_10161848 Ga0307513_101618482 219
120 3300031507 Ga0307509_10020007 Ga0307509_100200075 219
121 3300031507 Ga0307509_10039639 Ga0307509_100396394 219
122 3300031616 Ga0307508_10014309 Ga0307508_100143092 219
123 3300031616 Ga0307508_10052288 Ga0307508_100522882 219
124 3300031649 Ga0307514_10023148 Ga0307514_100231484 219
125 3300031730 Ga0307516_10015329 Ga0307516_100153294 219
126 3300033179 Ga0307507_10005111 Ga0307507_1000511111 219
127 3300033180 Ga0307510_10017005 Ga0307510_100170056 219
128 3300046454 Ga0495592_0001429 Ga0495592_0001429_9482_10147 219
129 3300046459 Ga0495629_0100871 Ga0495629_0100871_819_1490 219
130 3300046459 Ga0495629_0153332 Ga0495629_0153332_458_1150 219
131 3300046461 Ga0495641_0036246 Ga0495641_0036246_1516_2181 219
132 3300046462 Ga0495651_0047909 Ga0495651_0047909_2263_2928 219
133 3300046463 Ga0495653_0010780 Ga0495653_0010780_3076_3741 219
134 3300046476 Ga0495662_0006967 Ga0495662_0006967_2497_3162 219
135 3300046477 Ga0495664_0003276 Ga0495664_0003276_7039_7704 219
136 3300046511 Ga0495608_0033506 Ga0495608_0033506_344_1009 219
137 3300046516 Ga0495628_0013118 Ga0495628_0013118_443_1108 219
138 3300046516 Ga0495628_0082218 Ga0495628_0082218_956_1621 219
139 3300046517 Ga0495630_0173220 Ga0495630_0173220_540_1205 219
140 3300046519 Ga0495632_0078164 Ga0495632_0078164_773_1444 219
141 3300046522 Ga0495643_0002747 Ga0495643_0002747_2542_3213 219
142 3300046526 Ga0495666_0001180 Ga0495666_0001180_2490_3155 219
143 3300046531 Ga0495665_0124723 Ga0495665_0124723_368_1033 219
144 3300046533 Ga0495640_0010089 Ga0495640_0010089_344_1009 219
145 3300046536 Ga0495587_0022547 Ga0495587_0022547_949_1614 219
146 3300046543 Ga0495645_0032965 Ga0495645_0032965_2270_2935 219
147 3300046559 Ga0495667_0115710 Ga0495667_0115710_583_1248 219
148 3300046642 Ga0495634_0015084 Ga0495634_0015084_3203_3868 219
149 3300046663 Ga0495635_0038686 Ga0495635_0038686_2263_2928 219
150 3300046675 Ga0495657_0033976 Ga0495657_0033976_2507_3172 219
151 3300046678 Ga0495599_0079066 Ga0495599_0079066_949_1614 219
152 3300046679 Ga0495623_0024618 Ga0495623_0024618_2263_2928 219
153 3300046680 Ga0495646_0004122 Ga0495646_0004122_2439_3104 219
154 3300046680 Ga0495646_0193009 Ga0495646_0193009_96_761 219
155 3300046683 Ga0495658_0069007 Ga0495658_0069007_291_962 219
156 3300046689 Ga0495613_0001149 Ga0495613_0001149_7634_8299 219
157 3300046689 Ga0495613_0115036 Ga0495613_0115036_183_854 219
158 3300046691 Ga0495670_0022785 Ga0495670_0022785_2376_3047 219
159 3300046809 Ga0495600_0046346 Ga0495600_0046346_485_1150 219
160 3300046810 Ga0495660_0061919 Ga0495660_0061919_1026_1697 219
161 3300047317 Ga0495604_0001320 Ga0495604_0001320_16187_16852 219
162 3300047318 Ga0495636_0008797 Ga0495636_0008797_683_1354 219
163 3300047319 Ga0495674_0017715 Ga0495674_0017715_3620_4285 219
164 3300047323 Ga0495683_0230133 Ga0495683_0230133_97_768 219
165 3300047443 Ga0495687_003574 Ga0495687_003574_6592_7257 219
166 3300047443 Ga0495687_019625 Ga0495687_019625_1584_2255 219
167 3300047447 Ga0495685_002401 Ga0495685_002401_5172_5843 219
168 3300047471 Ga0495684_0018965 Ga0495684_0018965_2704_3369 219
169 3300047673 Ga0495593_0031569 Ga0495593_0031569_813_1478 219
170 3300053085 Ga0495619_0040632 Ga0495619_0040632_32_697 219
171 3300053086 Ga0500578_0012444 Ga0500578_0012444_652_1323 219
172 3300053099 Ga0500654_058339 Ga0500654_058339_307_978 219
173 3300053100 Ga0500660_039633 Ga0500660_039633_498_1169 219
174 3300053101 Ga0500553_136757 Ga0500553_136757_273_944 219
175 3300053109 Ga0500569_001500 Ga0500569_001500_447_1118 219
176 3300053123 Ga0500614_004794 Ga0500614_004794_724_1395 219
177 3300053129 Ga0500628_005693 Ga0500628_005693_1122_1793 219
178 3300053131 Ga0500652_007135 Ga0500652_007135_2607_3278 219
179 3300053134 Ga0500658_0033416 Ga0500658_0033416_1324_1995 219
180 3300053137 Ga0500561_0000775 Ga0500561_0000775_3241_3912 219
181 3300053142 Ga0500577_0068266 Ga0500577_0068266_134_805 219
182 3300053149 Ga0500600_0001718 Ga0500600_0001718_389_1060 219
183 3300053160 Ga0500633_0025426 Ga0500633_0025426_210_881 219
184 3300053161 Ga0500634_0001300 Ga0500634_0001300_8197_8868 219
185 3300053732 Ga0500656_001260 Ga0500656_001260_1147_1818 219
186 3300005336 Ga0070680_100167508 Ga0070680_1001675083 220
187 3300005458 Ga0070681_10039140 Ga0070681_100391404 220
188 3300005530 Ga0070679_100150861 Ga0070679_1001508612 220
189 3300006847 Ga0075431_100245311 Ga0075431_1002453113 220
190 3300025912 Ga0207707_10080111 Ga0207707_100801112 220
191 3300025917 Ga0207660_10089411 Ga0207660_100894113 220
192 3300025921 Ga0207652_10063291 Ga0207652_100632914 220
193 3300025944 Ga0207661_10000165 Ga0207661_1000016529 220
194 3300037471 Ga0395905_0128247 Ga0395905_0128247_134_796 220
195 3300039437 Ga0436365_0418544 Ga0436365_0418544_587_1249 220
196 3300039450 Ga0436363_0708183 Ga0436363_0708183_523_1188 220
197 3300039453 Ga0436362_0942942 Ga0436362_0942942_417_1079 220
198 3300044683 Ga0466965_0153501 Ga0466965_0153501_209_877 220
199 3300044684 Ga0466966_0303688 Ga0466966_0303688_273_935 220
200 3300044694 Ga0466963_0135672 Ga0466963_0135672_756_1418 220
201 3300047472 Ga0495686_0117098 Ga0495686_0117098_455_1147 220
202 3300049591 Ga0501075_0372971 Ga0501075_0372971_155_823 220
203 3300049741 Ga0501079_0276149 Ga0501079_0276149_426_1094 220
204 3300005616 Ga0068852_100920085 Ga0068852_1009200851 221
205 3300005981 Ga0081538_10009031 Ga0081538_100090313 221
206 3300005981 Ga0081538_10045943 Ga0081538_100459433 221
207 3300021384 Ga0213876_10002484 Ga0213876_100024846 221
208 3300026088 Ga0207641_10489469 Ga0207641_104894692 221
209 3300031456 Ga0307513_10123893 Ga0307513_101238932 221
210 3300039437 Ga0436365_1447684 Ga0436365_1447684_17843_18520 221
211 3300044735 Ga0466968_0029833 Ga0466968_0029833_537_1202 221
212 3300045049 Ga0466959_0364863 Ga0466959_0364863_54_719 221
213 3300046529 Ga0495652_0363247 Ga0495652_0363247_327_998 221
214 3300049568 Ga0501031_0073698 Ga0501031_0073698_973_1638 221
215 3300049570 Ga0501033_0102558 Ga0501033_0102558_1373_2038 221
216 3300049570 Ga0501033_0210416 Ga0501033_0210416_596_1261 221
217 3300049572 Ga0501036_0017262 Ga0501036_0017262_5046_5711 221
218 3300049572 Ga0501036_0045229 Ga0501036_0045229_1244_1909 221
219 3300049575 Ga0501039_0003396 Ga0501039_0003396_9868_10533 221
220 3300049576 Ga0501040_0000515 Ga0501040_0000515_13834_14499 221
221 3300049576 Ga0501040_0006488 Ga0501040_0006488_5268_5933 221
222 3300049577 Ga0501041_0017542 Ga0501041_0017542_1272_1937 221
223 3300049577 Ga0501041_0023411 Ga0501041_0023411_2166_2831 221
224 3300049578 Ga0501042_0019543 Ga0501042_0019543_2662_3327 221
225 3300049580 Ga0501046_0019768 Ga0501046_0019768_1301_1966 221
226 3300049580 Ga0501046_0137248 Ga0501046_0137248_994_1659 221
227 3300049582 Ga0501048_0009811 Ga0501048_0009811_1348_2013 221
228 3300049582 Ga0501048_0109180 Ga0501048_0109180_1236_1901 221
229 3300049587 Ga0501071_0001164 Ga0501071_0001164_8180_8845 221
230 3300049587 Ga0501071_0045033 Ga0501071_0045033_1189_1854 221
231 3300049588 Ga0501072_0000894 Ga0501072_0000894_7908_8573 221
232 3300049588 Ga0501072_0003415 Ga0501072_0003415_8831_9496 221
233 3300049589 Ga0501073_0348937 Ga0501073_0348937_36_701 221
234 3300049590 Ga0501074_0009393 Ga0501074_0009393_5550_6215 221
235 3300049590 Ga0501074_0030239 Ga0501074_0030239_1891_2556 221
236 3300049591 Ga0501075_0003952 Ga0501075_0003952_3265_3930 221
237 3300049591 Ga0501075_0004349 Ga0501075_0004349_8064_8729 221
238 3300049592 Ga0501076_0003103 Ga0501076_0003103_1800_2465 221
239 3300049592 Ga0501076_0007818 Ga0501076_0007818_3674_4339 221
240 3300049593 Ga0501077_0027075 Ga0501077_0027075_853_1518 221
241 3300049593 Ga0501077_0078121 Ga0501077_0078121_183_848 221
242 3300049741 Ga0501079_0002701 Ga0501079_0002701_7865_8530 221
243 3300049742 Ga0501080_0322871 Ga0501080_0322871_615_1280 221
244 3300049743 Ga0501081_0016708 Ga0501081_0016708_2371_3036 221
245 3300049743 Ga0501081_0032249 Ga0501081_0032249_1176_1841 221
246 3300049822 Ga0501035_0055381 Ga0501035_0055381_2859_3524 221
247 3300049822 Ga0501035_0056570 Ga0501035_0056570_1122_1787 221
248 3300049824 Ga0501045_0004075 Ga0501045_0004075_1611_2276 221
249 3300054114 Ga0501084_0004385 Ga0501084_0004385_1840_2505 221
250 3300054114 Ga0501084_0081060 Ga0501084_0081060_685_1350 221
251 3300060353 Ga0501082_0070632 Ga0501082_0070632_439_1104 221
252 3300060353 Ga0501082_0105889 Ga0501082_0105889_1248_1913 221
253 3300061734 Ga0530510_0009858 Ga0530510_0009858_2005_2670 221
254 3300061734 Ga0530510_0020967 Ga0530510_0020967_1354_2019 221
255 iso_pu_bacteria 2791355406 2793975290 221
256 iso_pu_bacteria 8047893842 8047900553 221
257 iso_pu_bacteria 8048356638 8048358349 221
258 iso_pu_bacteria 8048369669 8048377493 221
259 iso_pu_bacteria 8048379754 8048386591 221
260 3300005327 Ga0070658_10167205 Ga0070658_101672052 222
261 3300005329 Ga0070683_100426284 Ga0070683_1004262842 222
262 3300005356 Ga0070674_100280002 Ga0070674_1002800022 222
263 3300005366 Ga0070659_100145991 Ga0070659_1001459912 222
264 3300005436 Ga0070713_100873452 Ga0070713_1008734521 222
265 3300005455 Ga0070663_100406052 Ga0070663_1004060521 222
266 3300005457 Ga0070662_100279092 Ga0070662_1002790921 222
267 3300005518 Ga0070699_100756683 Ga0070699_1007566832 222
268 3300005535 Ga0070684_100150171 Ga0070684_1001501713 222
269 3300005535 Ga0070684_100631378 Ga0070684_1006313782 222
270 3300005536 Ga0070697_100110630 Ga0070697_1001106302 222
271 3300005615 Ga0070702_100308501 Ga0070702_1003085012 222
272 3300005616 Ga0068852_100068387 Ga0068852_1000683874 222
273 3300005719 Ga0068861_100458385 Ga0068861_1004583852 222
274 3300005937 Ga0081455_10087914 Ga0081455_100879142 222
275 3300011119 Ga0105246_10926369 Ga0105246_109263691 222
276 3300025909 Ga0207705_10148417 Ga0207705_101484172 222
277 3300025919 Ga0207657_10471073 Ga0207657_104710731 222
278 3300025920 Ga0207649_10189872 Ga0207649_101898723 222
279 3300025928 Ga0207700_10536007 Ga0207700_105360072 222
280 3300025944 Ga0207661_10318622 Ga0207661_103186222 222
281 3300026023 Ga0207677_10349080 Ga0207677_103490802 222
282 3300026116 Ga0207674_10342550 Ga0207674_103425502 222
283 3300026118 Ga0207675_100474986 Ga0207675_1004749862 222
284 3300026121 Ga0207683_10456413 Ga0207683_104564132 222
285 3300026142 Ga0207698_11124577 Ga0207698_111245771 222
286 3300031731 Ga0307405_10589755 Ga0307405_105897551 222
287 3300031824 Ga0307413_10405346 Ga0307413_104053462 222
288 3300031995 Ga0307409_101036879 Ga0307409_1010368791 222
289 3300032126 Ga0307415_100669090 Ga0307415_1006690901 222
290 3300037418 Ga0395900_0235542 Ga0395900_0235542_369_1043 222
291 3300037466 Ga0395898_0068716 Ga0395898_0068716_2693_3367 222
292 3300038443 Ga0395901_0021241 Ga0395901_0021241_1244_1918 222
293 3300039450 Ga0436363_0936359 Ga0436363_0936359_375_1046 222
294 3300041494 Ga0451837_0199012 Ga0451837_0199012_646_1353 222
295 3300044694 Ga0466963_0069974 Ga0466963_0069974_342_1010 222
296 3300044706 Ga0466964_0015320 Ga0466964_0015320_2190_2858 222
297 3300044735 Ga0466968_0032795 Ga0466968_0032795_1218_1892 222
298 3300044765 Ga0466970_0259865 Ga0466970_0259865_27_695 222
299 3300044901 Ga0466960_0163557 Ga0466960_0163557_225_899 222
300 3300045976 Ga0466967_0011207 Ga0466967_0011207_130_798 222
301 3300045976 Ga0466967_0050443 Ga0466967_0050443_581_1249 222
302 3300045976 Ga0466967_0723810 Ga0466967_0723810_268_936 222
303 3300046674 Ga0495588_0069978 Ga0495588_0069978_736_1404 222
304 3300048915 Ga0496112_1017341 Ga0496112_1017341_55_723 222
305 3300048924 Ga0496121_0181465 Ga0496121_0181465_792_1460 222
306 3300049571 Ga0501034_0326431 Ga0501034_0326431_336_1004 222
307 3300049575 Ga0501039_0003643 Ga0501039_0003643_5125_5793 222
308 3300049576 Ga0501040_0056481 Ga0501040_0056481_511_1179 222
309 3300049576 Ga0501040_0130371 Ga0501040_0130371_297_971 222
310 3300049578 Ga0501042_0096001 Ga0501042_0096001_762_1430 222
311 3300049588 Ga0501072_0025305 Ga0501072_0025305_1726_2394 222
312 3300049592 Ga0501076_0086792 Ga0501076_0086792_555_1223 222
313 3300049822 Ga0501035_0309722 Ga0501035_0309722_75_743 222
314 3300049824 Ga0501045_0139177 Ga0501045_0139177_886_1554 222
315 3300050514 nmdc:mga08x19_636081_c1 nmdc:mga08x19_636081_c1_62_730 222
316 3300053146 Ga0500588_0126179 Ga0500588_0126179_10_678 222
317 3300053153 Ga0500616_0106578 Ga0500616_0106578_103_771 222
318 3300005290 Ga0065712_10134679 Ga0065712_101346792 223
319 3300005617 Ga0068859_100568932 Ga0068859_1005689322 223
320 3300005842 Ga0068858_100765347 Ga0068858_1007653472 223
321 3300006914 Ga0075436_100274265 Ga0075436_1002742652 223
322 3300006931 Ga0097620_100568864 Ga0097620_1005688642 223
323 3300007076 Ga0075435_100161829 Ga0075435_1001618291 223
324 3300009094 Ga0111539_11308523 Ga0111539_113085232 223
325 3300009147 Ga0114129_10177752 Ga0114129_101777522 223
326 3300009147 Ga0114129_10463333 Ga0114129_104633332 223
327 3300014968 Ga0157379_10098519 Ga0157379_100985192 223
328 3300026035 Ga0207703_10784658 Ga0207703_107846581 223
329 3300039450 Ga0436363_1563078 Ga0436363_1563078_34_705 223
330 3300048913 Ga0496110_0174763 Ga0496110_0174763_408_1088 223
331 3300049569 Ga0501032_0031810 Ga0501032_0031810_2478_3149 223
332 3300049572 Ga0501036_0001457 Ga0501036_0001457_2243_2914 223
333 3300049573 Ga0501037_0049852 Ga0501037_0049852_255_926 223
334 3300049574 Ga0501038_0055443 Ga0501038_0055443_590_1261 223
335 3300049575 Ga0501039_0101275 Ga0501039_0101275_894_1565 223
336 3300049576 Ga0501040_0048027 Ga0501040_0048027_230_901 223
337 3300049577 Ga0501041_0025760 Ga0501041_0025760_2552_3223 223
338 3300049578 Ga0501042_0039878 Ga0501042_0039878_116_787 223
339 3300049579 Ga0501043_0170030 Ga0501043_0170030_128_799 223
340 3300049580 Ga0501046_0103554 Ga0501046_0103554_155_826 223
341 3300049582 Ga0501048_0144990 Ga0501048_0144990_115_786 223
342 3300049585 Ga0501069_0189605 Ga0501069_0189605_423_1094 223
343 3300049586 Ga0501070_0014832 Ga0501070_0014832_428_1099 223
344 3300049587 Ga0501071_0066901 Ga0501071_0066901_1484_2155 223
345 3300049588 Ga0501072_0055650 Ga0501072_0055650_230_901 223
346 3300049589 Ga0501073_0002737 Ga0501073_0002737_12126_12797 223
347 3300049590 Ga0501074_0121445 Ga0501074_0121445_1082_1753 223
348 3300049591 Ga0501075_0138435 Ga0501075_0138435_1082_1753 223
349 3300049592 Ga0501076_0082896 Ga0501076_0082896_1484_2155 223
350 3300049593 Ga0501077_0030118 Ga0501077_0030118_2552_3223 223
351 3300049741 Ga0501079_0153559 Ga0501079_0153559_894_1565 223
352 3300049742 Ga0501080_0174268 Ga0501080_0174268_1082_1753 223
353 3300049743 Ga0501081_0313777 Ga0501081_0313777_251_922 223
354 3300049744 Ga0501083_0015377 Ga0501083_0015377_2323_2994 223
355 3300049822 Ga0501035_0020722 Ga0501035_0020722_384_1055 223
356 3300049823 Ga0501044_0332749 Ga0501044_0332749_689_1360 223
357 3300049824 Ga0501045_0116512 Ga0501045_0116512_230_901 223
358 3300050507 nmdc:mga05p37_482142_c1 nmdc:mga05p37_482142_c1_185_865 223
359 3300050511 nmdc:mga08y16_953155_c1 nmdc:mga08y16_953155_c1_100_780 223
360 3300050512 nmdc:mga0n895_57126_c1 nmdc:mga0n895_57126_c1_2415_3086 223
361 3300050513 nmdc:mga0rr50_135216_c1 nmdc:mga0rr50_135216_c1_538_1209 223
362 3300050515 nmdc:mga0a205_102371_c1 nmdc:mga0a205_102371_c1_1238_1909 223
363 3300060353 Ga0501082_0136813 Ga0501082_0136813_1356_2027 223
364 3300005353 Ga0070669_100475705 Ga0070669_1004757051 224
365 3300005367 Ga0070667_100000223 Ga0070667_10000022326 224
366 3300005440 Ga0070705_100096968 Ga0070705_1000969682 224
367 3300005445 Ga0070708_100364018 Ga0070708_1003640181 224
368 3300005471 Ga0070698_100000518 Ga0070698_10000051834 224
369 3300005518 Ga0070699_100003005 Ga0070699_10000300514 224
370 3300005536 Ga0070697_100274165 Ga0070697_1002741652 224
371 3300005548 Ga0070665_100005604 Ga0070665_1000056045 224
372 3300005617 Ga0068859_100000174 Ga0068859_10000017417 224
373 3300005841 Ga0068863_100032761 Ga0068863_1000327612 224
374 3300005841 Ga0068863_100848734 Ga0068863_1008487342 224
375 3300005842 Ga0068858_100003020 Ga0068858_10000302018 224
376 3300005843 Ga0068860_100000044 Ga0068860_100000044134 224
377 3300005844 Ga0068862_100000003 Ga0068862_10000000398 224
378 3300005981 Ga0081538_10000058 Ga0081538_1000005896 224
379 3300006163 Ga0070715_10050541 Ga0070715_100505412 224
380 3300006173 Ga0070716_100019767 Ga0070716_1000197673 224
381 3300006175 Ga0070712_100144546 Ga0070712_1001445462 224
382 3300006852 Ga0075433_10000817 Ga0075433_100008177 224
383 3300006871 Ga0075434_100001271 Ga0075434_10000127117 224
384 3300006871 Ga0075434_100227155 Ga0075434_1002271552 224
385 3300006914 Ga0075436_100009326 Ga0075436_1000093265 224
386 3300006931 Ga0097620_100000174 Ga0097620_10000017417 224
387 3300007076 Ga0075435_100003936 Ga0075435_1000039365 224
388 3300009101 Ga0105247_10000006 Ga0105247_10000006223 224
389 3300009147 Ga0114129_10162497 Ga0114129_101624971 224
390 3300009177 Ga0105248_10000042 Ga0105248_10000042143 224
391 3300009553 Ga0105249_10000008 Ga0105249_10000008190 224
392 3300013306 Ga0163162_10075007 Ga0163162_100750073 224
393 3300014325 Ga0163163_10026112 Ga0163163_100261122 224
394 3300014968 Ga0157379_10064509 Ga0157379_100645092 224
395 3300025900 Ga0207710_10000025 Ga0207710_1000002565 224
396 3300025905 Ga0207685_10017601 Ga0207685_100176011 224
397 3300025906 Ga0207699_10068340 Ga0207699_100683402 224
398 3300025922 Ga0207646_10029718 Ga0207646_100297185 224
399 3300025923 Ga0207681_10003522 Ga0207681_100035222 224
400 3300025939 Ga0207665_10002519 Ga0207665_1000251910 224
401 3300025941 Ga0207711_10000697 Ga0207711_1000069718 224
402 3300025961 Ga0207712_10000011 Ga0207712_10000011131 224
403 3300025986 Ga0207658_10000307 Ga0207658_1000030732 224
404 3300026035 Ga0207703_10006939 Ga0207703_100069399 224
405 3300026088 Ga0207641_10005680 Ga0207641_100056805 224
406 3300026088 Ga0207641_10174683 Ga0207641_101746832 224
407 3300026118 Ga0207675_100337725 Ga0207675_1003377251 224
408 3300028380 Ga0268265_10000010 Ga0268265_1000001099 224
409 3300028381 Ga0268264_10000007 Ga0268264_10000007633 224
410 3300030521 Ga0307511_10000494 Ga0307511_1000049428 224
411 3300037466 Ga0395898_0755317 Ga0395898_0755317_140_826 224
412 3300038443 Ga0395901_0190780 Ga0395901_0190780_16_702 224
413 3300042876 Ga0451577_0039770 Ga0451577_0039770_996_1676 224
414 3300044683 Ga0466965_0005651 Ga0466965_0005651_3031_3705 224
415 3300044693 Ga0466961_0084742 Ga0466961_0084742_112_786 224
416 3300044694 Ga0466963_0011503 Ga0466963_0011503_1503_2177 224
417 3300044694 Ga0466963_0032705 Ga0466963_0032705_1551_2225 224
418 3300044719 Ga0466971_0036214 Ga0466971_0036214_1352_2026 224
419 3300044765 Ga0466970_0168959 Ga0466970_0168959_189_863 224
420 3300044842 Ga0466957_0286027 Ga0466957_0286027_198_872 224
421 3300044901 Ga0466960_0025585 Ga0466960_0025585_143_817 224
422 3300045049 Ga0466959_0319021 Ga0466959_0319021_152_826 224
423 3300046491 Ga0495584_0199194 Ga0495584_0199194_64_738 224
424 3300046615 Ga0495656_0053442 Ga0495656_0053442_417_1091 224
425 3300048903 Ga0496100_0098453 Ga0496100_0098453_57_746 224
426 3300048904 Ga0496101_0020411 Ga0496101_0020411_700_1389 224
427 3300048905 Ga0496102_0000060 Ga0496102_0000060_88042_88731 224
428 3300048906 Ga0496103_0000500 Ga0496103_0000500_19294_19983 224
429 3300048910 Ga0496107_0083153 Ga0496107_0083153_743_1432 224
430 3300048911 Ga0496108_0330652 Ga0496108_0330652_456_1145 224
431 3300048917 Ga0496114_0241857 Ga0496114_0241857_393_1082 224
432 3300048919 Ga0496116_0046069 Ga0496116_0046069_1484_2173 224
433 3300048920 Ga0496117_0002026 Ga0496117_0002026_4521_5210 224
434 3300048921 Ga0496118_0001179 Ga0496118_0001179_30290_30979 224
435 3300048922 Ga0496119_0016754 Ga0496119_0016754_718_1407 224
436 3300048923 Ga0496120_0004413 Ga0496120_0004413_7804_8493 224
437 3300048924 Ga0496121_0085248 Ga0496121_0085248_787_1476 224
438 3300048927 Ga0496124_0088633 Ga0496124_0088633_260_949 224
439 3300048928 Ga0496125_0012912 Ga0496125_0012912_5472_6161 224
440 3300048929 Ga0496126_0008248 Ga0496126_0008248_2044_2733 224
441 3300049583 Ga0501067_0001773 Ga0501067_0001773_9519_10202 224
442 3300049585 Ga0501069_0025346 Ga0501069_0025346_2208_2891 224
443 3300050507 nmdc:mga05p37_10310_c1 nmdc:mga05p37_10310_c1_9355_10032 224
444 3300050510 nmdc:mga06r32_330200_c1 nmdc:mga06r32_330200_c1_764_1438 224
445 3300050512 nmdc:mga0n895_9556_c1 nmdc:mga0n895_9556_c1_1070_1747 224
446 3300050513 nmdc:mga0rr50_3537_c1 nmdc:mga0rr50_3537_c1_5548_6225 224
447 3300050514 nmdc:mga08x19_3507_c1 nmdc:mga08x19_3507_c1_6234_6911 224
448 3300050515 nmdc:mga0a205_20197_c1 nmdc:mga0a205_20197_c1_5194_5871 224
449 3300061719 Ga0466962_0004738 Ga0466962_0004738_2391_3065 224
450 3300061734 Ga0530510_0035126 Ga0530510_0035126_2078_2761 224
451 3300005471 Ga0070698_100011475 Ga0070698_1000114754 225
452 3300005535 Ga0070684_100452029 Ga0070684_1004520291 225
453 3300005614 Ga0068856_100913195 Ga0068856_1009131952 225
454 3300005985 Ga0081539_10003738 Ga0081539_100037387 225
455 3300005985 Ga0081539_10076839 Ga0081539_100768392 225
456 3300006058 Ga0075432_10001916 Ga0075432_100019163 225
457 3300006194 Ga0075427_10010851 Ga0075427_100108512 225
458 3300006237 Ga0097621_100254557 Ga0097621_1002545572 225
459 3300006844 Ga0075428_100203234 Ga0075428_1002032342 225
460 3300006846 Ga0075430_100017770 Ga0075430_1000177702 225
461 3300006847 Ga0075431_100137307 Ga0075431_1001373072 225
462 3300006852 Ga0075433_10060813 Ga0075433_100608131 225
463 3300006871 Ga0075434_100313659 Ga0075434_1003136592 225
464 3300007076 Ga0075435_100128729 Ga0075435_1001287292 225
465 3300009094 Ga0111539_10043947 Ga0111539_100439474 225
466 3300009101 Ga0105247_10705981 Ga0105247_107059811 225
467 3300009147 Ga0114129_10039391 Ga0114129_100393914 225
468 3300009147 Ga0114129_10621532 Ga0114129_106215322 225
469 3300011119 Ga0105246_10698399 Ga0105246_106983991 225
470 3300013100 Ga0157373_10589954 Ga0157373_105899541 225
471 3300013105 Ga0157369_10652771 Ga0157369_106527711 225
472 3300013296 Ga0157374_10911282 Ga0157374_109112822 225
473 3300013308 Ga0157375_10607816 Ga0157375_106078162 225
474 3300014969 Ga0157376_10807614 Ga0157376_108076141 225
475 3300027907 Ga0207428_10004233 Ga0207428_100042335 225
476 3300037312 Ga0395899_0040078 Ga0395899_0040078_1112_1795 225
477 3300037312 Ga0395899_0323239 Ga0395899_0323239_306_983 225
478 3300037418 Ga0395900_0056291 Ga0395900_0056291_2205_2888 225
479 3300037466 Ga0395898_0106523 Ga0395898_0106523_1966_2643 225
480 3300037471 Ga0395905_0075385 Ga0395905_0075385_1878_2561 225
481 3300038443 Ga0395901_0011587 Ga0395901_0011587_3905_4588 225
482 3300039062 Ga0400483_143088 Ga0400483_143088_81_758 225
483 3300044694 Ga0466963_0035507 Ga0466963_0035507_1855_2532 225
484 3300044694 Ga0466963_0605066 Ga0466963_0605066_83_760 225
485 3300044719 Ga0466971_0056136 Ga0466971_0056136_204_881 225
486 3300044901 Ga0466960_0131085 Ga0466960_0131085_32_709 225
487 3300045049 Ga0466959_0278242 Ga0466959_0278242_382_1059 225
488 3300045836 Ga0466958_0059539 Ga0466958_0059539_785_1462 225
489 3300045976 Ga0466967_0031038 Ga0466967_0031038_1960_2637 225
490 3300045976 Ga0466967_0195130 Ga0466967_0195130_134_811 225
491 3300048907 Ga0496104_0537280 Ga0496104_0537280_70_747 225
492 3300048908 Ga0496105_0529556 Ga0496105_0529556_15_692 225
493 3300048914 Ga0496111_0298048 Ga0496111_0298048_41_718 225
494 3300049578 Ga0501042_0112336 Ga0501042_0112336_243_920 225
495 3300049592 Ga0501076_0472224 Ga0501076_0472224_154_831 225
496 3300050507 nmdc:mga05p37_130523_c1 nmdc:mga05p37_130523_c1_2139_2816 225
497 3300050507 nmdc:mga05p37_142939_c1 nmdc:mga05p37_142939_c1_1636_2313 225
498 3300050507 nmdc:mga05p37_21214_c1 nmdc:mga05p37_21214_c1_5617_6294 225
499 3300050508 nmdc:mga09592_169501_c1 nmdc:mga09592_169501_c1_402_1079 225
500 3300050509 nmdc:mga0qj67_91666_c1 nmdc:mga0qj67_91666_c1_98_775 225
501 3300050510 nmdc:mga06r32_438984_c1 nmdc:mga06r32_438984_c1_208_885 225
502 3300050511 nmdc:mga08y16_45205_c1 nmdc:mga08y16_45205_c1_1833_2510 225
503 3300050512 nmdc:mga0n895_320921_c1 nmdc:mga0n895_320921_c1_360_1037 225
504 3300050512 nmdc:mga0n895_63695_c1 nmdc:mga0n895_63695_c1_1264_1941 225
505 3300050513 nmdc:mga0rr50_43998_c1 nmdc:mga0rr50_43998_c1_1465_2142 225
506 3300050515 nmdc:mga0a205_32312_c1 nmdc:mga0a205_32312_c1_1264_1941 225
507 3300050515 nmdc:mga0a205_33485_c1 nmdc:mga0a205_33485_c1_2871_3548 225
508 3300061719 Ga0466962_0070878 Ga0466962_0070878_735_1412 225
509 3300005330 Ga0070690_100220633 Ga0070690_1002206331 226
510 3300005334 Ga0068869_100055969 Ga0068869_1000559691 226
511 3300005337 Ga0070682_100124198 Ga0070682_1001241982 226
512 3300005338 Ga0068868_100030488 Ga0068868_1000304882 226
513 3300005347 Ga0070668_100326753 Ga0070668_1003267532 226
514 3300005353 Ga0070669_100120823 Ga0070669_1001208232 226
515 3300005364 Ga0070673_100579406 Ga0070673_1005794062 226
516 3300005438 Ga0070701_10072885 Ga0070701_100728852 226
517 3300005441 Ga0070700_100168651 Ga0070700_1001686511 226
518 3300005444 Ga0070694_100018986 Ga0070694_1000189866 226
519 3300005456 Ga0070678_100088450 Ga0070678_1000884502 226
520 3300005456 Ga0070678_100174377 Ga0070678_1001743772 226
521 3300005459 Ga0068867_100158097 Ga0068867_1001580972 226
522 3300005471 Ga0070698_100128964 Ga0070698_1001289642 226
523 3300005544 Ga0070686_100070463 Ga0070686_1000704632 226
524 3300005546 Ga0070696_100081602 Ga0070696_1000816022 226
525 3300005549 Ga0070704_100077141 Ga0070704_1000771412 226
526 3300005549 Ga0070704_100110388 Ga0070704_1001103882 226
527 3300005564 Ga0070664_100475507 Ga0070664_1004755071 226
528 3300005617 Ga0068859_100254743 Ga0068859_1002547431 226
529 3300005617 Ga0068859_100308206 Ga0068859_1003082062 226
530 3300005618 Ga0068864_100333323 Ga0068864_1003333232 226
531 3300005840 Ga0068870_10069329 Ga0068870_100693292 226
532 3300005844 Ga0068862_100188980 Ga0068862_1001889802 226
533 3300005937 Ga0081455_10048160 Ga0081455_100481602 226
534 3300005937 Ga0081455_10052144 Ga0081455_100521442 226
535 3300005937 Ga0081455_10085651 Ga0081455_100856512 226
536 3300005981 Ga0081538_10000068 Ga0081538_1000006870 226
537 3300005981 Ga0081538_10058172 Ga0081538_100581723 226
538 3300005981 Ga0081538_10089618 Ga0081538_100896182 226
539 3300005983 Ga0081540_1008210 Ga0081540_100821010 226
540 3300005983 Ga0081540_1123603 Ga0081540_11236032 226
541 3300006038 Ga0075365_10001599 Ga0075365_100015992 226
542 3300006038 Ga0075365_10004931 Ga0075365_100049316 226
543 3300006051 Ga0075364_10025626 Ga0075364_100256262 226
544 3300006173 Ga0070716_100026506 Ga0070716_1000265062 226
545 3300006175 Ga0070712_100004298 Ga0070712_1000042985 226
546 3300006844 Ga0075428_100166500 Ga0075428_1001665002 226
547 3300006847 Ga0075431_100035185 Ga0075431_1000351852 226
548 3300006847 Ga0075431_100091392 Ga0075431_1000913922 226
549 3300006852 Ga0075433_10000057 Ga0075433_1000005732 226
550 3300006852 Ga0075433_10000692 Ga0075433_1000069215 226
551 3300006852 Ga0075433_10073546 Ga0075433_100735462 226
552 3300006852 Ga0075433_10677539 Ga0075433_106775392 226
553 3300006871 Ga0075434_100000070 Ga0075434_10000007041 226
554 3300006871 Ga0075434_100016441 Ga0075434_1000164414 226
555 3300006871 Ga0075434_100041745 Ga0075434_1000417453 226
556 3300006880 Ga0075429_100000551 Ga0075429_10000055110 226
557 3300006880 Ga0075429_100269171 Ga0075429_1002691712 226
558 3300006931 Ga0097620_100254750 Ga0097620_1002547501 226
559 3300006931 Ga0097620_100308234 Ga0097620_1003082342 226
560 3300007076 Ga0075435_100147833 Ga0075435_1001478332 226
561 3300009094 Ga0111539_10006167 Ga0111539_1000616716 226
562 3300009094 Ga0111539_10194210 Ga0111539_101942102 226
563 3300009094 Ga0111539_10960808 Ga0111539_109608081 226
564 3300009098 Ga0105245_10256364 Ga0105245_102563642 226
565 3300009098 Ga0105245_10473949 Ga0105245_104739492 226
566 3300009147 Ga0114129_10003427 Ga0114129_100034278 226
567 3300009147 Ga0114129_10020642 Ga0114129_100206426 226
568 3300009147 Ga0114129_10056028 Ga0114129_100560287 226
569 3300009147 Ga0114129_10191292 Ga0114129_101912922 226
570 3300009553 Ga0105249_10042148 Ga0105249_100421483 226
571 3300010375 Ga0105239_10264408 Ga0105239_102644083 226
572 3300010375 Ga0105239_10686263 Ga0105239_106862632 226
573 3300013297 Ga0157378_10115802 Ga0157378_101158022 226
574 3300013306 Ga0163162_10748547 Ga0163162_107485471 226
575 3300013308 Ga0157375_10085668 Ga0157375_100856684 226
576 3300014325 Ga0163163_10539231 Ga0163163_105392311 226
577 3300014745 Ga0157377_10281418 Ga0157377_102814181 226
578 3300014968 Ga0157379_10091350 Ga0157379_100913502 226
579 3300021384 Ga0213876_10008534 Ga0213876_100085341 226
580 3300025901 Ga0207688_10026271 Ga0207688_100262713 226
581 3300025901 Ga0207688_10032083 Ga0207688_100320832 226
582 3300025915 Ga0207693_10003509 Ga0207693_100035098 226
583 3300025916 Ga0207663_10020210 Ga0207663_100202102 226
584 3300025918 Ga0207662_10395429 Ga0207662_103954291 226
585 3300025923 Ga0207681_10039925 Ga0207681_100399252 226
586 3300025932 Ga0207690_10140429 Ga0207690_101404292 226
587 3300025933 Ga0207706_10755230 Ga0207706_107552301 226
588 3300025935 Ga0207709_10337115 Ga0207709_103371152 226
589 3300025940 Ga0207691_10121496 Ga0207691_101214962 226
590 3300025942 Ga0207689_10211621 Ga0207689_102116212 226
591 3300026121 Ga0207683_10094478 Ga0207683_100944783 226
592 3300026121 Ga0207683_10135838 Ga0207683_101358382 226
593 3300027907 Ga0207428_10064722 Ga0207428_100647223 226
594 3300027907 Ga0207428_10222926 Ga0207428_102229262 226
595 3300028379 Ga0268266_11116063 Ga0268266_111160631 226
596 3300028380 Ga0268265_10171061 Ga0268265_101710611 226
597 3300037312 Ga0395899_0370446 Ga0395899_0370446_100_783 226
598 3300037418 Ga0395900_0006221 Ga0395900_0006221_11605_12285 226
599 3300037418 Ga0395900_0102383 Ga0395900_0102383_1935_2615 226
600 3300037418 Ga0395900_0224038 Ga0395900_0224038_335_1015 226
601 3300037418 Ga0395900_0253799 Ga0395900_0253799_852_1535 226
602 3300037418 Ga0395900_0773571 Ga0395900_0773571_13_693 226
603 3300037466 Ga0395898_0002063 Ga0395898_0002063_23655_24335 226
604 3300037466 Ga0395898_0015070 Ga0395898_0015070_1972_2652 226
605 3300037466 Ga0395898_0306852 Ga0395898_0306852_568_1251 226
606 3300037471 Ga0395905_0008033 Ga0395905_0008033_3673_4353 226
607 3300037471 Ga0395905_0214925 Ga0395905_0214925_372_1052 226
608 3300038443 Ga0395901_0008507 Ga0395901_0008507_4637_5317 226
609 3300038443 Ga0395901_0009883 Ga0395901_0009883_2803_3483 226
610 3300038443 Ga0395901_0137204 Ga0395901_0137204_1661_2344 226
611 3300038443 Ga0395901_0439690 Ga0395901_0439690_513_1196 226
612 3300038443 Ga0395901_0510093 Ga0395901_0510093_109_792 226
613 3300038996 Ga0242420_026583 Ga0242420_026583_340_1026 226
614 3300042130 Ga0450892_008350 Ga0450892_008350_13_702 226
615 3300042530 Ga0450916_004973 Ga0450916_004973_446_1135 226
616 3300042876 Ga0451577_0607297 Ga0451577_0607297_229_924 226
617 3300044694 Ga0466963_0023198 Ga0466963_0023198_1982_2674 226
618 3300044735 Ga0466968_0147930 Ga0466968_0147930_13_744 226
619 3300045976 Ga0466967_0307203 Ga0466967_0307203_72_752 226
620 3300045976 Ga0466967_0695030 Ga0466967_0695030_167_895 226
621 3300046455 Ga0495603_0099638 Ga0495603_0099638_31_711 226
622 3300046460 Ga0495638_0016925 Ga0495638_0016925_1346_2026 226
623 3300046461 Ga0495641_0050692 Ga0495641_0050692_1167_1847 226
624 3300046461 Ga0495641_0161695 Ga0495641_0161695_53_733 226
625 3300046675 Ga0495657_0175477 Ga0495657_0175477_24_710 226
626 3300046683 Ga0495658_0461387 Ga0495658_0461387_110_790 226
627 3300047321 Ga0495676_0117228 Ga0495676_0117228_706_1386 226
628 3300048903 Ga0496100_0000004 Ga0496100_0000004_235336_236016 226
629 3300048903 Ga0496100_0010810 Ga0496100_0010810_1862_2542 226
630 3300048904 Ga0496101_0000007 Ga0496101_0000007_235336_236016 226
631 3300048904 Ga0496101_0080653 Ga0496101_0080653_939_1619 226
632 3300048905 Ga0496102_0015718 Ga0496102_0015718_3382_4062 226
633 3300048905 Ga0496102_0139345 Ga0496102_0139345_419_1099 226
634 3300048906 Ga0496103_0003635 Ga0496103_0003635_3505_4185 226
635 3300048908 Ga0496105_0011383 Ga0496105_0011383_4866_5546 226
636 3300048909 Ga0496106_0000004 Ga0496106_0000004_196750_197430 226
637 3300048909 Ga0496106_0008284 Ga0496106_0008284_3419_4099 226
638 3300048909 Ga0496106_0355496 Ga0496106_0355496_201_881 226
639 3300048910 Ga0496107_0000001 Ga0496107_0000001_235336_236016 226
640 3300048910 Ga0496107_0283088 Ga0496107_0283088_248_928 226
641 3300048911 Ga0496108_0032225 Ga0496108_0032225_1687_2367 226
642 3300048914 Ga0496111_0020922 Ga0496111_0020922_2493_3173 226
643 3300048914 Ga0496111_0064521 Ga0496111_0064521_734_1414 226
644 3300048915 Ga0496112_0037377 Ga0496112_0037377_293_973 226
645 3300048916 Ga0496113_0006265 Ga0496113_0006265_439_1119 226
646 3300048917 Ga0496114_0002542 Ga0496114_0002542_8098_8778 226
647 3300048918 Ga0496115_0000815 Ga0496115_0000815_16979_17659 226
648 3300049572 Ga0501036_0064238 Ga0501036_0064238_888_1577 226
649 3300049572 Ga0501036_0298324 Ga0501036_0298324_139_819 226
650 3300049572 Ga0501036_0352087 Ga0501036_0352087_537_1217 226
651 3300049577 Ga0501041_0154381 Ga0501041_0154381_728_1417 226
652 3300049580 Ga0501046_0501763 Ga0501046_0501763_151_840 226
653 3300049584 Ga0501068_0275327 Ga0501068_0275327_174_854 226
654 3300049584 Ga0501068_0312935 Ga0501068_0312935_73_756 226
655 3300049587 Ga0501071_0127405 Ga0501071_0127405_954_1643 226
656 3300049590 Ga0501074_0112760 Ga0501074_0112760_776_1465 226
657 3300049591 Ga0501075_0130354 Ga0501075_0130354_772_1452 226
658 3300049592 Ga0501076_0029116 Ga0501076_0029116_2127_2816 226
659 3300049592 Ga0501076_0085597 Ga0501076_0085597_1463_2152 226
660 3300049593 Ga0501077_0309307 Ga0501077_0309307_179_868 226
661 3300049741 Ga0501079_0387385 Ga0501079_0387385_232_921 226
662 3300049741 Ga0501079_0406984 Ga0501079_0406984_351_1031 226
663 3300050492 nmdc:mga0yw44_140119_c1 nmdc:mga0yw44_140119_c1_139_819 226
664 3300050492 nmdc:mga0yw44_51785_c1 nmdc:mga0yw44_51785_c1_1194_1874 226
665 3300050492 nmdc:mga0yw44_88951_c1 nmdc:mga0yw44_88951_c1_618_1298 226
666 3300050507 nmdc:mga05p37_1215725_c1 nmdc:mga05p37_1215725_c1_77_757 226
667 3300050507 nmdc:mga05p37_147460_c1 nmdc:mga05p37_147460_c1_1585_2271 226
668 3300050507 nmdc:mga05p37_21516_c1 nmdc:mga05p37_21516_c1_4916_5596 226
669 3300050507 nmdc:mga05p37_48686_c1 nmdc:mga05p37_48686_c1_2299_2979 226
670 3300050510 nmdc:mga06r32_13499_c1 nmdc:mga06r32_13499_c1_6209_6889 226
671 3300050510 nmdc:mga06r32_79753_c1 nmdc:mga06r32_79753_c1_885_1571 226
672 3300050511 nmdc:mga08y16_80546_c1 nmdc:mga08y16_80546_c1_519_1199 226
673 3300050512 nmdc:mga0n895_56427_c1 nmdc:mga0n895_56427_c1_1461_2141 226
674 3300050512 nmdc:mga0n895_743_c1 nmdc:mga0n895_743_c1_6235_6921 226
675 3300050513 nmdc:mga0rr50_135655_c1 nmdc:mga0rr50_135655_c1_524_1210 226
676 3300050513 nmdc:mga0rr50_333702_c1 nmdc:mga0rr50_333702_c1_375_1055 226
677 3300050515 nmdc:mga0a205_115185_c1 nmdc:mga0a205_115185_c1_781_1467 226
678 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_132895_133575 226
679 3300050515 nmdc:mga0a205_22022_c1 nmdc:mga0a205_22022_c1_1442_2122 226
680 3300050515 nmdc:mga0a205_68679_c1 nmdc:mga0a205_68679_c1_1529_2209 226
681 3300054114 Ga0501084_0029398 Ga0501084_0029398_285_974 226
682 3300054114 Ga0501084_0660664 Ga0501084_0660664_13_693 226
683 3300060353 Ga0501082_0172521 Ga0501082_0172521_158_847 226
684 3300061734 Ga0530510_0005561 Ga0530510_0005561_7676_8365 226
685 3300061734 Ga0530510_0184960 Ga0530510_0184960_399_1079 226
686 3300025936 Ga0207670_10785840 Ga0207670_107858401 227
687 3300041494 Ga0451837_1576622 Ga0451837_1576622_197_925 227
688 3300044684 Ga0466966_0010361 Ga0466966_0010361_2707_3432 228
689 3300044693 Ga0466961_0040499 Ga0466961_0040499_2169_2894 228
690 3300044694 Ga0466963_0039164 Ga0466963_0039164_2367_3092 228
691 3300044719 Ga0466971_0003662 Ga0466971_0003662_5797_6522 228
692 3300044842 Ga0466957_0003743 Ga0466957_0003743_388_1113 228
693 3300045836 Ga0466958_0003197 Ga0466958_0003197_4654_5379 228
694 3300060353 Ga0501082_0589463 Ga0501082_0589463_159_854 228
695 3300061719 Ga0466962_0001045 Ga0466962_0001045_6707_7432 228
696 3300003203 JGI25406J46586_10016300 JGI25406J46586_100163003 231
697 3300005985 Ga0081539_10000062 Ga0081539_10000062147 231
698 3300049588 Ga0501072_0023500 Ga0501072_0023500_2579_3355 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

33

142

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

174

249

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9807 5 123
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.979 7 124
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9787 5 123
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9786 7 124
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9776 5 123
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9987 6 85 3.40.50.2300
af_O07776_147_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.989 131 228 1.10.10.10
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9818 6 85 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9806 5 85 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9787 3 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2T3N0B4-F1-model_v4 Response regulatory domain-containing protein 0.9868 6 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C4IG96-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9827 7 120 GO:0000155
GO:0005886
GO:0009927
AF-A0A6I5QSI8-F1-model_v4 Response regulator 0.9822 5 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A5C6EQA2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9811 7 122 GO:0000155
GO:0005886
AF-A0A3C0Z4C2-F1-model_v4 DNA-binding response regulator 0.979 6 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
88.83 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map