F475995

General Info

Members Datasets Scaffolds Average Seq Length
698 383 1396 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221652|2644294982
Length 318
Sequence FLRNVAYSSSGSPWRGCGRPVVLPGAGDPACGVIASAGTIPATMLTYPHIDPVALQIGPLAVHWYGLTYLAAFGLFMLLGIRRLRHPPFASITGPGAWTRKDVEDILFLGVAGVVIGGRLGYCLFYKPGYYLSHPLEIFAVWQGGMAFHGGLLGVVVSMLWFAHSRQRPWLQVADFVAPCVPTGLAAGRVGNFINGELWGRFASPDLPWGMVFAHSGSMQPRHPSQVYQFLMEGLLLFILLWLYARKERRPGQVAAAFLFGYGVFRFIAEYFREPDAFLGILSLGMSMGQWLCVPMIVGGAAMWLWAQRQPVGALVSR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
160 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
205 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
206 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
207 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
208 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
209 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
210 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
215 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
271 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
272 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
295 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
298 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
301 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
302 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
311 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
312 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
313 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
314 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
315 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
319 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 2643221652 Acidovorax sp. Root402 Isolate Unclassified
321 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
322 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
323 2547132374 Acidovorax radicis N35 Isolate Unclassified
324 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
325 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
326 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
327 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
328 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
329 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
330 2643221570 Acidovorax sp. Root568 Isolate Unclassified
331 2643221596 Acidovorax sp. Root70 Isolate Unclassified
332 2643221609 Acidovorax sp. Root217 Isolate Unclassified
333 2643221611 Acidovorax sp. Root219 Isolate Unclassified
334 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
335 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
336 2643221658 Variovorax sp. Root411 Isolate Unclassified
337 2643221660 Methylibium sp. Root1272 Isolate Unclassified
338 2643221672 Variovorax sp. Root434 Isolate Unclassified
339 2643221683 Variovorax sp. Root473 Isolate Unclassified
340 2643221717 Acidovorax sp. Root267 Isolate Unclassified
341 2721755523 Delftia sp. HK171 Isolate Unclassified
342 2738541277 Variovorax sp. GV051 Isolate Unclassified
343 2738541307 Variovorax sp. GV008 Isolate Unclassified
344 2738543012 Acidovorax sp. CF301 Isolate Unclassified
345 2738543013 Variovorax sp. BT01 Isolate Unclassified
346 2738543019 Variovorax sp. GV040 Isolate Unclassified
347 2816332133 Acidovorax radicis 2721A Isolate Unclassified
348 2818991446 Variovorax sp. 1180 Isolate Unclassified
349 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
350 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
351 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
352 2842677519 Variovorax sp. R-72495 Isolate Unclassified
353 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
354 2842733646 Variovorax sp. R-72446 Isolate Unclassified
355 2842747753 Variovorax sp. R-72060 Isolate Unclassified
356 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
357 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
358 2885198086 Variovorax sp. 679 Isolate Unclassified
359 2885211737 Variovorax sp. 553 Isolate Unclassified
360 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
361 2899924645 Variovorax sp. 369 Isolate Unclassified
362 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
363 2904456579 Variovorax sp. 2002 Isolate Unclassified
364 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
365 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
366 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
367 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
368 2928037797 Variovorax sp. 1126 Isolate Unclassified
369 2928044640 Variovorax sp. 1128 Isolate Unclassified
370 2928051484 Variovorax sp. 1133 Isolate Unclassified
371 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
372 2928070936 Variovorax gossypii 1167 Isolate Unclassified
373 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
374 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
375 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
376 2929520902 Variovorax beijingensis 502 Isolate Unclassified
377 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
378 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
379 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
380 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
381 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
382 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
383 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.26
Metatranscriptomes 0.29
Isolates 9.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.25
Nodule 1.29
Rhizoplane 2.44
Rhizosphere 45.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011138 3300001979 Bacteria 3433
2 JGI24740J21852_10013604 3300001979 Bacteria 3028
3 JGI25156J39149_1000002 3300002705 Bacteria 343501
4 JGI25154J39366_1000010 3300002738 Bacteria 297985
5 JGI25157J39369_1000001 3300002741 Bacteria 363277
6 JGI25152J39213_1003097 3300002773 Bacteria 5816
7 JGI25152J39213_1006587 3300002773 Bacteria 3127
8 JGI25150J39212_1002336 3300002774 Bacteria 4768
9 JGI25150J39212_1011673 3300002774 Bacteria 1582
10 JGI25159J45721_1001031 3300002987 Bacteria 11936
11 JGI25159J45721_1001487 3300002987 Bacteria 9633
12 JGI25159J45721_1008017 3300002987 Bacteria 2951
13 JGI25159J45721_1012808 3300002987 Bacteria 1976
14 JGI25151J46595_10000849 3300003187 Bacteria 24354
15 JGI25151J46595_10005377 3300003187 Bacteria 6619
16 JGI25151J46595_10005605 3300003187 Bacteria 6460
17 JGI25151J46595_10006891 3300003187 Bacteria 5641
18 JGI25151J46595_10009023 3300003187 Bacteria 4753
19 JGI25151J46595_10011921 3300003187 Bacteria 3973
20 JGI25153J46596_10006648 3300003215 Bacteria 5816
21 JGI25160J50197_1000301 3300003354 Bacteria 34898
22 JGI25160J50197_1015284 3300003354 Bacteria 2527
23 JGI25161J50226_1000043 3300003374 Bacteria 120741
24 JGI25161J50226_1002461 3300003374 Bacteria 4733
25 Ga0006562J51391_1151955 3300003578 Bacteria 2740
26 Ga0006562J51391_1151956 3300003578 Bacteria 2560
27 Ga0055535_1000263 3300003761 Bacteria 55363
28 Ga0055542_1000004 3300003762 Bacteria 553532
29 Ga0055526_1000766 3300003771 Bacteria 23992
30 Ga0055526_1005571 3300003771 Bacteria 7186
31 Ga0055526_1009308 3300003771 Bacteria 4753
32 Ga0055526_1009358 3300003771 Bacteria 4727
33 Ga0055537_1000124 3300003773 Bacteria 58656
34 Ga0055537_1000365 3300003773 Bacteria 30792
35 Ga0055537_1000479 3300003773 Bacteria 25018
36 Ga0055537_1003569 3300003773 Bacteria 4753
37 Ga0055524_1000130 3300003775 Bacteria 88754
38 Ga0055524_1000167 3300003775 Bacteria 75234
39 Ga0055524_1007210 3300003775 Bacteria 4753
40 Ga0055524_1013103 3300003775 Bacteria 3146
41 Ga0055536_1000896 3300003781 Bacteria 19290
42 Ga0055536_1001627 3300003781 Bacteria 13360
43 Ga0055536_1002373 3300003781 Bacteria 10626
44 Ga0055536_1013807 3300003781 Bacteria 2882
45 Ga0055536_1016391 3300003781 Bacteria 2481
46 Ga0055536_1019956 3300003781 Bacteria 2088
47 Ga0055534_1000117 3300003784 Bacteria 58656
48 Ga0055534_1003009 3300003784 Bacteria 5541
49 Ga0055534_1004914 3300003784 Bacteria 3735
50 Ga0055534_1005542 3300003784 Bacteria 3353
51 Ga0055534_1006602 3300003784 Bacteria 2896
52 Ga0055528_1000145 3300003790 Bacteria 58081
53 Ga0055528_1001213 3300003790 Bacteria 16517
54 Ga0055528_1007631 3300003790 Bacteria 4753
55 Ga0055528_1022869 3300003790 Bacteria 1929
56 Ga0055530_10000265 3300003791 Bacteria 47389
57 Ga0055530_10005615 3300003791 Bacteria 5886
58 Ga0055530_10006721 3300003791 Bacteria 5039
59 Ga0055530_10013110 3300003791 Bacteria 2846
60 Ga0055530_10018585 3300003791 Bacteria 2137
61 Ga0055540_1000079 3300003792 Bacteria 112817
62 Ga0055540_1000086 3300003792 Bacteria 102576
63 Ga0055540_1000578 3300003792 Bacteria 26846
64 Ga0055540_1001104 3300003792 Bacteria 17014
65 Ga0055540_1004004 3300003792 Bacteria 6860
66 Ga0055540_1014383 3300003792 Bacteria 2358
67 Ga0055540_1017767 3300003792 Bacteria 1973
68 Ga0055531_10000536 3300003794 Bacteria 33683
69 Ga0055531_10001363 3300003794 Bacteria 18136
70 Ga0055531_10010642 3300003794 Bacteria 4545
71 Ga0055531_10013529 3300003794 Bacteria 3753
72 Ga0055531_10020052 3300003794 Bacteria 2666
73 Ga0055531_10022816 3300003794 Bacteria 2370
74 Ga0055531_10022924 3300003794 Bacteria 2361
75 Ga0055543_1000805 3300004625 Bacteria 15454
76 Ga0055543_1001896 3300004625 Bacteria 7566
77 Ga0055543_1002001 3300004625 Bacteria 7242
78 Ga0065165_1005107 3300005262 Bacteria 7618
79 Ga0065165_1008339 3300005262 Bacteria 4870
80 Ga0065165_1008653 3300005262 Bacteria 4715
81 Ga0065165_1012867 3300005262 Bacteria 3373
82 Ga0065714_10124086 3300005288 Bacteria 1315
83 Ga0065704_10081381 3300005289 Bacteria 3769
84 Ga0070676_10081865 3300005328 Bacteria 1960
85 Ga0070683_100096688 3300005329 Bacteria 2778
86 Ga0070690_100046592 3300005330 Bacteria 2756
87 Ga0070680_100098501 3300005336 Bacteria 2425
88 Ga0068868_100439366 3300005338 Bacteria 1133
89 Ga0070689_100167342 3300005340 Bacteria 1780
90 Ga0070687_100028560 3300005343 Bacteria 2707
91 Ga0070661_100002671 3300005344 Bacteria 12213
92 Ga0070669_100198122 3300005353 Bacteria 1579
93 Ga0070659_100133938 3300005366 Bacteria 2014
94 Ga0070667_100162647 3300005367 Bacteria 1967
95 Ga0070710_10028644 3300005437 Bacteria 2981
96 Ga0070662_100009317 3300005457 Bacteria 6416
97 Ga0068867_100160666 3300005459 Bacteria 1772
98 Ga0070679_100187766 3300005530 Bacteria 2036
99 Ga0070679_100614913 3300005530 Bacteria 1030
100 Ga0070686_100013770 3300005544 Bacteria 4639
101 Ga0070665_100279277 3300005548 Bacteria 1672
102 Ga0070665_100334758 3300005548 Bacteria 1518
103 Ga0068855_100096209 3300005563 Bacteria 3412
104 Ga0070664_100027002 3300005564 Bacteria 4768
105 Ga0070664_100259811 3300005564 Bacteria 1562
106 Ga0070664_100298088 3300005564 Bacteria 1456
107 Ga0070664_100599947 3300005564 Bacteria 1021
108 Ga0068857_100030969 3300005577 Bacteria 4727
109 Ga0068854_100221493 3300005578 Bacteria 1497
110 Ga0070702_100354814 3300005615 Bacteria 1034
111 Ga0068852_100007651 3300005616 Bacteria 7899
112 Ga0068852_100030084 3300005616 Bacteria 4466
113 Ga0068859_100101309 3300005617 Bacteria 2937
114 Ga0068858_100088828 3300005842 Bacteria 2876
115 Ga0081539_10001356 3300005985 Bacteria 42605
116 Ga0075365_10021178 3300006038 Bacteria 4051
117 Ga0075365_10027325 3300006038 Bacteria 3630
118 Ga0075365_10051968 3300006038 Bacteria 2709
119 Ga0075365_10059315 3300006038 Bacteria 2550
120 Ga0075368_10002580 3300006042 Bacteria 5940
121 Ga0075363_100009495 3300006048 Bacteria 4574
122 Ga0075363_100011657 3300006048 Bacteria 4217
123 Ga0075363_100118134 3300006048 Bacteria 1479
124 Ga0075364_10006781 3300006051 Bacteria 6754
125 Ga0075364_10096910 3300006051 Bacteria 1962
126 Ga0075362_10004271 3300006177 Bacteria 5107
127 Ga0075362_10008739 3300006177 Bacteria 3891
128 Ga0075362_10010016 3300006177 Bacteria 3685
129 Ga0075362_10017847 3300006177 Bacteria 2928
130 Ga0075362_10020067 3300006177 Bacteria 2789
131 Ga0075362_10072510 3300006177 Bacteria 1575
132 Ga0075362_10138525 3300006177 Bacteria 1162
133 Ga0075367_10003242 3300006178 Bacteria 7698
134 Ga0075367_10160279 3300006178 Bacteria 1399
135 Ga0075369_10047418 3300006186 Bacteria 1852
136 Ga0075366_10001774 3300006195 Bacteria 10888
137 Ga0075366_10007976 3300006195 Bacteria 5863
138 Ga0075366_10013528 3300006195 Bacteria 4650
139 Ga0075366_10027503 3300006195 Bacteria 3337
140 Ga0075366_10067359 3300006195 Bacteria 2130
141 Ga0075366_10078028 3300006195 Bacteria 1976
142 Ga0097621_100001352 3300006237 Bacteria 16880
143 Ga0075370_10000855 3300006353 Bacteria 12358
144 Ga0075370_10000948 3300006353 Bacteria 11930
145 Ga0075370_10003921 3300006353 Bacteria 7143
146 Ga0075370_10016758 3300006353 Bacteria 3947
147 Ga0075370_10019514 3300006353 Bacteria 3694
148 Ga0075370_10027582 3300006353 Bacteria 3152
149 Ga0075370_10031657 3300006353 Bacteria 2953
150 Ga0075370_10034068 3300006353 Bacteria 2854
151 Ga0075370_10159443 3300006353 Bacteria 1324
152 Ga0075370_10192607 3300006353 Bacteria 1202
153 Ga0068871_100072909 3300006358 Bacteria 2829
154 Ga0068871_100293739 3300006358 Bacteria 1425
155 Ga0075433_10000369 3300006852 Bacteria 28286
156 Ga0075434_100000187 3300006871 Bacteria 40764
157 Ga0075434_100001022 3300006871 Bacteria 22777
158 Ga0075429_100090684 3300006880 Bacteria 2666
159 Ga0075436_100016561 3300006914 Bacteria 5046
160 Ga0075436_100039260 3300006914 Bacteria 3268
161 Ga0097620_100101314 3300006931 Bacteria 2937
162 Ga0079104_1000034 3300006946 Bacteria 199368
163 Ga0079104_1000100 3300006946 Bacteria 126924
164 Ga0079104_1011656 3300006946 Bacteria 2812
165 Ga0099826_10000831 3300006948 Bacteria 16641
166 Ga0075435_100000126 3300007076 Bacteria 43549
167 Ga0075435_100013976 3300007076 Bacteria 5987
168 Ga0099794_10001777 3300007265 Bacteria 7682
169 Ga0105244_10000699 3300009036 Bacteria 29093
170 Ga0105250_10028913 3300009092 Bacteria 2230
171 Ga0105240_10085376 3300009093 Bacteria 3867
172 Ga0105240_10088473 3300009093 Bacteria 3789
173 Ga0111539_10055258 3300009094 Bacteria 4720
174 Ga0105243_10003962 3300009148 Bacteria 11811
175 Ga0105243_10007155 3300009148 Bacteria 8578
176 Ga0105243_10009092 3300009148 Bacteria 7591
177 Ga0105243_10034358 3300009148 Bacteria 3925
178 Ga0105243_10042495 3300009148 Bacteria 3558
179 Ga0105241_10055398 3300009174 Bacteria 3038
180 Ga0105241_10312537 3300009174 Bacteria 1352
181 Ga0105242_10006957 3300009176 Bacteria 8729
182 Ga0105242_10350059 3300009176 Bacteria 1364
183 Ga0105242_10410953 3300009176 Bacteria 1266
184 Ga0105237_10011096 3300009545 Bacteria 9549
185 Ga0105238_10197750 3300009551 Bacteria 1986
186 Ga0105238_10289003 3300009551 Bacteria 1621
187 Ga0105239_10594363 3300010375 Bacteria 1262
188 Ga0105246_10071480 3300011119 Bacteria 2443
189 Ga0105246_10291497 3300011119 Bacteria 1313
190 Ga0105246_10309044 3300011119 Bacteria 1280
191 Ga0157373_10075329 3300013100 Bacteria 2381
192 Ga0157373_10132358 3300013100 Bacteria 1754
193 Ga0157373_10158989 3300013100 Bacteria 1590
194 Ga0157370_10022578 3300013104 Bacteria 6262
195 Ga0157370_10730574 3300013104 Bacteria 903
196 Ga0157369_10044036 3300013105 Bacteria 4861
197 Ga0157378_10069662 3300013297 Bacteria 3156
198 Ga0163163_10652925 3300014325 Bacteria 1115
199 Ga0182008_10000418 3300014497 Bacteria 32935
200 Ga0182008_10008154 3300014497 Bacteria 5734
201 Ga0182008_10032416 3300014497 Bacteria 2626
202 Ga0182008_10096862 3300014497 Bacteria 1456
203 Ga0157376_10021945 3300014969 Bacteria 4967
204 Ga0157376_10932236 3300014969 Bacteria 888
205 Ga0182006_1000867 3300015261 Bacteria 20300
206 Ga0182006_1055366 3300015261 Bacteria 1514
207 Ga0182007_10000627 3300015262 Bacteria 20547
208 Ga0182007_10002274 3300015262 Bacteria 9676
209 Ga0182005_1048620 3300015265 Bacteria 1152
210 Ga0183362_10001 3300015683 Bacteria 2046624
211 Ga0163161_10031156 3300017792 Bacteria 3798
212 Ga0163161_10037236 3300017792 Bacteria 3487
213 Ga0213872_10000074 3300021361 Bacteria 90986
214 Ga0213872_10012229 3300021361 Bacteria 4044
215 Ga0209435_100001 3300025206 Bacteria 1424171
216 Ga0209436_105671 3300025208 Bacteria 2831
217 Ga0209672_100775 3300025228 Bacteria 15309
218 Ga0209147_100541 3300025229 Bacteria 21608
219 Ga0209258_100022 3300025242 Bacteria 553584
220 Ga0207425_1000154 3300025245 Bacteria 58601
221 Ga0207425_1000959 3300025245 Bacteria 13578
222 Ga0207425_1002619 3300025245 Bacteria 6220
223 Ga0207425_1005184 3300025245 Bacteria 3753
224 Ga0209646_1000001 3300025246 Bacteria 3092932
225 Ga0209026_1000001 3300025250 Bacteria 1228671
226 Ga0209148_1000034 3300025254 Bacteria 553584
227 Ga0209759_1000001 3300025256 Bacteria 2799452
228 Ga0209129_1000023 3300025258 Bacteria 420646
229 Ga0209129_1001811 3300025258 Bacteria 11351
230 Ga0209129_1003387 3300025258 Bacteria 6997
231 Ga0209129_1026680 3300025258 Bacteria 995
232 Ga0209565_1000096 3300025263 Bacteria 134434
233 Ga0209565_1000114 3300025263 Bacteria 116078
234 Ga0209565_1000125 3300025263 Bacteria 110485
235 Ga0209565_1001491 3300025263 Bacteria 10225
236 Ga0209565_1004038 3300025263 Bacteria 4573
237 Ga0209565_1019267 3300025263 Bacteria 1460
238 Ga0209673_1000192 3300025273 Bacteria 123155
239 Ga0209673_1000232 3300025273 Bacteria 108581
240 Ga0209673_1000572 3300025273 Bacteria 58687
241 Ga0209673_1000583 3300025273 Bacteria 57643
242 Ga0209673_1002127 3300025273 Bacteria 14789
243 Ga0209130_1000041 3300025284 Bacteria 261078
244 Ga0209130_1000113 3300025284 Bacteria 130804
245 Ga0209130_1000508 3300025284 Bacteria 39372
246 Ga0209130_1000752 3300025284 Bacteria 28075
247 Ga0209130_1001465 3300025284 Bacteria 15515
248 Ga0209675_1000029 3300025291 Bacteria 281053
249 Ga0209675_1000705 3300025291 Bacteria 22965
250 Ga0209675_1001714 3300025291 Bacteria 12082
251 Ga0209675_1001840 3300025291 Bacteria 11522
252 Ga0209675_1003283 3300025291 Bacteria 7775
253 Ga0209675_1019065 3300025291 Bacteria 1900
254 Ga0209675_1025320 3300025291 Bacteria 1499
255 Ga0209675_1034908 3300025291 Bacteria 1152
256 Ga0209676_1000005 3300025292 Bacteria 1076001
257 Ga0209676_1000054 3300025292 Bacteria 365890
258 Ga0209676_1000285 3300025292 Bacteria 104459
259 Ga0209676_1000418 3300025292 Bacteria 75214
260 Ga0209676_1000705 3300025292 Bacteria 46561
261 Ga0209676_1002444 3300025292 Bacteria 13185
262 Ga0209676_1003024 3300025292 Bacteria 10913
263 Ga0209676_1004565 3300025292 Bacteria 7663
264 Ga0209676_1024486 3300025292 Bacteria 1954
265 Ga0209025_1000531 3300025294 Bacteria 72578
266 Ga0209025_1000745 3300025294 Bacteria 54850
267 Ga0209025_1001493 3300025294 Bacteria 30271
268 Ga0209025_1003514 3300025294 Bacteria 14717
269 Ga0209025_1003579 3300025294 Bacteria 14523
270 Ga0209025_1006274 3300025294 Bacteria 9300
271 Ga0209025_1008516 3300025294 Bacteria 7370
272 Ga0209564_1000270 3300025295 Bacteria 108503
273 Ga0209564_1000817 3300025295 Bacteria 42412
274 Ga0209564_1000912 3300025295 Bacteria 38636
275 Ga0209564_1001098 3300025295 Bacteria 32197
276 Ga0209758_1000064 3300025297 Bacteria 311812
277 Ga0209758_1006195 3300025297 Bacteria 8737
278 Ga0209758_1024025 3300025297 Bacteria 2731
279 Ga0209050_1000007 3300025298 Bacteria 1187891
280 Ga0209050_1000066 3300025298 Bacteria 305458
281 Ga0209050_1000570 3300025298 Bacteria 59779
282 Ga0209050_1000690 3300025298 Bacteria 50644
283 Ga0209050_1002884 3300025298 Bacteria 13579
284 Ga0209050_1003061 3300025298 Bacteria 12887
285 Ga0209050_1006842 3300025298 Bacteria 6622
286 Ga0209050_1006996 3300025298 Bacteria 6488
287 Ga0209050_1008118 3300025298 Bacteria 5691
288 Ga0209050_1019941 3300025298 Bacteria 2520
289 Ga0209256_1000003 3300025299 Bacteria 1661127
290 Ga0209256_1000020 3300025299 Bacteria 542402
291 Ga0209256_1000356 3300025299 Bacteria 74710
292 Ga0209256_1000577 3300025299 Bacteria 52302
293 Ga0207426_1000001 3300025302 Bacteria 1341301
294 Ga0207426_1000031 3300025302 Bacteria 460699
295 Ga0207426_1000061 3300025302 Bacteria 362507
296 Ga0207426_1001299 3300025302 Bacteria 21465
297 Ga0209051_1000009 3300025303 Bacteria 706778
298 Ga0209051_1000044 3300025303 Bacteria 305458
299 Ga0209051_1000210 3300025303 Bacteria 102629
300 Ga0209051_1000327 3300025303 Bacteria 71493
301 Ga0209051_1000363 3300025303 Bacteria 66432
302 Ga0209051_1000491 3300025303 Bacteria 51059
303 Ga0209051_1000564 3300025303 Bacteria 45000
304 Ga0209051_1018878 3300025303 Bacteria 3033
305 Ga0209257_1000011 3300025304 Bacteria 1112630
306 Ga0209257_1000055 3300025304 Bacteria 415534
307 Ga0209257_1000082 3300025304 Bacteria 305458
308 Ga0209257_1000314 3300025304 Bacteria 102629
309 Ga0209257_1000502 3300025304 Bacteria 69204
310 Ga0209257_1002902 3300025304 Bacteria 15869
311 Ga0209257_1006390 3300025304 Bacteria 7621
312 Ga0209257_1007389 3300025304 Bacteria 6645
313 Ga0209257_1011545 3300025304 Bacteria 4235
314 Ga0207655_1001588 3300025728 Bacteria 20387
315 Ga0207692_10117664 3300025898 Bacteria 1483
316 Ga0207654_10028668 3300025911 Bacteria 3037
317 Ga0207660_10113961 3300025917 Bacteria 2039
318 Ga0207662_10056620 3300025918 Bacteria 2342
319 Ga0207649_10005908 3300025920 Bacteria 6634
320 Ga0207649_10082370 3300025920 Bacteria 2086
321 Ga0207681_10129901 3300025923 Bacteria 1861
322 Ga0207690_10008693 3300025932 Bacteria 6025
323 Ga0207706_10006639 3300025933 Bacteria 10703
324 Ga0207706_10007228 3300025933 Bacteria 10267
325 Ga0207706_10027392 3300025933 Bacteria 5095
326 Ga0207686_10002673 3300025934 Bacteria 9679
327 Ga0207709_10000019 3300025935 Bacteria 402225
328 Ga0207709_10001066 3300025935 Bacteria 20206
329 Ga0207709_10002413 3300025935 Bacteria 11753
330 Ga0207709_10015195 3300025935 Bacteria 4267
331 Ga0207670_10483498 3300025936 Bacteria 1003
332 Ga0207669_10037359 3300025937 Bacteria 2786
333 Ga0207691_10293971 3300025940 Bacteria 1397
334 Ga0207689_10325742 3300025942 Bacteria 1275
335 Ga0207661_10108995 3300025944 Bacteria 2339
336 Ga0207679_10001480 3300025945 Bacteria 14724
337 Ga0207679_10003955 3300025945 Bacteria 9203
338 Ga0207667_10664516 3300025949 Bacteria 1047
339 Ga0207651_10162408 3300025960 Bacteria 1753
340 Ga0207640_10117256 3300025981 Bacteria 1900
341 Ga0207677_10015245 3300026023 Bacteria 4514
342 Ga0207677_10397527 3300026023 Bacteria 1168
343 Ga0207703_10014663 3300026035 Bacteria 6116
344 Ga0207639_10025392 3300026041 Bacteria 4296
345 Ga0207639_10355771 3300026041 Bacteria 1309
346 Ga0207678_10117897 3300026067 Bacteria 2265
347 Ga0207648_10459777 3300026089 Bacteria 1160
348 Ga0207676_10119487 3300026095 Bacteria 2220
349 Ga0207674_10531007 3300026116 Bacteria 1137
350 Ga0207683_10287041 3300026121 Bacteria 1504
351 Ga0207698_10034650 3300026142 Bacteria 3682
352 Ga0207698_10507377 3300026142 Bacteria 1175
353 Ga0209281_1000005 3300027111 Bacteria 1242284
354 Ga0209281_1004678 3300027111 Bacteria 4020
355 Ga0209282_1001130 3300027666 Bacteria 14241
356 Ga0209813_10002277 3300027866 Bacteria 4386
357 Ga0209974_10082148 3300027876 Bacteria 1110
358 Ga0209974_10099729 3300027876 Bacteria 1014
359 Ga0207428_10071917 3300027907 Bacteria 2716
360 Ga0268266_10049385 3300028379 Bacteria 3608
361 Ga0307515_10000026 3300028794 Bacteria 382411
362 Ga0307515_10000028 3300028794 Bacteria 368467
363 Ga0307515_10000358 3300028794 Bacteria 112133
364 Ga0307515_10000702 3300028794 Bacteria 77364
365 Ga0307515_10290805 3300028794 Bacteria 1330
366 Ga0316177_1015869 3300030731 Bacteria 1585
367 Ga0316176_1179678 3300030732 Bacteria 1731
368 Ga0314311_1173925 3300030733 Bacteria 2169
369 Ga0265330_10024749 3300031235 Bacteria 2722
370 Ga0265332_10000002 3300031238 Bacteria 709510
371 Ga0265332_10000003 3300031238 Bacteria 482849
372 Ga0265332_10029887 3300031238 Bacteria 2380
373 Ga0265325_10001303 3300031241 Bacteria 17663
374 Ga0265340_10023487 3300031247 Bacteria 3144
375 Ga0265327_10000293 3300031251 Bacteria 96862
376 Ga0265327_10013279 3300031251 Bacteria 5481
377 Ga0307513_10000012 3300031456 Bacteria 328865
378 Ga0307513_10000021 3300031456 Bacteria 228078
379 Ga0307513_10177396 3300031456 Bacteria 1999
380 Ga0307408_100001814 3300031548 Bacteria 15559
381 Ga0307408_100021024 3300031548 Bacteria 4411
382 Ga0307408_100111097 3300031548 Bacteria 2105
383 Ga0307408_100126179 3300031548 Bacteria 1990
384 Ga0307408_100487569 3300031548 Bacteria 1076
385 Ga0307408_100523765 3300031548 Bacteria 1041
386 Ga0307514_10011048 3300031649 Bacteria 7523
387 Ga0307514_10064235 3300031649 Bacteria 2784
388 Ga0265314_10000066 3300031711 Bacteria 156399
389 Ga0265314_10013569 3300031711 Bacteria 6574
390 Ga0265342_10053711 3300031712 Bacteria 2397
391 Ga0307516_10019825 3300031730 Bacteria 6954
392 Ga0307516_10281440 3300031730 Bacteria 1345
393 Ga0307405_10038723 3300031731 Bacteria 2876
394 Ga0307405_10111779 3300031731 Bacteria 1852
395 Ga0307405_10253448 3300031731 Bacteria 1311
396 Ga0307405_10371177 3300031731 Bacteria 1110
397 Ga0307406_10001092 3300031901 Bacteria 15102
398 Ga0307406_10004344 3300031901 Bacteria 7714
399 Ga0307407_10031017 3300031903 Bacteria 2891
400 Ga0307412_10007370 3300031911 Bacteria 6238
401 Ga0307412_10085187 3300031911 Bacteria 2196
402 Ga0307412_10091354 3300031911 Bacteria 2131
403 Ga0307412_10276440 3300031911 Bacteria 1316
404 Ga0307412_10362637 3300031911 Bacteria 1167
405 Ga0307416_100008192 3300032002 Bacteria 6719
406 Ga0307416_100917673 3300032002 Bacteria 976
407 Ga0307414_10004678 3300032004 Bacteria 7462
408 Ga0307411_10187615 3300032005 Bacteria 1575
409 Ga0307510_10299490 3300033180 Bacteria 1071
410 Ga0373923_0056557 3300035111 Bacteria 1657
411 Ga0373953_0021435 3300035117 Bacteria 2425
412 Ga0373954_0040264 3300035118 Bacteria 2177
413 Ga0373956_0105734 3300035119 Bacteria 1308
414 Ga0373955_0026390 3300035172 Bacteria 2992
415 Ga0373942_0002461 3300035207 Bacteria 4490
416 Ga0373924_0022331 3300035410 Bacteria 2474
417 Ga0373933_0078880 3300035724 Bacteria 2015
418 Ga0373947_0212293 3300035725 Bacteria 1270
419 Ga0373937_0351316 3300036401 Bacteria 1396
420 Ga0395899_0001484 3300037312 Bacteria 19967
421 Ga0395905_0000763 3300037471 Bacteria 42401
422 Ga0395905_0003434 3300037471 Bacteria 16949
423 Ga0395905_0010399 3300037471 Bacteria 9059
424 Ga0395905_0013696 3300037471 Bacteria 7766
425 Ga0395905_0016368 3300037471 Bacteria 7045
426 Ga0395905_0084023 3300037471 Bacteria 2982
427 Ga0395905_0127497 3300037471 Bacteria 2393
428 Ga0395905_0474924 3300037471 Bacteria 1149
429 Ga0395901_0166457 3300038443 Bacteria 2314
430 Ga0395901_0562302 3300038443 Bacteria 1155
431 Ga0436361_0292057 3300039447 Bacteria 25019
432 Ga0436361_0531535 3300039447 Bacteria 9893
433 Ga0439436_0007968 3300041404 Bacteria 3254
434 Ga0439439_0002537 3300041406 Bacteria 3897
435 Ga0439439_0035232 3300041406 Bacteria 1285
436 Ga0451789_0899535 3300041443 Bacteria 1097
437 Ga0451795_0091317 3300041456 Bacteria 4362
438 Ga0451800_0943611 3300041459 Bacteria 1169
439 Ga0451804_0073610 3300041463 Bacteria 1388
440 Ga0439431_0000588 3300041997 Bacteria 7704
441 Ga0439442_020156 3300042002 Bacteria 1381
442 Ga0439432_015682 3300042006 Bacteria 2554
443 Ga0439449_0000431 3300042007 Bacteria 15498
444 Ga0439449_0000884 3300042007 Bacteria 11695
445 Ga0439449_0001803 3300042007 Bacteria 8428
446 Ga0439449_0014807 3300042007 Bacteria 2930
447 Ga0439449_0020448 3300042007 Bacteria 2480
448 Ga0439449_0077836 3300042007 Bacteria 1223
449 Ga0439452_021393 3300042010 Bacteria 1686
450 Ga0439462_0006427 3300042015 Bacteria 2921
451 Ga0439462_0016415 3300042015 Bacteria 1912
452 Ga0450911_000110 3300042115 Bacteria 33959
453 Ga0450919_007990 3300042121 Bacteria 1229
454 Ga0450894_006311 3300042131 Bacteria 1530
455 Ga0450906_006599 3300042145 Bacteria 2333
456 Ga0450910_014396 3300042147 Bacteria 1157
457 Ga0439446_0021019 3300042156 Bacteria 1842
458 Ga0450908_001993 3300042184 Bacteria 3997
459 Ga0439434_0013581 3300042435 Bacteria 2419
460 Ga0439434_0018542 3300042435 Bacteria 2084
461 Ga0439434_0035255 3300042435 Bacteria 1529
462 Ga0450918_000575 3300042531 Bacteria 7811
463 Ga0450893_0003213 3300042532 Bacteria 2569
464 Ga0451577_0000141 3300042876 Bacteria 161372
465 Ga0451577_0000728 3300042876 Bacteria 51004
466 Ga0451577_0011015 3300042876 Bacteria 8588
467 Ga0451577_0175728 3300042876 Bacteria 1930
468 Ga0451577_0328749 3300042876 Bacteria 1386
469 Ga0466969_0114690 3300044656 Bacteria 1258
470 Ga0466972_0002814 3300044658 Bacteria 8620
471 Ga0453683_0000580 3300044673 Bacteria 40538
472 Ga0453683_0028768 3300044673 Bacteria 3517
473 Ga0466965_0062178 3300044683 Bacteria 1867
474 Ga0466965_0136060 3300044683 Bacteria 1277
475 Ga0466966_0038123 3300044684 Bacteria 3097
476 Ga0466964_0019078 3300044706 Bacteria 2635
477 Ga0453684_0000121 3300044712 Bacteria 341067
478 Ga0453684_0000463 3300044712 Bacteria 161665
479 Ga0453684_0158722 3300044712 Bacteria 2677
480 Ga0466970_0052586 3300044765 Bacteria 2174
481 Ga0466960_0034649 3300044901 Bacteria 2354
482 Ga0451576_0003962 3300045051 Bacteria 19723
483 Ga0451576_0009346 3300045051 Bacteria 11372
484 Ga0451576_0038430 3300045051 Bacteria 5065
485 Ga0466958_0199132 3300045836 Bacteria 1274
486 Ga0466967_0000299 3300045976 Bacteria 22210
487 Ga0495627_030565 3300046453 Bacteria 1706
488 Ga0495627_046255 3300046453 Bacteria 1323
489 Ga0495638_0009953 3300046460 Bacteria 6629
490 Ga0495610_0036121 3300046512 Bacteria 2528
491 Ga0495616_0004462 3300046513 Bacteria 8811
492 Ga0495620_0012665 3300046515 Bacteria 4343
493 Ga0495631_0000492 3300046518 Bacteria 26294
494 Ga0495632_0006419 3300046519 Bacteria 7564
495 Ga0495637_0001313 3300046520 Bacteria 14926
496 Ga0495663_0039039 3300046525 Bacteria 1437
497 Ga0495654_0002302 3300046530 Bacteria 12352
498 Ga0495654_0015854 3300046530 Bacteria 3995
499 Ga0495597_0002478 3300046542 Bacteria 11652
500 Ga0495633_0000652 3300046558 Bacteria 32073
501 Ga0495633_0104937 3300046558 Bacteria 1311
502 Ga0495656_0000110 3300046615 Bacteria 32732
503 Ga0495656_0065897 3300046615 Bacteria 1594
504 Ga0495625_0001291 3300046660 Bacteria 31462
505 Ga0495625_0048664 3300046660 Bacteria 3051
506 Ga0495588_0062888 3300046674 Bacteria 1924
507 Ga0495588_0123934 3300046674 Bacteria 1362
508 Ga0495588_0149065 3300046674 Bacteria 1236
509 Ga0495670_0163620 3300046691 Bacteria 1170
510 Ga0495676_0009977 3300047321 Bacteria 8629
511 Ga0495680_0086867 3300047322 Bacteria 2353
512 Ga0495593_0165794 3300047673 Bacteria 1114
513 Ga0495615_0000968 3300048090 Bacteria 4080
514 Ga0496102_0086239 3300048905 Bacteria 2899
515 Ga0496102_0181582 3300048905 Bacteria 1983
516 Ga0496103_0078808 3300048906 Bacteria 2069
517 Ga0496104_0010890 3300048907 Bacteria 8135
518 Ga0496105_0001768 3300048908 Bacteria 15456
519 Ga0496106_0155367 3300048909 Bacteria 1806
520 Ga0496109_0081034 3300048912 Bacteria 2991
521 Ga0496109_0254069 3300048912 Bacteria 1655
522 Ga0496110_0324266 3300048913 Bacteria 1403
523 Ga0496114_0098290 3300048917 Bacteria 2495
524 Ga0496117_0000166 3300048920 Bacteria 138665
525 Ga0496117_0042827 3300048920 Bacteria 3300
526 Ga0496117_0073959 3300048920 Bacteria 2271
527 Ga0496117_0107684 3300048920 Bacteria 1745
528 Ga0496118_0008215 3300048921 Bacteria 10841
529 Ga0496118_0009204 3300048921 Bacteria 10031
530 Ga0496121_0000187 3300048924 Bacteria 138361
531 Ga0496121_0031937 3300048924 Bacteria 4799
532 Ga0496121_0081487 3300048924 Bacteria 2561
533 Ga0496121_0192386 3300048924 Bacteria 1461
534 Ga0496122_0013572 3300048925 Bacteria 7957
535 Ga0496122_0060650 3300048925 Bacteria 2784
536 Ga0496122_0073012 3300048925 Bacteria 2436
537 Ga0496123_0001126 3300048926 Bacteria 39890
538 Ga0496123_0028778 3300048926 Bacteria 4107
539 Ga0496123_0058815 3300048926 Bacteria 2490
540 Ga0496123_0121532 3300048926 Bacteria 1468
541 Ga0496124_0005536 3300048927 Bacteria 14150
542 Ga0496124_0041510 3300048927 Bacteria 3969
543 Ga0496124_0095827 3300048927 Bacteria 2411
544 Ga0496125_0002287 3300048928 Bacteria 25337
545 Ga0496125_0012190 3300048928 Bacteria 8554
546 Ga0496125_0012633 3300048928 Bacteria 8360
547 Ga0496125_0037939 3300048928 Bacteria 4181
548 Ga0496125_0039882 3300048928 Bacteria 4036
549 Ga0496125_0133162 3300048928 Bacteria 1745
550 Ga0501034_0209785 3300049571 Bacteria 1903
551 Ga0501046_0046217 3300049580 Bacteria 3457
552 Ga0501047_0208380 3300049581 Bacteria 1814
553 Ga0501048_0068176 3300049582 Bacteria 2514
554 Ga0501069_0102787 3300049585 Bacteria 1623
555 Ga0501072_0046328 3300049588 Bacteria 3422
556 Ga0501249_002771 3300049679 Bacteria 3528
557 Ga0501257_050029 3300049686 Bacteria 1041
558 Ga0501225_0026111 3300049705 Bacteria 1607
559 Ga0501080_0358444 3300049742 Bacteria 1316
560 Ga0501081_0091872 3300049743 Bacteria 2135
561 Ga0501262_000249 3300049759 Bacteria 6596
562 Ga0501035_0051331 3300049822 Bacteria 3693
563 nmdc:mga03683_2050_c1 3300050489 Bacteria 6177
564 nmdc:mga03683_39668_c2 3300050489 Bacteria 873
565 nmdc:mga03683_47448_c1 3300050489 Bacteria 1782
566 nmdc:mga03683_51802_c1 3300050489 Bacteria 1715
567 nmdc:mga03n38_160566_c1 3300050490 Bacteria 1138
568 nmdc:mga00v17_36402_c1 3300050491 Bacteria 2933
569 nmdc:mga0yw44_24689_c1 3300050492 Bacteria 3405
570 nmdc:mga0k408_14139_c1 3300050493 Bacteria 4391
571 nmdc:mga0k408_14754_c1 3300050493 Bacteria 4311
572 nmdc:mga0k408_194963_c1 3300050493 Bacteria 1209
573 nmdc:mga0k408_197313_c1 3300050493 Bacteria 1201
574 nmdc:mga0k408_34900_c1 3300050493 Bacteria 2882
575 nmdc:mga0k408_40749_c1 3300050493 Bacteria 2673
576 nmdc:mga0k408_56778_c1 3300050493 Bacteria 2272
577 nmdc:mga0k408_5749_c1 3300050493 Bacteria 6599
578 nmdc:mga0k408_9371_c1 3300050493 Bacteria 5276
579 nmdc:mga06z11_253318_c1 3300050494 Bacteria 1037
580 nmdc:mga06z11_320472_c1 3300050494 Bacteria 924
581 nmdc:mga06z11_33598_c1 3300050494 Bacteria 2511
582 nmdc:mga04h51_2488_c1 3300050495 Bacteria 4378
583 nmdc:mga07m45_14730_c1 3300050496 Bacteria 4174
584 nmdc:mga07m45_1917_c1 3300050496 Bacteria 9613
585 nmdc:mga07m45_46008_c1 3300050496 Bacteria 2451
586 nmdc:mga07m45_75177_c1 3300050496 Bacteria 1925
587 nmdc:mga0qj67_82537_c1 3300050509 Bacteria 2577
588 nmdc:mga0n895_58_c1 3300050512 Bacteria 65261
589 nmdc:mga0n895_619_c1 3300050512 Bacteria 24714
590 nmdc:mga0rr50_12556_c1 3300050513 Bacteria 5482
591 nmdc:mga0rr50_3841_c1 3300050513 Bacteria 8723
592 nmdc:mga08x19_727_c1 3300050514 Bacteria 21023
593 nmdc:mga0a205_173783_c1 3300050515 Bacteria 2050
594 nmdc:mga0a205_4300_c1 3300050515 Bacteria 12783
595 nmdc:mga0sz30_37496_c1 3300050516 Bacteria 2029
596 nmdc:mga0sz30_9757_c1 3300050516 Bacteria 3660
597 Ga0500610_0000495 3300053079 Bacteria 12122
598 Ga0500610_0005628 3300053079 Bacteria 5162
599 Ga0500643_002223 3300053087 Bacteria 10250
600 Ga0500644_0056391 3300053088 Bacteria 1367
601 Ga0500647_0088775 3300053091 Bacteria 1481
602 Ga0500583_0105989 3300053092 Bacteria 1381
603 Ga0500651_0000353 3300053093 Bacteria 25788
604 Ga0500651_0012001 3300053093 Bacteria 5240
605 Ga0500566_0053538 3300053094 Bacteria 2303
606 Ga0500650_0000718 3300053098 Bacteria 8906
607 Ga0500650_0031206 3300053098 Bacteria 2421
608 Ga0500562_003594 3300053108 Bacteria 3892
609 Ga0500571_000114 3300053110 Bacteria 26125
610 Ga0500593_002014 3300053117 Bacteria 7371
611 Ga0500593_003386 3300053117 Bacteria 6013
612 Ga0500594_0020643 3300053118 Bacteria 1645
613 Ga0500618_001358 3300053125 Bacteria 11139
614 Ga0500623_035386 3300053127 Bacteria 2571
615 Ga0500642_0001092 3300053130 Bacteria 7776
616 Ga0500652_000099 3300053131 Bacteria 34685
617 Ga0500655_001134 3300053133 Bacteria 5067
618 Ga0500655_012038 3300053133 Bacteria 1571
619 Ga0500559_0065092 3300053136 Bacteria 1632
620 Ga0500568_0008532 3300053139 Bacteria 4931
621 Ga0500568_0021455 3300053139 Bacteria 2777
622 Ga0500574_018941 3300053141 Bacteria 1706
623 Ga0500616_0009122 3300053153 Bacteria 6064
624 Ga0500622_0000097 3300053156 Bacteria 89802
625 Ga0500627_0000364 3300053158 Bacteria 12279
626 Ga0500634_0034126 3300053161 Bacteria 2772
627 Ga0500625_048548 3300053729 Bacteria 1970
628 Ga0500645_000274 3300053730 Bacteria 36869
629 Ga0500645_001839 3300053730 Bacteria 10172
630 Ga0501084_0020258 3300054114 Bacteria 5545
631 Ga0500661_002343 3300055283 Bacteria 3573
632 Ga0590071_000677 3300059421 Bacteria 9667
633 2644294982 2643221652 Bacteria 5140275
634 2511245562 2511231002 Bacteria 5042903
635 2513227396 2513020051 Bacteria 6053213
636 2548498315 2547132374 Bacteria 5530232
637 2548501295 2547132374 Bacteria 5530232
638 2587727937 2585428057 Bacteria 6737412
639 2587733756 2585428058 Bacteria 6853932
640 2599624499 2599185214 Bacteria 8209958
641 2599672639 2599185226 Bacteria 8233575
642 2599683639 2599185227 Bacteria 8246414
643 2599694248 2599185229 Bacteria 8216126
644 2643867582 2643221570 Bacteria 5103772
645 2643990502 2643221596 Bacteria 5006805
646 2644062927 2643221609 Bacteria 6756331
647 2644070610 2643221611 Bacteria 6820941
648 2644159451 2643221628 Bacteria 5745828
649 2644248993 2643221644 Bacteria 6865017
650 2644328068 2643221658 Bacteria 6064537
651 2644340150 2643221660 Bacteria 4208257
652 2644398623 2643221672 Bacteria 6322190
653 2644468576 2643221683 Bacteria 5749203
654 2644648849 2643221717 Bacteria 5676132
655 2644649161 2643221717 Bacteria 5676132
656 2722884597 2721755523 Bacteria 6430384
657 2738720199 2738541277 Bacteria 7458140
658 2738881741 2738541307 Bacteria 8606193
659 2739243748 2738543012 Bacteria 7115078
660 2739250885 2738543013 Bacteria 5618633
661 2739279398 2738543019 Bacteria 7459457
662 2816472587 2816332133 Bacteria 7249298
663 2819595912 2818991446 Bacteria 7757362
664 2831266938 2831265667 Bacteria 7184833
665 2838056997 2838054893 Bacteria 7451788
666 2839143197 2839138175 Bacteria 6549354
667 2842678809 2842677519 Bacteria 5615038
668 2842720273 2842718218 Bacteria 4560148
669 2842735539 2842733646 Bacteria 5716726
670 2842751368 2842747753 Bacteria 5578255
671 2881102349 2881101125 Bacteria 4590519
672 2885192840 2885192300 Bacteria 5882526
673 2885199007 2885198086 Bacteria 7212419
674 2885212730 2885211737 Bacteria 7212420
675 2894026654 2894023352 Bacteria 5167372
676 2899925260 2899924645 Bacteria 7487985
677 2904454574 2904449895 Bacteria 6927402
678 2904460983 2904456579 Bacteria 6819253
679 2904548365 2904541872 Bacteria 8915136
680 2919465861 2919462493 Bacteria 5817112
681 2919688522 2919688452 Bacteria 4595932
682 2919704792 2919704043 Bacteria 5560311
683 2928038617 2928037797 Bacteria 7273642
684 2928045778 2928044640 Bacteria 7271509
685 2928053395 2928051484 Bacteria 7773759
686 2928067000 2928064002 Bacteria 7419480
687 2928071101 2928070936 Bacteria 8062541
688 2928084958 2928084124 Bacteria 7159212
689 2928116220 2928115317 Bacteria 6477646
690 2929163758 2929160207 Bacteria 9075316
691 2929526866 2929520902 Bacteria 6765052
692 2932423624 2932422444 Bacteria 4678430
693 2945912418 2945909444 Bacteria 7065066
694 2945948332 2945945610 Bacteria 5951079
695 2945977027 2945972063 Bacteria 6086495
696 2945985264 2945984333 Bacteria 7358892
697 2974322737 2974320154 Bacteria 4571377
698 2990713096 2990710928 Bacteria 5002431
699 JGI24740J21852_10011138
700 JGI24740J21852_10013604
701 JGI25156J39149_1000002
702 JGI25154J39366_1000010
703 JGI25157J39369_1000001
704 JGI25152J39213_1003097
705 JGI25152J39213_1006587
706 JGI25150J39212_1002336
707 JGI25150J39212_1011673
708 JGI25159J45721_1001031
709 JGI25159J45721_1001487
710 JGI25159J45721_1008017
711 JGI25159J45721_1012808
712 JGI25151J46595_10000849
713 JGI25151J46595_10005377
714 JGI25151J46595_10005605
715 JGI25151J46595_10006891
716 JGI25151J46595_10009023
717 JGI25151J46595_10011921
718 JGI25153J46596_10006648
719 JGI25160J50197_1000301
720 JGI25160J50197_1015284
721 JGI25161J50226_1000043
722 JGI25161J50226_1002461
723 Ga0006562J51391_1151955
724 Ga0006562J51391_1151956
725 Ga0055535_1000263
726 Ga0055542_1000004
727 Ga0055526_1000766
728 Ga0055526_1005571
729 Ga0055526_1009308
730 Ga0055526_1009358
731 Ga0055537_1000124
732 Ga0055537_1000365
733 Ga0055537_1000479
734 Ga0055537_1003569
735 Ga0055524_1000130
736 Ga0055524_1000167
737 Ga0055524_1007210
738 Ga0055524_1013103
739 Ga0055536_1000896
740 Ga0055536_1001627
741 Ga0055536_1002373
742 Ga0055536_1013807
743 Ga0055536_1016391
744 Ga0055536_1019956
745 Ga0055534_1000117
746 Ga0055534_1003009
747 Ga0055534_1004914
748 Ga0055534_1005542
749 Ga0055534_1006602
750 Ga0055528_1000145
751 Ga0055528_1001213
752 Ga0055528_1007631
753 Ga0055528_1022869
754 Ga0055530_10000265
755 Ga0055530_10005615
756 Ga0055530_10006721
757 Ga0055530_10013110
758 Ga0055530_10018585
759 Ga0055540_1000079
760 Ga0055540_1000086
761 Ga0055540_1000578
762 Ga0055540_1001104
763 Ga0055540_1004004
764 Ga0055540_1014383
765 Ga0055540_1017767
766 Ga0055531_10000536
767 Ga0055531_10001363
768 Ga0055531_10010642
769 Ga0055531_10013529
770 Ga0055531_10020052
771 Ga0055531_10022816
772 Ga0055531_10022924
773 Ga0055543_1000805
774 Ga0055543_1001896
775 Ga0055543_1002001
776 Ga0065165_1005107
777 Ga0065165_1008339
778 Ga0065165_1008653
779 Ga0065165_1012867
780 Ga0065714_10124086
781 Ga0065704_10081381
782 Ga0070676_10081865
783 Ga0070683_100096688
784 Ga0070690_100046592
785 Ga0070680_100098501
786 Ga0068868_100439366
787 Ga0070689_100167342
788 Ga0070687_100028560
789 Ga0070661_100002671
790 Ga0070669_100198122
791 Ga0070659_100133938
792 Ga0070667_100162647
793 Ga0070710_10028644
794 Ga0070662_100009317
795 Ga0068867_100160666
796 Ga0070679_100187766
797 Ga0070679_100614913
798 Ga0070686_100013770
799 Ga0070665_100279277
800 Ga0070665_100334758
801 Ga0068855_100096209
802 Ga0070664_100027002
803 Ga0070664_100259811
804 Ga0070664_100298088
805 Ga0070664_100599947
806 Ga0068857_100030969
807 Ga0068854_100221493
808 Ga0070702_100354814
809 Ga0068852_100007651
810 Ga0068852_100030084
811 Ga0068859_100101309
812 Ga0068858_100088828
813 Ga0081539_10001356
814 Ga0075365_10021178
815 Ga0075365_10027325
816 Ga0075365_10051968
817 Ga0075365_10059315
818 Ga0075368_10002580
819 Ga0075363_100009495
820 Ga0075363_100011657
821 Ga0075363_100118134
822 Ga0075364_10006781
823 Ga0075364_10096910
824 Ga0075362_10004271
825 Ga0075362_10008739
826 Ga0075362_10010016
827 Ga0075362_10017847
828 Ga0075362_10020067
829 Ga0075362_10072510
830 Ga0075362_10138525
831 Ga0075367_10003242
832 Ga0075367_10160279
833 Ga0075369_10047418
834 Ga0075366_10001774
835 Ga0075366_10007976
836 Ga0075366_10013528
837 Ga0075366_10027503
838 Ga0075366_10067359
839 Ga0075366_10078028
840 Ga0097621_100001352
841 Ga0075370_10000855
842 Ga0075370_10000948
843 Ga0075370_10003921
844 Ga0075370_10016758
845 Ga0075370_10019514
846 Ga0075370_10027582
847 Ga0075370_10031657
848 Ga0075370_10034068
849 Ga0075370_10159443
850 Ga0075370_10192607
851 Ga0068871_100072909
852 Ga0068871_100293739
853 Ga0075433_10000369
854 Ga0075434_100000187
855 Ga0075434_100001022
856 Ga0075429_100090684
857 Ga0075436_100016561
858 Ga0075436_100039260
859 Ga0097620_100101314
860 Ga0079104_1000034
861 Ga0079104_1000100
862 Ga0079104_1011656
863 Ga0099826_10000831
864 Ga0075435_100000126
865 Ga0075435_100013976
866 Ga0099794_10001777
867 Ga0105244_10000699
868 Ga0105250_10028913
869 Ga0105240_10085376
870 Ga0105240_10088473
871 Ga0111539_10055258
872 Ga0105243_10003962
873 Ga0105243_10007155
874 Ga0105243_10009092
875 Ga0105243_10034358
876 Ga0105243_10042495
877 Ga0105241_10055398
878 Ga0105241_10312537
879 Ga0105242_10006957
880 Ga0105242_10350059
881 Ga0105242_10410953
882 Ga0105237_10011096
883 Ga0105238_10197750
884 Ga0105238_10289003
885 Ga0105239_10594363
886 Ga0105246_10071480
887 Ga0105246_10291497
888 Ga0105246_10309044
889 Ga0157373_10075329
890 Ga0157373_10132358
891 Ga0157373_10158989
892 Ga0157370_10022578
893 Ga0157370_10730574
894 Ga0157369_10044036
895 Ga0157378_10069662
896 Ga0163163_10652925
897 Ga0182008_10000418
898 Ga0182008_10008154
899 Ga0182008_10032416
900 Ga0182008_10096862
901 Ga0157376_10021945
902 Ga0157376_10932236
903 Ga0182006_1000867
904 Ga0182006_1055366
905 Ga0182007_10000627
906 Ga0182007_10002274
907 Ga0182005_1048620
908 Ga0183362_10001
909 Ga0163161_10031156
910 Ga0163161_10037236
911 Ga0213872_10000074
912 Ga0213872_10012229
913 Ga0209435_100001
914 Ga0209436_105671
915 Ga0209672_100775
916 Ga0209147_100541
917 Ga0209258_100022
918 Ga0207425_1000154
919 Ga0207425_1000959
920 Ga0207425_1002619
921 Ga0207425_1005184
922 Ga0209646_1000001
923 Ga0209026_1000001
924 Ga0209148_1000034
925 Ga0209759_1000001
926 Ga0209129_1000023
927 Ga0209129_1001811
928 Ga0209129_1003387
929 Ga0209129_1026680
930 Ga0209565_1000096
931 Ga0209565_1000114
932 Ga0209565_1000125
933 Ga0209565_1001491
934 Ga0209565_1004038
935 Ga0209565_1019267
936 Ga0209673_1000192
937 Ga0209673_1000232
938 Ga0209673_1000572
939 Ga0209673_1000583
940 Ga0209673_1002127
941 Ga0209130_1000041
942 Ga0209130_1000113
943 Ga0209130_1000508
944 Ga0209130_1000752
945 Ga0209130_1001465
946 Ga0209675_1000029
947 Ga0209675_1000705
948 Ga0209675_1001714
949 Ga0209675_1001840
950 Ga0209675_1003283
951 Ga0209675_1019065
952 Ga0209675_1025320
953 Ga0209675_1034908
954 Ga0209676_1000005
955 Ga0209676_1000054
956 Ga0209676_1000285
957 Ga0209676_1000418
958 Ga0209676_1000705
959 Ga0209676_1002444
960 Ga0209676_1003024
961 Ga0209676_1004565
962 Ga0209676_1024486
963 Ga0209025_1000531
964 Ga0209025_1000745
965 Ga0209025_1001493
966 Ga0209025_1003514
967 Ga0209025_1003579
968 Ga0209025_1006274
969 Ga0209025_1008516
970 Ga0209564_1000270
971 Ga0209564_1000817
972 Ga0209564_1000912
973 Ga0209564_1001098
974 Ga0209758_1000064
975 Ga0209758_1006195
976 Ga0209758_1024025
977 Ga0209050_1000007
978 Ga0209050_1000066
979 Ga0209050_1000570
980 Ga0209050_1000690
981 Ga0209050_1002884
982 Ga0209050_1003061
983 Ga0209050_1006842
984 Ga0209050_1006996
985 Ga0209050_1008118
986 Ga0209050_1019941
987 Ga0209256_1000003
988 Ga0209256_1000020
989 Ga0209256_1000356
990 Ga0209256_1000577
991 Ga0207426_1000001
992 Ga0207426_1000031
993 Ga0207426_1000061
994 Ga0207426_1001299
995 Ga0209051_1000009
996 Ga0209051_1000044
997 Ga0209051_1000210
998 Ga0209051_1000327
999 Ga0209051_1000363
1000 Ga0209051_1000491
1001 Ga0209051_1000564
1002 Ga0209051_1018878
1003 Ga0209257_1000011
1004 Ga0209257_1000055
1005 Ga0209257_1000082
1006 Ga0209257_1000314
1007 Ga0209257_1000502
1008 Ga0209257_1002902
1009 Ga0209257_1006390
1010 Ga0209257_1007389
1011 Ga0209257_1011545
1012 Ga0207655_1001588
1013 Ga0207692_10117664
1014 Ga0207654_10028668
1015 Ga0207660_10113961
1016 Ga0207662_10056620
1017 Ga0207649_10005908
1018 Ga0207649_10082370
1019 Ga0207681_10129901
1020 Ga0207690_10008693
1021 Ga0207706_10006639
1022 Ga0207706_10007228
1023 Ga0207706_10027392
1024 Ga0207686_10002673
1025 Ga0207709_10000019
1026 Ga0207709_10001066
1027 Ga0207709_10002413
1028 Ga0207709_10015195
1029 Ga0207670_10483498
1030 Ga0207669_10037359
1031 Ga0207691_10293971
1032 Ga0207689_10325742
1033 Ga0207661_10108995
1034 Ga0207679_10001480
1035 Ga0207679_10003955
1036 Ga0207667_10664516
1037 Ga0207651_10162408
1038 Ga0207640_10117256
1039 Ga0207677_10015245
1040 Ga0207677_10397527
1041 Ga0207703_10014663
1042 Ga0207639_10025392
1043 Ga0207639_10355771
1044 Ga0207678_10117897
1045 Ga0207648_10459777
1046 Ga0207676_10119487
1047 Ga0207674_10531007
1048 Ga0207683_10287041
1049 Ga0207698_10034650
1050 Ga0207698_10507377
1051 Ga0209281_1000005
1052 Ga0209281_1004678
1053 Ga0209282_1001130
1054 Ga0209813_10002277
1055 Ga0209974_10082148
1056 Ga0209974_10099729
1057 Ga0207428_10071917
1058 Ga0268266_10049385
1059 Ga0307515_10000026
1060 Ga0307515_10000028
1061 Ga0307515_10000358
1062 Ga0307515_10000702
1063 Ga0307515_10290805
1064 Ga0316177_1015869
1065 Ga0316176_1179678
1066 Ga0314311_1173925
1067 Ga0265330_10024749
1068 Ga0265332_10000002
1069 Ga0265332_10000003
1070 Ga0265332_10029887
1071 Ga0265325_10001303
1072 Ga0265340_10023487
1073 Ga0265327_10000293
1074 Ga0265327_10013279
1075 Ga0307513_10000012
1076 Ga0307513_10000021
1077 Ga0307513_10177396
1078 Ga0307408_100001814
1079 Ga0307408_100021024
1080 Ga0307408_100111097
1081 Ga0307408_100126179
1082 Ga0307408_100487569
1083 Ga0307408_100523765
1084 Ga0307514_10011048
1085 Ga0307514_10064235
1086 Ga0265314_10000066
1087 Ga0265314_10013569
1088 Ga0265342_10053711
1089 Ga0307516_10019825
1090 Ga0307516_10281440
1091 Ga0307405_10038723
1092 Ga0307405_10111779
1093 Ga0307405_10253448
1094 Ga0307405_10371177
1095 Ga0307406_10001092
1096 Ga0307406_10004344
1097 Ga0307407_10031017
1098 Ga0307412_10007370
1099 Ga0307412_10085187
1100 Ga0307412_10091354
1101 Ga0307412_10276440
1102 Ga0307412_10362637
1103 Ga0307416_100008192
1104 Ga0307416_100917673
1105 Ga0307414_10004678
1106 Ga0307411_10187615
1107 Ga0307510_10299490
1108 Ga0373923_0056557
1109 Ga0373953_0021435
1110 Ga0373954_0040264
1111 Ga0373956_0105734
1112 Ga0373955_0026390
1113 Ga0373942_0002461
1114 Ga0373924_0022331
1115 Ga0373933_0078880
1116 Ga0373947_0212293
1117 Ga0373937_0351316
1118 Ga0395899_0001484
1119 Ga0395905_0000763
1120 Ga0395905_0003434
1121 Ga0395905_0010399
1122 Ga0395905_0013696
1123 Ga0395905_0016368
1124 Ga0395905_0084023
1125 Ga0395905_0127497
1126 Ga0395905_0474924
1127 Ga0395901_0166457
1128 Ga0395901_0562302
1129 Ga0436361_0292057
1130 Ga0436361_0531535
1131 Ga0439436_0007968
1132 Ga0439439_0002537
1133 Ga0439439_0035232
1134 Ga0451789_0899535
1135 Ga0451795_0091317
1136 Ga0451800_0943611
1137 Ga0451804_0073610
1138 Ga0439431_0000588
1139 Ga0439442_020156
1140 Ga0439432_015682
1141 Ga0439449_0000431
1142 Ga0439449_0000884
1143 Ga0439449_0001803
1144 Ga0439449_0014807
1145 Ga0439449_0020448
1146 Ga0439449_0077836
1147 Ga0439452_021393
1148 Ga0439462_0006427
1149 Ga0439462_0016415
1150 Ga0450911_000110
1151 Ga0450919_007990
1152 Ga0450894_006311
1153 Ga0450906_006599
1154 Ga0450910_014396
1155 Ga0439446_0021019
1156 Ga0450908_001993
1157 Ga0439434_0013581
1158 Ga0439434_0018542
1159 Ga0439434_0035255
1160 Ga0450918_000575
1161 Ga0450893_0003213
1162 Ga0451577_0000141
1163 Ga0451577_0000728
1164 Ga0451577_0011015
1165 Ga0451577_0175728
1166 Ga0451577_0328749
1167 Ga0466969_0114690
1168 Ga0466972_0002814
1169 Ga0453683_0000580
1170 Ga0453683_0028768
1171 Ga0466965_0062178
1172 Ga0466965_0136060
1173 Ga0466966_0038123
1174 Ga0466964_0019078
1175 Ga0453684_0000121
1176 Ga0453684_0000463
1177 Ga0453684_0158722
1178 Ga0466970_0052586
1179 Ga0466960_0034649
1180 Ga0451576_0003962
1181 Ga0451576_0009346
1182 Ga0451576_0038430
1183 Ga0466958_0199132
1184 Ga0466967_0000299
1185 Ga0495627_030565
1186 Ga0495627_046255
1187 Ga0495638_0009953
1188 Ga0495610_0036121
1189 Ga0495616_0004462
1190 Ga0495620_0012665
1191 Ga0495631_0000492
1192 Ga0495632_0006419
1193 Ga0495637_0001313
1194 Ga0495663_0039039
1195 Ga0495654_0002302
1196 Ga0495654_0015854
1197 Ga0495597_0002478
1198 Ga0495633_0000652
1199 Ga0495633_0104937
1200 Ga0495656_0000110
1201 Ga0495656_0065897
1202 Ga0495625_0001291
1203 Ga0495625_0048664
1204 Ga0495588_0062888
1205 Ga0495588_0123934
1206 Ga0495588_0149065
1207 Ga0495670_0163620
1208 Ga0495676_0009977
1209 Ga0495680_0086867
1210 Ga0495593_0165794
1211 Ga0495615_0000968
1212 Ga0496102_0086239
1213 Ga0496102_0181582
1214 Ga0496103_0078808
1215 Ga0496104_0010890
1216 Ga0496105_0001768
1217 Ga0496106_0155367
1218 Ga0496109_0081034
1219 Ga0496109_0254069
1220 Ga0496110_0324266
1221 Ga0496114_0098290
1222 Ga0496117_0000166
1223 Ga0496117_0042827
1224 Ga0496117_0073959
1225 Ga0496117_0107684
1226 Ga0496118_0008215
1227 Ga0496118_0009204
1228 Ga0496121_0000187
1229 Ga0496121_0031937
1230 Ga0496121_0081487
1231 Ga0496121_0192386
1232 Ga0496122_0013572
1233 Ga0496122_0060650
1234 Ga0496122_0073012
1235 Ga0496123_0001126
1236 Ga0496123_0028778
1237 Ga0496123_0058815
1238 Ga0496123_0121532
1239 Ga0496124_0005536
1240 Ga0496124_0041510
1241 Ga0496124_0095827
1242 Ga0496125_0002287
1243 Ga0496125_0012190
1244 Ga0496125_0012633
1245 Ga0496125_0037939
1246 Ga0496125_0039882
1247 Ga0496125_0133162
1248 Ga0501034_0209785
1249 Ga0501046_0046217
1250 Ga0501047_0208380
1251 Ga0501048_0068176
1252 Ga0501069_0102787
1253 Ga0501072_0046328
1254 Ga0501249_002771
1255 Ga0501257_050029
1256 Ga0501225_0026111
1257 Ga0501080_0358444
1258 Ga0501081_0091872
1259 Ga0501262_000249
1260 Ga0501035_0051331
1261 nmdc:mga03683_2050_c1
1262 nmdc:mga03683_39668_c2
1263 nmdc:mga03683_47448_c1
1264 nmdc:mga03683_51802_c1
1265 nmdc:mga03n38_160566_c1
1266 nmdc:mga00v17_36402_c1
1267 nmdc:mga0yw44_24689_c1
1268 nmdc:mga0k408_14139_c1
1269 nmdc:mga0k408_14754_c1
1270 nmdc:mga0k408_194963_c1
1271 nmdc:mga0k408_197313_c1
1272 nmdc:mga0k408_34900_c1
1273 nmdc:mga0k408_40749_c1
1274 nmdc:mga0k408_56778_c1
1275 nmdc:mga0k408_5749_c1
1276 nmdc:mga0k408_9371_c1
1277 nmdc:mga06z11_253318_c1
1278 nmdc:mga06z11_320472_c1
1279 nmdc:mga06z11_33598_c1
1280 nmdc:mga04h51_2488_c1
1281 nmdc:mga07m45_14730_c1
1282 nmdc:mga07m45_1917_c1
1283 nmdc:mga07m45_46008_c1
1284 nmdc:mga07m45_75177_c1
1285 nmdc:mga0qj67_82537_c1
1286 nmdc:mga0n895_58_c1
1287 nmdc:mga0n895_619_c1
1288 nmdc:mga0rr50_12556_c1
1289 nmdc:mga0rr50_3841_c1
1290 nmdc:mga08x19_727_c1
1291 nmdc:mga0a205_173783_c1
1292 nmdc:mga0a205_4300_c1
1293 nmdc:mga0sz30_37496_c1
1294 nmdc:mga0sz30_9757_c1
1295 Ga0500610_0000495
1296 Ga0500610_0005628
1297 Ga0500643_002223
1298 Ga0500644_0056391
1299 Ga0500647_0088775
1300 Ga0500583_0105989
1301 Ga0500651_0000353
1302 Ga0500651_0012001
1303 Ga0500566_0053538
1304 Ga0500650_0000718
1305 Ga0500650_0031206
1306 Ga0500562_003594
1307 Ga0500571_000114
1308 Ga0500593_002014
1309 Ga0500593_003386
1310 Ga0500594_0020643
1311 Ga0500618_001358
1312 Ga0500623_035386
1313 Ga0500642_0001092
1314 Ga0500652_000099
1315 Ga0500655_001134
1316 Ga0500655_012038
1317 Ga0500559_0065092
1318 Ga0500568_0008532
1319 Ga0500568_0021455
1320 Ga0500574_018941
1321 Ga0500616_0009122
1322 Ga0500622_0000097
1323 Ga0500627_0000364
1324 Ga0500634_0034126
1325 Ga0500625_048548
1326 Ga0500645_000274
1327 Ga0500645_001839
1328 Ga0501084_0020258
1329 Ga0500661_002343
1330 Ga0590071_000677
1331 2644294982
1332 2511245562
1333 2513227396
1334 2548498315
1335 2548501295
1336 2587727937
1337 2587733756
1338 2599624499
1339 2599672639
1340 2599683639
1341 2599694248
1342 2643867582
1343 2643990502
1344 2644062927
1345 2644070610
1346 2644159451
1347 2644248993
1348 2644328068
1349 2644340150
1350 2644398623
1351 2644468576
1352 2644648849
1353 2644649161
1354 2722884597
1355 2738720199
1356 2738881741
1357 2739243748
1358 2739250885
1359 2739279398
1360 2816472587
1361 2819595912
1362 2831266938
1363 2838056997
1364 2839143197
1365 2842678809
1366 2842720273
1367 2842735539
1368 2842751368
1369 2881102349
1370 2885192840
1371 2885199007
1372 2885212730
1373 2894026654
1374 2899925260
1375 2904454574
1376 2904460983
1377 2904548365
1378 2919465861
1379 2919688522
1380 2919704792
1381 2928038617
1382 2928045778
1383 2928053395
1384 2928067000
1385 2928071101
1386 2928084958
1387 2928116220
1388 2929163758
1389 2929526866
1390 2932423624
1391 2945912418
1392 2945948332
1393 2945977027
1394 2945985264
1395 2974322737
1396 2990713096

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

52

306

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7944 2 263
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7753 2 263
4u99-assembly2.cif.gz_B crystal structure of an h-nox protein from s. oneidensis in the fe(ii) ligation state, q154a/q155a/k156a mutant 0.6131 95 142
7d3e-assembly1.cif.gz_B cryo-em structure of human duox1-duoxa1 in low-calcium state 0.5272 176 261
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.3857 109 260
ID Description Score Start End Superfamily
af_Q7K1I4_1_105_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6599 187 259 1.20.120.350
af_Q8L7H8_5_108_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5661 178 260 1.10.10.1740
af_Q8LD38_5_108_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5637 178 260 1.10.10.1740
af_O01578_26_133_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5467 187 260 1.10.10.1740
af_A0A1D6PYC9_52_155_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4462 21 145 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A519M239-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9746 123 268 GO:0005886
GO:0008961
GO:0042158
AF-A0A655YEH0-F1-model_v4 Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) 0.9711 112 260 GO:0005886
GO:0008961
GO:0042158
AF-A0A1E7YRZ7-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.969 119 260 GO:0005886
GO:0008961
GO:0042158
AF-A0A6N9SNN2-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9678 143 260 GO:0005886
GO:0008961
GO:0042158
AF-A0A348ZWD3-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.961 128 254 GO:0005886
GO:0008961
GO:0042158

Map