F475995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 383 | 1396 | 272 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221652|2644294982 |
| Length | 318 |
| Sequence | FLRNVAYSSSGSPWRGCGRPVVLPGAGDPACGVIASAGTIPATMLTYPHIDPVALQIGPLAVHWYGLTYLAAFGLFMLLGIRRLRHPPFASITGPGAWTRKDVEDILFLGVAGVVIGGRLGYCLFYKPGYYLSHPLEIFAVWQGGMAFHGGLLGVVVSMLWFAHSRQRPWLQVADFVAPCVPTGLAAGRVGNFINGELWGRFASPDLPWGMVFAHSGSMQPRHPSQVYQFLMEGLLLFILLWLYARKERRPGQVAAAFLFGYGVFRFIAEYFREPDAFLGILSLGMSMGQWLCVPMIVGGAAMWLWAQRQPVGALVSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 159 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 160 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 195 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 196 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 202 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 205 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 206 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 207 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 208 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 209 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 210 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 211 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 212 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 213 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 214 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 215 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 272 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 284 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 292 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 293 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 295 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 296 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 297 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 299 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 303 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 308 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 313 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 315 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 319 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 321 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 322 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 323 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 324 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 325 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 326 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 327 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 328 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 329 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 330 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 331 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 332 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 333 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 334 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 335 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 336 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 337 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 338 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 339 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 340 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 341 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 342 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 343 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 344 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 345 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 346 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 347 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 348 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 349 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 350 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 351 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 352 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 353 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 354 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 355 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 356 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 357 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 358 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 359 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 360 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 361 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 362 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 363 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 364 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 365 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 366 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 367 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 368 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 369 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 370 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 371 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 372 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 373 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 374 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 375 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 376 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 377 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 378 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 379 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 380 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 381 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 382 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 383 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.26 |
| Metatranscriptomes | 0.29 |
| Isolates | 9.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 38.25 |
| Nodule | 1.29 |
| Rhizoplane | 2.44 |
| Rhizosphere | 45.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011138 | 3300001979 | Bacteria | 3433 |
| 2 | JGI24740J21852_10013604 | 3300001979 | Bacteria | 3028 |
| 3 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 4 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 5 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 6 | JGI25152J39213_1003097 | 3300002773 | Bacteria | 5816 |
| 7 | JGI25152J39213_1006587 | 3300002773 | Bacteria | 3127 |
| 8 | JGI25150J39212_1002336 | 3300002774 | Bacteria | 4768 |
| 9 | JGI25150J39212_1011673 | 3300002774 | Bacteria | 1582 |
| 10 | JGI25159J45721_1001031 | 3300002987 | Bacteria | 11936 |
| 11 | JGI25159J45721_1001487 | 3300002987 | Bacteria | 9633 |
| 12 | JGI25159J45721_1008017 | 3300002987 | Bacteria | 2951 |
| 13 | JGI25159J45721_1012808 | 3300002987 | Bacteria | 1976 |
| 14 | JGI25151J46595_10000849 | 3300003187 | Bacteria | 24354 |
| 15 | JGI25151J46595_10005377 | 3300003187 | Bacteria | 6619 |
| 16 | JGI25151J46595_10005605 | 3300003187 | Bacteria | 6460 |
| 17 | JGI25151J46595_10006891 | 3300003187 | Bacteria | 5641 |
| 18 | JGI25151J46595_10009023 | 3300003187 | Bacteria | 4753 |
| 19 | JGI25151J46595_10011921 | 3300003187 | Bacteria | 3973 |
| 20 | JGI25153J46596_10006648 | 3300003215 | Bacteria | 5816 |
| 21 | JGI25160J50197_1000301 | 3300003354 | Bacteria | 34898 |
| 22 | JGI25160J50197_1015284 | 3300003354 | Bacteria | 2527 |
| 23 | JGI25161J50226_1000043 | 3300003374 | Bacteria | 120741 |
| 24 | JGI25161J50226_1002461 | 3300003374 | Bacteria | 4733 |
| 25 | Ga0006562J51391_1151955 | 3300003578 | Bacteria | 2740 |
| 26 | Ga0006562J51391_1151956 | 3300003578 | Bacteria | 2560 |
| 27 | Ga0055535_1000263 | 3300003761 | Bacteria | 55363 |
| 28 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 29 | Ga0055526_1000766 | 3300003771 | Bacteria | 23992 |
| 30 | Ga0055526_1005571 | 3300003771 | Bacteria | 7186 |
| 31 | Ga0055526_1009308 | 3300003771 | Bacteria | 4753 |
| 32 | Ga0055526_1009358 | 3300003771 | Bacteria | 4727 |
| 33 | Ga0055537_1000124 | 3300003773 | Bacteria | 58656 |
| 34 | Ga0055537_1000365 | 3300003773 | Bacteria | 30792 |
| 35 | Ga0055537_1000479 | 3300003773 | Bacteria | 25018 |
| 36 | Ga0055537_1003569 | 3300003773 | Bacteria | 4753 |
| 37 | Ga0055524_1000130 | 3300003775 | Bacteria | 88754 |
| 38 | Ga0055524_1000167 | 3300003775 | Bacteria | 75234 |
| 39 | Ga0055524_1007210 | 3300003775 | Bacteria | 4753 |
| 40 | Ga0055524_1013103 | 3300003775 | Bacteria | 3146 |
| 41 | Ga0055536_1000896 | 3300003781 | Bacteria | 19290 |
| 42 | Ga0055536_1001627 | 3300003781 | Bacteria | 13360 |
| 43 | Ga0055536_1002373 | 3300003781 | Bacteria | 10626 |
| 44 | Ga0055536_1013807 | 3300003781 | Bacteria | 2882 |
| 45 | Ga0055536_1016391 | 3300003781 | Bacteria | 2481 |
| 46 | Ga0055536_1019956 | 3300003781 | Bacteria | 2088 |
| 47 | Ga0055534_1000117 | 3300003784 | Bacteria | 58656 |
| 48 | Ga0055534_1003009 | 3300003784 | Bacteria | 5541 |
| 49 | Ga0055534_1004914 | 3300003784 | Bacteria | 3735 |
| 50 | Ga0055534_1005542 | 3300003784 | Bacteria | 3353 |
| 51 | Ga0055534_1006602 | 3300003784 | Bacteria | 2896 |
| 52 | Ga0055528_1000145 | 3300003790 | Bacteria | 58081 |
| 53 | Ga0055528_1001213 | 3300003790 | Bacteria | 16517 |
| 54 | Ga0055528_1007631 | 3300003790 | Bacteria | 4753 |
| 55 | Ga0055528_1022869 | 3300003790 | Bacteria | 1929 |
| 56 | Ga0055530_10000265 | 3300003791 | Bacteria | 47389 |
| 57 | Ga0055530_10005615 | 3300003791 | Bacteria | 5886 |
| 58 | Ga0055530_10006721 | 3300003791 | Bacteria | 5039 |
| 59 | Ga0055530_10013110 | 3300003791 | Bacteria | 2846 |
| 60 | Ga0055530_10018585 | 3300003791 | Bacteria | 2137 |
| 61 | Ga0055540_1000079 | 3300003792 | Bacteria | 112817 |
| 62 | Ga0055540_1000086 | 3300003792 | Bacteria | 102576 |
| 63 | Ga0055540_1000578 | 3300003792 | Bacteria | 26846 |
| 64 | Ga0055540_1001104 | 3300003792 | Bacteria | 17014 |
| 65 | Ga0055540_1004004 | 3300003792 | Bacteria | 6860 |
| 66 | Ga0055540_1014383 | 3300003792 | Bacteria | 2358 |
| 67 | Ga0055540_1017767 | 3300003792 | Bacteria | 1973 |
| 68 | Ga0055531_10000536 | 3300003794 | Bacteria | 33683 |
| 69 | Ga0055531_10001363 | 3300003794 | Bacteria | 18136 |
| 70 | Ga0055531_10010642 | 3300003794 | Bacteria | 4545 |
| 71 | Ga0055531_10013529 | 3300003794 | Bacteria | 3753 |
| 72 | Ga0055531_10020052 | 3300003794 | Bacteria | 2666 |
| 73 | Ga0055531_10022816 | 3300003794 | Bacteria | 2370 |
| 74 | Ga0055531_10022924 | 3300003794 | Bacteria | 2361 |
| 75 | Ga0055543_1000805 | 3300004625 | Bacteria | 15454 |
| 76 | Ga0055543_1001896 | 3300004625 | Bacteria | 7566 |
| 77 | Ga0055543_1002001 | 3300004625 | Bacteria | 7242 |
| 78 | Ga0065165_1005107 | 3300005262 | Bacteria | 7618 |
| 79 | Ga0065165_1008339 | 3300005262 | Bacteria | 4870 |
| 80 | Ga0065165_1008653 | 3300005262 | Bacteria | 4715 |
| 81 | Ga0065165_1012867 | 3300005262 | Bacteria | 3373 |
| 82 | Ga0065714_10124086 | 3300005288 | Bacteria | 1315 |
| 83 | Ga0065704_10081381 | 3300005289 | Bacteria | 3769 |
| 84 | Ga0070676_10081865 | 3300005328 | Bacteria | 1960 |
| 85 | Ga0070683_100096688 | 3300005329 | Bacteria | 2778 |
| 86 | Ga0070690_100046592 | 3300005330 | Bacteria | 2756 |
| 87 | Ga0070680_100098501 | 3300005336 | Bacteria | 2425 |
| 88 | Ga0068868_100439366 | 3300005338 | Bacteria | 1133 |
| 89 | Ga0070689_100167342 | 3300005340 | Bacteria | 1780 |
| 90 | Ga0070687_100028560 | 3300005343 | Bacteria | 2707 |
| 91 | Ga0070661_100002671 | 3300005344 | Bacteria | 12213 |
| 92 | Ga0070669_100198122 | 3300005353 | Bacteria | 1579 |
| 93 | Ga0070659_100133938 | 3300005366 | Bacteria | 2014 |
| 94 | Ga0070667_100162647 | 3300005367 | Bacteria | 1967 |
| 95 | Ga0070710_10028644 | 3300005437 | Bacteria | 2981 |
| 96 | Ga0070662_100009317 | 3300005457 | Bacteria | 6416 |
| 97 | Ga0068867_100160666 | 3300005459 | Bacteria | 1772 |
| 98 | Ga0070679_100187766 | 3300005530 | Bacteria | 2036 |
| 99 | Ga0070679_100614913 | 3300005530 | Bacteria | 1030 |
| 100 | Ga0070686_100013770 | 3300005544 | Bacteria | 4639 |
| 101 | Ga0070665_100279277 | 3300005548 | Bacteria | 1672 |
| 102 | Ga0070665_100334758 | 3300005548 | Bacteria | 1518 |
| 103 | Ga0068855_100096209 | 3300005563 | Bacteria | 3412 |
| 104 | Ga0070664_100027002 | 3300005564 | Bacteria | 4768 |
| 105 | Ga0070664_100259811 | 3300005564 | Bacteria | 1562 |
| 106 | Ga0070664_100298088 | 3300005564 | Bacteria | 1456 |
| 107 | Ga0070664_100599947 | 3300005564 | Bacteria | 1021 |
| 108 | Ga0068857_100030969 | 3300005577 | Bacteria | 4727 |
| 109 | Ga0068854_100221493 | 3300005578 | Bacteria | 1497 |
| 110 | Ga0070702_100354814 | 3300005615 | Bacteria | 1034 |
| 111 | Ga0068852_100007651 | 3300005616 | Bacteria | 7899 |
| 112 | Ga0068852_100030084 | 3300005616 | Bacteria | 4466 |
| 113 | Ga0068859_100101309 | 3300005617 | Bacteria | 2937 |
| 114 | Ga0068858_100088828 | 3300005842 | Bacteria | 2876 |
| 115 | Ga0081539_10001356 | 3300005985 | Bacteria | 42605 |
| 116 | Ga0075365_10021178 | 3300006038 | Bacteria | 4051 |
| 117 | Ga0075365_10027325 | 3300006038 | Bacteria | 3630 |
| 118 | Ga0075365_10051968 | 3300006038 | Bacteria | 2709 |
| 119 | Ga0075365_10059315 | 3300006038 | Bacteria | 2550 |
| 120 | Ga0075368_10002580 | 3300006042 | Bacteria | 5940 |
| 121 | Ga0075363_100009495 | 3300006048 | Bacteria | 4574 |
| 122 | Ga0075363_100011657 | 3300006048 | Bacteria | 4217 |
| 123 | Ga0075363_100118134 | 3300006048 | Bacteria | 1479 |
| 124 | Ga0075364_10006781 | 3300006051 | Bacteria | 6754 |
| 125 | Ga0075364_10096910 | 3300006051 | Bacteria | 1962 |
| 126 | Ga0075362_10004271 | 3300006177 | Bacteria | 5107 |
| 127 | Ga0075362_10008739 | 3300006177 | Bacteria | 3891 |
| 128 | Ga0075362_10010016 | 3300006177 | Bacteria | 3685 |
| 129 | Ga0075362_10017847 | 3300006177 | Bacteria | 2928 |
| 130 | Ga0075362_10020067 | 3300006177 | Bacteria | 2789 |
| 131 | Ga0075362_10072510 | 3300006177 | Bacteria | 1575 |
| 132 | Ga0075362_10138525 | 3300006177 | Bacteria | 1162 |
| 133 | Ga0075367_10003242 | 3300006178 | Bacteria | 7698 |
| 134 | Ga0075367_10160279 | 3300006178 | Bacteria | 1399 |
| 135 | Ga0075369_10047418 | 3300006186 | Bacteria | 1852 |
| 136 | Ga0075366_10001774 | 3300006195 | Bacteria | 10888 |
| 137 | Ga0075366_10007976 | 3300006195 | Bacteria | 5863 |
| 138 | Ga0075366_10013528 | 3300006195 | Bacteria | 4650 |
| 139 | Ga0075366_10027503 | 3300006195 | Bacteria | 3337 |
| 140 | Ga0075366_10067359 | 3300006195 | Bacteria | 2130 |
| 141 | Ga0075366_10078028 | 3300006195 | Bacteria | 1976 |
| 142 | Ga0097621_100001352 | 3300006237 | Bacteria | 16880 |
| 143 | Ga0075370_10000855 | 3300006353 | Bacteria | 12358 |
| 144 | Ga0075370_10000948 | 3300006353 | Bacteria | 11930 |
| 145 | Ga0075370_10003921 | 3300006353 | Bacteria | 7143 |
| 146 | Ga0075370_10016758 | 3300006353 | Bacteria | 3947 |
| 147 | Ga0075370_10019514 | 3300006353 | Bacteria | 3694 |
| 148 | Ga0075370_10027582 | 3300006353 | Bacteria | 3152 |
| 149 | Ga0075370_10031657 | 3300006353 | Bacteria | 2953 |
| 150 | Ga0075370_10034068 | 3300006353 | Bacteria | 2854 |
| 151 | Ga0075370_10159443 | 3300006353 | Bacteria | 1324 |
| 152 | Ga0075370_10192607 | 3300006353 | Bacteria | 1202 |
| 153 | Ga0068871_100072909 | 3300006358 | Bacteria | 2829 |
| 154 | Ga0068871_100293739 | 3300006358 | Bacteria | 1425 |
| 155 | Ga0075433_10000369 | 3300006852 | Bacteria | 28286 |
| 156 | Ga0075434_100000187 | 3300006871 | Bacteria | 40764 |
| 157 | Ga0075434_100001022 | 3300006871 | Bacteria | 22777 |
| 158 | Ga0075429_100090684 | 3300006880 | Bacteria | 2666 |
| 159 | Ga0075436_100016561 | 3300006914 | Bacteria | 5046 |
| 160 | Ga0075436_100039260 | 3300006914 | Bacteria | 3268 |
| 161 | Ga0097620_100101314 | 3300006931 | Bacteria | 2937 |
| 162 | Ga0079104_1000034 | 3300006946 | Bacteria | 199368 |
| 163 | Ga0079104_1000100 | 3300006946 | Bacteria | 126924 |
| 164 | Ga0079104_1011656 | 3300006946 | Bacteria | 2812 |
| 165 | Ga0099826_10000831 | 3300006948 | Bacteria | 16641 |
| 166 | Ga0075435_100000126 | 3300007076 | Bacteria | 43549 |
| 167 | Ga0075435_100013976 | 3300007076 | Bacteria | 5987 |
| 168 | Ga0099794_10001777 | 3300007265 | Bacteria | 7682 |
| 169 | Ga0105244_10000699 | 3300009036 | Bacteria | 29093 |
| 170 | Ga0105250_10028913 | 3300009092 | Bacteria | 2230 |
| 171 | Ga0105240_10085376 | 3300009093 | Bacteria | 3867 |
| 172 | Ga0105240_10088473 | 3300009093 | Bacteria | 3789 |
| 173 | Ga0111539_10055258 | 3300009094 | Bacteria | 4720 |
| 174 | Ga0105243_10003962 | 3300009148 | Bacteria | 11811 |
| 175 | Ga0105243_10007155 | 3300009148 | Bacteria | 8578 |
| 176 | Ga0105243_10009092 | 3300009148 | Bacteria | 7591 |
| 177 | Ga0105243_10034358 | 3300009148 | Bacteria | 3925 |
| 178 | Ga0105243_10042495 | 3300009148 | Bacteria | 3558 |
| 179 | Ga0105241_10055398 | 3300009174 | Bacteria | 3038 |
| 180 | Ga0105241_10312537 | 3300009174 | Bacteria | 1352 |
| 181 | Ga0105242_10006957 | 3300009176 | Bacteria | 8729 |
| 182 | Ga0105242_10350059 | 3300009176 | Bacteria | 1364 |
| 183 | Ga0105242_10410953 | 3300009176 | Bacteria | 1266 |
| 184 | Ga0105237_10011096 | 3300009545 | Bacteria | 9549 |
| 185 | Ga0105238_10197750 | 3300009551 | Bacteria | 1986 |
| 186 | Ga0105238_10289003 | 3300009551 | Bacteria | 1621 |
| 187 | Ga0105239_10594363 | 3300010375 | Bacteria | 1262 |
| 188 | Ga0105246_10071480 | 3300011119 | Bacteria | 2443 |
| 189 | Ga0105246_10291497 | 3300011119 | Bacteria | 1313 |
| 190 | Ga0105246_10309044 | 3300011119 | Bacteria | 1280 |
| 191 | Ga0157373_10075329 | 3300013100 | Bacteria | 2381 |
| 192 | Ga0157373_10132358 | 3300013100 | Bacteria | 1754 |
| 193 | Ga0157373_10158989 | 3300013100 | Bacteria | 1590 |
| 194 | Ga0157370_10022578 | 3300013104 | Bacteria | 6262 |
| 195 | Ga0157370_10730574 | 3300013104 | Bacteria | 903 |
| 196 | Ga0157369_10044036 | 3300013105 | Bacteria | 4861 |
| 197 | Ga0157378_10069662 | 3300013297 | Bacteria | 3156 |
| 198 | Ga0163163_10652925 | 3300014325 | Bacteria | 1115 |
| 199 | Ga0182008_10000418 | 3300014497 | Bacteria | 32935 |
| 200 | Ga0182008_10008154 | 3300014497 | Bacteria | 5734 |
| 201 | Ga0182008_10032416 | 3300014497 | Bacteria | 2626 |
| 202 | Ga0182008_10096862 | 3300014497 | Bacteria | 1456 |
| 203 | Ga0157376_10021945 | 3300014969 | Bacteria | 4967 |
| 204 | Ga0157376_10932236 | 3300014969 | Bacteria | 888 |
| 205 | Ga0182006_1000867 | 3300015261 | Bacteria | 20300 |
| 206 | Ga0182006_1055366 | 3300015261 | Bacteria | 1514 |
| 207 | Ga0182007_10000627 | 3300015262 | Bacteria | 20547 |
| 208 | Ga0182007_10002274 | 3300015262 | Bacteria | 9676 |
| 209 | Ga0182005_1048620 | 3300015265 | Bacteria | 1152 |
| 210 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 211 | Ga0163161_10031156 | 3300017792 | Bacteria | 3798 |
| 212 | Ga0163161_10037236 | 3300017792 | Bacteria | 3487 |
| 213 | Ga0213872_10000074 | 3300021361 | Bacteria | 90986 |
| 214 | Ga0213872_10012229 | 3300021361 | Bacteria | 4044 |
| 215 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 216 | Ga0209436_105671 | 3300025208 | Bacteria | 2831 |
| 217 | Ga0209672_100775 | 3300025228 | Bacteria | 15309 |
| 218 | Ga0209147_100541 | 3300025229 | Bacteria | 21608 |
| 219 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 220 | Ga0207425_1000154 | 3300025245 | Bacteria | 58601 |
| 221 | Ga0207425_1000959 | 3300025245 | Bacteria | 13578 |
| 222 | Ga0207425_1002619 | 3300025245 | Bacteria | 6220 |
| 223 | Ga0207425_1005184 | 3300025245 | Bacteria | 3753 |
| 224 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 225 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 226 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 227 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 228 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 229 | Ga0209129_1001811 | 3300025258 | Bacteria | 11351 |
| 230 | Ga0209129_1003387 | 3300025258 | Bacteria | 6997 |
| 231 | Ga0209129_1026680 | 3300025258 | Bacteria | 995 |
| 232 | Ga0209565_1000096 | 3300025263 | Bacteria | 134434 |
| 233 | Ga0209565_1000114 | 3300025263 | Bacteria | 116078 |
| 234 | Ga0209565_1000125 | 3300025263 | Bacteria | 110485 |
| 235 | Ga0209565_1001491 | 3300025263 | Bacteria | 10225 |
| 236 | Ga0209565_1004038 | 3300025263 | Bacteria | 4573 |
| 237 | Ga0209565_1019267 | 3300025263 | Bacteria | 1460 |
| 238 | Ga0209673_1000192 | 3300025273 | Bacteria | 123155 |
| 239 | Ga0209673_1000232 | 3300025273 | Bacteria | 108581 |
| 240 | Ga0209673_1000572 | 3300025273 | Bacteria | 58687 |
| 241 | Ga0209673_1000583 | 3300025273 | Bacteria | 57643 |
| 242 | Ga0209673_1002127 | 3300025273 | Bacteria | 14789 |
| 243 | Ga0209130_1000041 | 3300025284 | Bacteria | 261078 |
| 244 | Ga0209130_1000113 | 3300025284 | Bacteria | 130804 |
| 245 | Ga0209130_1000508 | 3300025284 | Bacteria | 39372 |
| 246 | Ga0209130_1000752 | 3300025284 | Bacteria | 28075 |
| 247 | Ga0209130_1001465 | 3300025284 | Bacteria | 15515 |
| 248 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 249 | Ga0209675_1000705 | 3300025291 | Bacteria | 22965 |
| 250 | Ga0209675_1001714 | 3300025291 | Bacteria | 12082 |
| 251 | Ga0209675_1001840 | 3300025291 | Bacteria | 11522 |
| 252 | Ga0209675_1003283 | 3300025291 | Bacteria | 7775 |
| 253 | Ga0209675_1019065 | 3300025291 | Bacteria | 1900 |
| 254 | Ga0209675_1025320 | 3300025291 | Bacteria | 1499 |
| 255 | Ga0209675_1034908 | 3300025291 | Bacteria | 1152 |
| 256 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 257 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 258 | Ga0209676_1000285 | 3300025292 | Bacteria | 104459 |
| 259 | Ga0209676_1000418 | 3300025292 | Bacteria | 75214 |
| 260 | Ga0209676_1000705 | 3300025292 | Bacteria | 46561 |
| 261 | Ga0209676_1002444 | 3300025292 | Bacteria | 13185 |
| 262 | Ga0209676_1003024 | 3300025292 | Bacteria | 10913 |
| 263 | Ga0209676_1004565 | 3300025292 | Bacteria | 7663 |
| 264 | Ga0209676_1024486 | 3300025292 | Bacteria | 1954 |
| 265 | Ga0209025_1000531 | 3300025294 | Bacteria | 72578 |
| 266 | Ga0209025_1000745 | 3300025294 | Bacteria | 54850 |
| 267 | Ga0209025_1001493 | 3300025294 | Bacteria | 30271 |
| 268 | Ga0209025_1003514 | 3300025294 | Bacteria | 14717 |
| 269 | Ga0209025_1003579 | 3300025294 | Bacteria | 14523 |
| 270 | Ga0209025_1006274 | 3300025294 | Bacteria | 9300 |
| 271 | Ga0209025_1008516 | 3300025294 | Bacteria | 7370 |
| 272 | Ga0209564_1000270 | 3300025295 | Bacteria | 108503 |
| 273 | Ga0209564_1000817 | 3300025295 | Bacteria | 42412 |
| 274 | Ga0209564_1000912 | 3300025295 | Bacteria | 38636 |
| 275 | Ga0209564_1001098 | 3300025295 | Bacteria | 32197 |
| 276 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 277 | Ga0209758_1006195 | 3300025297 | Bacteria | 8737 |
| 278 | Ga0209758_1024025 | 3300025297 | Bacteria | 2731 |
| 279 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 280 | Ga0209050_1000066 | 3300025298 | Bacteria | 305458 |
| 281 | Ga0209050_1000570 | 3300025298 | Bacteria | 59779 |
| 282 | Ga0209050_1000690 | 3300025298 | Bacteria | 50644 |
| 283 | Ga0209050_1002884 | 3300025298 | Bacteria | 13579 |
| 284 | Ga0209050_1003061 | 3300025298 | Bacteria | 12887 |
| 285 | Ga0209050_1006842 | 3300025298 | Bacteria | 6622 |
| 286 | Ga0209050_1006996 | 3300025298 | Bacteria | 6488 |
| 287 | Ga0209050_1008118 | 3300025298 | Bacteria | 5691 |
| 288 | Ga0209050_1019941 | 3300025298 | Bacteria | 2520 |
| 289 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 290 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 291 | Ga0209256_1000356 | 3300025299 | Bacteria | 74710 |
| 292 | Ga0209256_1000577 | 3300025299 | Bacteria | 52302 |
| 293 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 294 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 295 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 296 | Ga0207426_1001299 | 3300025302 | Bacteria | 21465 |
| 297 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 298 | Ga0209051_1000044 | 3300025303 | Bacteria | 305458 |
| 299 | Ga0209051_1000210 | 3300025303 | Bacteria | 102629 |
| 300 | Ga0209051_1000327 | 3300025303 | Bacteria | 71493 |
| 301 | Ga0209051_1000363 | 3300025303 | Bacteria | 66432 |
| 302 | Ga0209051_1000491 | 3300025303 | Bacteria | 51059 |
| 303 | Ga0209051_1000564 | 3300025303 | Bacteria | 45000 |
| 304 | Ga0209051_1018878 | 3300025303 | Bacteria | 3033 |
| 305 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 306 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 307 | Ga0209257_1000082 | 3300025304 | Bacteria | 305458 |
| 308 | Ga0209257_1000314 | 3300025304 | Bacteria | 102629 |
| 309 | Ga0209257_1000502 | 3300025304 | Bacteria | 69204 |
| 310 | Ga0209257_1002902 | 3300025304 | Bacteria | 15869 |
| 311 | Ga0209257_1006390 | 3300025304 | Bacteria | 7621 |
| 312 | Ga0209257_1007389 | 3300025304 | Bacteria | 6645 |
| 313 | Ga0209257_1011545 | 3300025304 | Bacteria | 4235 |
| 314 | Ga0207655_1001588 | 3300025728 | Bacteria | 20387 |
| 315 | Ga0207692_10117664 | 3300025898 | Bacteria | 1483 |
| 316 | Ga0207654_10028668 | 3300025911 | Bacteria | 3037 |
| 317 | Ga0207660_10113961 | 3300025917 | Bacteria | 2039 |
| 318 | Ga0207662_10056620 | 3300025918 | Bacteria | 2342 |
| 319 | Ga0207649_10005908 | 3300025920 | Bacteria | 6634 |
| 320 | Ga0207649_10082370 | 3300025920 | Bacteria | 2086 |
| 321 | Ga0207681_10129901 | 3300025923 | Bacteria | 1861 |
| 322 | Ga0207690_10008693 | 3300025932 | Bacteria | 6025 |
| 323 | Ga0207706_10006639 | 3300025933 | Bacteria | 10703 |
| 324 | Ga0207706_10007228 | 3300025933 | Bacteria | 10267 |
| 325 | Ga0207706_10027392 | 3300025933 | Bacteria | 5095 |
| 326 | Ga0207686_10002673 | 3300025934 | Bacteria | 9679 |
| 327 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 328 | Ga0207709_10001066 | 3300025935 | Bacteria | 20206 |
| 329 | Ga0207709_10002413 | 3300025935 | Bacteria | 11753 |
| 330 | Ga0207709_10015195 | 3300025935 | Bacteria | 4267 |
| 331 | Ga0207670_10483498 | 3300025936 | Bacteria | 1003 |
| 332 | Ga0207669_10037359 | 3300025937 | Bacteria | 2786 |
| 333 | Ga0207691_10293971 | 3300025940 | Bacteria | 1397 |
| 334 | Ga0207689_10325742 | 3300025942 | Bacteria | 1275 |
| 335 | Ga0207661_10108995 | 3300025944 | Bacteria | 2339 |
| 336 | Ga0207679_10001480 | 3300025945 | Bacteria | 14724 |
| 337 | Ga0207679_10003955 | 3300025945 | Bacteria | 9203 |
| 338 | Ga0207667_10664516 | 3300025949 | Bacteria | 1047 |
| 339 | Ga0207651_10162408 | 3300025960 | Bacteria | 1753 |
| 340 | Ga0207640_10117256 | 3300025981 | Bacteria | 1900 |
| 341 | Ga0207677_10015245 | 3300026023 | Bacteria | 4514 |
| 342 | Ga0207677_10397527 | 3300026023 | Bacteria | 1168 |
| 343 | Ga0207703_10014663 | 3300026035 | Bacteria | 6116 |
| 344 | Ga0207639_10025392 | 3300026041 | Bacteria | 4296 |
| 345 | Ga0207639_10355771 | 3300026041 | Bacteria | 1309 |
| 346 | Ga0207678_10117897 | 3300026067 | Bacteria | 2265 |
| 347 | Ga0207648_10459777 | 3300026089 | Bacteria | 1160 |
| 348 | Ga0207676_10119487 | 3300026095 | Bacteria | 2220 |
| 349 | Ga0207674_10531007 | 3300026116 | Bacteria | 1137 |
| 350 | Ga0207683_10287041 | 3300026121 | Bacteria | 1504 |
| 351 | Ga0207698_10034650 | 3300026142 | Bacteria | 3682 |
| 352 | Ga0207698_10507377 | 3300026142 | Bacteria | 1175 |
| 353 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 354 | Ga0209281_1004678 | 3300027111 | Bacteria | 4020 |
| 355 | Ga0209282_1001130 | 3300027666 | Bacteria | 14241 |
| 356 | Ga0209813_10002277 | 3300027866 | Bacteria | 4386 |
| 357 | Ga0209974_10082148 | 3300027876 | Bacteria | 1110 |
| 358 | Ga0209974_10099729 | 3300027876 | Bacteria | 1014 |
| 359 | Ga0207428_10071917 | 3300027907 | Bacteria | 2716 |
| 360 | Ga0268266_10049385 | 3300028379 | Bacteria | 3608 |
| 361 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 362 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 363 | Ga0307515_10000358 | 3300028794 | Bacteria | 112133 |
| 364 | Ga0307515_10000702 | 3300028794 | Bacteria | 77364 |
| 365 | Ga0307515_10290805 | 3300028794 | Bacteria | 1330 |
| 366 | Ga0316177_1015869 | 3300030731 | Bacteria | 1585 |
| 367 | Ga0316176_1179678 | 3300030732 | Bacteria | 1731 |
| 368 | Ga0314311_1173925 | 3300030733 | Bacteria | 2169 |
| 369 | Ga0265330_10024749 | 3300031235 | Bacteria | 2722 |
| 370 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 371 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 372 | Ga0265332_10029887 | 3300031238 | Bacteria | 2380 |
| 373 | Ga0265325_10001303 | 3300031241 | Bacteria | 17663 |
| 374 | Ga0265340_10023487 | 3300031247 | Bacteria | 3144 |
| 375 | Ga0265327_10000293 | 3300031251 | Bacteria | 96862 |
| 376 | Ga0265327_10013279 | 3300031251 | Bacteria | 5481 |
| 377 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 378 | Ga0307513_10000021 | 3300031456 | Bacteria | 228078 |
| 379 | Ga0307513_10177396 | 3300031456 | Bacteria | 1999 |
| 380 | Ga0307408_100001814 | 3300031548 | Bacteria | 15559 |
| 381 | Ga0307408_100021024 | 3300031548 | Bacteria | 4411 |
| 382 | Ga0307408_100111097 | 3300031548 | Bacteria | 2105 |
| 383 | Ga0307408_100126179 | 3300031548 | Bacteria | 1990 |
| 384 | Ga0307408_100487569 | 3300031548 | Bacteria | 1076 |
| 385 | Ga0307408_100523765 | 3300031548 | Bacteria | 1041 |
| 386 | Ga0307514_10011048 | 3300031649 | Bacteria | 7523 |
| 387 | Ga0307514_10064235 | 3300031649 | Bacteria | 2784 |
| 388 | Ga0265314_10000066 | 3300031711 | Bacteria | 156399 |
| 389 | Ga0265314_10013569 | 3300031711 | Bacteria | 6574 |
| 390 | Ga0265342_10053711 | 3300031712 | Bacteria | 2397 |
| 391 | Ga0307516_10019825 | 3300031730 | Bacteria | 6954 |
| 392 | Ga0307516_10281440 | 3300031730 | Bacteria | 1345 |
| 393 | Ga0307405_10038723 | 3300031731 | Bacteria | 2876 |
| 394 | Ga0307405_10111779 | 3300031731 | Bacteria | 1852 |
| 395 | Ga0307405_10253448 | 3300031731 | Bacteria | 1311 |
| 396 | Ga0307405_10371177 | 3300031731 | Bacteria | 1110 |
| 397 | Ga0307406_10001092 | 3300031901 | Bacteria | 15102 |
| 398 | Ga0307406_10004344 | 3300031901 | Bacteria | 7714 |
| 399 | Ga0307407_10031017 | 3300031903 | Bacteria | 2891 |
| 400 | Ga0307412_10007370 | 3300031911 | Bacteria | 6238 |
| 401 | Ga0307412_10085187 | 3300031911 | Bacteria | 2196 |
| 402 | Ga0307412_10091354 | 3300031911 | Bacteria | 2131 |
| 403 | Ga0307412_10276440 | 3300031911 | Bacteria | 1316 |
| 404 | Ga0307412_10362637 | 3300031911 | Bacteria | 1167 |
| 405 | Ga0307416_100008192 | 3300032002 | Bacteria | 6719 |
| 406 | Ga0307416_100917673 | 3300032002 | Bacteria | 976 |
| 407 | Ga0307414_10004678 | 3300032004 | Bacteria | 7462 |
| 408 | Ga0307411_10187615 | 3300032005 | Bacteria | 1575 |
| 409 | Ga0307510_10299490 | 3300033180 | Bacteria | 1071 |
| 410 | Ga0373923_0056557 | 3300035111 | Bacteria | 1657 |
| 411 | Ga0373953_0021435 | 3300035117 | Bacteria | 2425 |
| 412 | Ga0373954_0040264 | 3300035118 | Bacteria | 2177 |
| 413 | Ga0373956_0105734 | 3300035119 | Bacteria | 1308 |
| 414 | Ga0373955_0026390 | 3300035172 | Bacteria | 2992 |
| 415 | Ga0373942_0002461 | 3300035207 | Bacteria | 4490 |
| 416 | Ga0373924_0022331 | 3300035410 | Bacteria | 2474 |
| 417 | Ga0373933_0078880 | 3300035724 | Bacteria | 2015 |
| 418 | Ga0373947_0212293 | 3300035725 | Bacteria | 1270 |
| 419 | Ga0373937_0351316 | 3300036401 | Bacteria | 1396 |
| 420 | Ga0395899_0001484 | 3300037312 | Bacteria | 19967 |
| 421 | Ga0395905_0000763 | 3300037471 | Bacteria | 42401 |
| 422 | Ga0395905_0003434 | 3300037471 | Bacteria | 16949 |
| 423 | Ga0395905_0010399 | 3300037471 | Bacteria | 9059 |
| 424 | Ga0395905_0013696 | 3300037471 | Bacteria | 7766 |
| 425 | Ga0395905_0016368 | 3300037471 | Bacteria | 7045 |
| 426 | Ga0395905_0084023 | 3300037471 | Bacteria | 2982 |
| 427 | Ga0395905_0127497 | 3300037471 | Bacteria | 2393 |
| 428 | Ga0395905_0474924 | 3300037471 | Bacteria | 1149 |
| 429 | Ga0395901_0166457 | 3300038443 | Bacteria | 2314 |
| 430 | Ga0395901_0562302 | 3300038443 | Bacteria | 1155 |
| 431 | Ga0436361_0292057 | 3300039447 | Bacteria | 25019 |
| 432 | Ga0436361_0531535 | 3300039447 | Bacteria | 9893 |
| 433 | Ga0439436_0007968 | 3300041404 | Bacteria | 3254 |
| 434 | Ga0439439_0002537 | 3300041406 | Bacteria | 3897 |
| 435 | Ga0439439_0035232 | 3300041406 | Bacteria | 1285 |
| 436 | Ga0451789_0899535 | 3300041443 | Bacteria | 1097 |
| 437 | Ga0451795_0091317 | 3300041456 | Bacteria | 4362 |
| 438 | Ga0451800_0943611 | 3300041459 | Bacteria | 1169 |
| 439 | Ga0451804_0073610 | 3300041463 | Bacteria | 1388 |
| 440 | Ga0439431_0000588 | 3300041997 | Bacteria | 7704 |
| 441 | Ga0439442_020156 | 3300042002 | Bacteria | 1381 |
| 442 | Ga0439432_015682 | 3300042006 | Bacteria | 2554 |
| 443 | Ga0439449_0000431 | 3300042007 | Bacteria | 15498 |
| 444 | Ga0439449_0000884 | 3300042007 | Bacteria | 11695 |
| 445 | Ga0439449_0001803 | 3300042007 | Bacteria | 8428 |
| 446 | Ga0439449_0014807 | 3300042007 | Bacteria | 2930 |
| 447 | Ga0439449_0020448 | 3300042007 | Bacteria | 2480 |
| 448 | Ga0439449_0077836 | 3300042007 | Bacteria | 1223 |
| 449 | Ga0439452_021393 | 3300042010 | Bacteria | 1686 |
| 450 | Ga0439462_0006427 | 3300042015 | Bacteria | 2921 |
| 451 | Ga0439462_0016415 | 3300042015 | Bacteria | 1912 |
| 452 | Ga0450911_000110 | 3300042115 | Bacteria | 33959 |
| 453 | Ga0450919_007990 | 3300042121 | Bacteria | 1229 |
| 454 | Ga0450894_006311 | 3300042131 | Bacteria | 1530 |
| 455 | Ga0450906_006599 | 3300042145 | Bacteria | 2333 |
| 456 | Ga0450910_014396 | 3300042147 | Bacteria | 1157 |
| 457 | Ga0439446_0021019 | 3300042156 | Bacteria | 1842 |
| 458 | Ga0450908_001993 | 3300042184 | Bacteria | 3997 |
| 459 | Ga0439434_0013581 | 3300042435 | Bacteria | 2419 |
| 460 | Ga0439434_0018542 | 3300042435 | Bacteria | 2084 |
| 461 | Ga0439434_0035255 | 3300042435 | Bacteria | 1529 |
| 462 | Ga0450918_000575 | 3300042531 | Bacteria | 7811 |
| 463 | Ga0450893_0003213 | 3300042532 | Bacteria | 2569 |
| 464 | Ga0451577_0000141 | 3300042876 | Bacteria | 161372 |
| 465 | Ga0451577_0000728 | 3300042876 | Bacteria | 51004 |
| 466 | Ga0451577_0011015 | 3300042876 | Bacteria | 8588 |
| 467 | Ga0451577_0175728 | 3300042876 | Bacteria | 1930 |
| 468 | Ga0451577_0328749 | 3300042876 | Bacteria | 1386 |
| 469 | Ga0466969_0114690 | 3300044656 | Bacteria | 1258 |
| 470 | Ga0466972_0002814 | 3300044658 | Bacteria | 8620 |
| 471 | Ga0453683_0000580 | 3300044673 | Bacteria | 40538 |
| 472 | Ga0453683_0028768 | 3300044673 | Bacteria | 3517 |
| 473 | Ga0466965_0062178 | 3300044683 | Bacteria | 1867 |
| 474 | Ga0466965_0136060 | 3300044683 | Bacteria | 1277 |
| 475 | Ga0466966_0038123 | 3300044684 | Bacteria | 3097 |
| 476 | Ga0466964_0019078 | 3300044706 | Bacteria | 2635 |
| 477 | Ga0453684_0000121 | 3300044712 | Bacteria | 341067 |
| 478 | Ga0453684_0000463 | 3300044712 | Bacteria | 161665 |
| 479 | Ga0453684_0158722 | 3300044712 | Bacteria | 2677 |
| 480 | Ga0466970_0052586 | 3300044765 | Bacteria | 2174 |
| 481 | Ga0466960_0034649 | 3300044901 | Bacteria | 2354 |
| 482 | Ga0451576_0003962 | 3300045051 | Bacteria | 19723 |
| 483 | Ga0451576_0009346 | 3300045051 | Bacteria | 11372 |
| 484 | Ga0451576_0038430 | 3300045051 | Bacteria | 5065 |
| 485 | Ga0466958_0199132 | 3300045836 | Bacteria | 1274 |
| 486 | Ga0466967_0000299 | 3300045976 | Bacteria | 22210 |
| 487 | Ga0495627_030565 | 3300046453 | Bacteria | 1706 |
| 488 | Ga0495627_046255 | 3300046453 | Bacteria | 1323 |
| 489 | Ga0495638_0009953 | 3300046460 | Bacteria | 6629 |
| 490 | Ga0495610_0036121 | 3300046512 | Bacteria | 2528 |
| 491 | Ga0495616_0004462 | 3300046513 | Bacteria | 8811 |
| 492 | Ga0495620_0012665 | 3300046515 | Bacteria | 4343 |
| 493 | Ga0495631_0000492 | 3300046518 | Bacteria | 26294 |
| 494 | Ga0495632_0006419 | 3300046519 | Bacteria | 7564 |
| 495 | Ga0495637_0001313 | 3300046520 | Bacteria | 14926 |
| 496 | Ga0495663_0039039 | 3300046525 | Bacteria | 1437 |
| 497 | Ga0495654_0002302 | 3300046530 | Bacteria | 12352 |
| 498 | Ga0495654_0015854 | 3300046530 | Bacteria | 3995 |
| 499 | Ga0495597_0002478 | 3300046542 | Bacteria | 11652 |
| 500 | Ga0495633_0000652 | 3300046558 | Bacteria | 32073 |
| 501 | Ga0495633_0104937 | 3300046558 | Bacteria | 1311 |
| 502 | Ga0495656_0000110 | 3300046615 | Bacteria | 32732 |
| 503 | Ga0495656_0065897 | 3300046615 | Bacteria | 1594 |
| 504 | Ga0495625_0001291 | 3300046660 | Bacteria | 31462 |
| 505 | Ga0495625_0048664 | 3300046660 | Bacteria | 3051 |
| 506 | Ga0495588_0062888 | 3300046674 | Bacteria | 1924 |
| 507 | Ga0495588_0123934 | 3300046674 | Bacteria | 1362 |
| 508 | Ga0495588_0149065 | 3300046674 | Bacteria | 1236 |
| 509 | Ga0495670_0163620 | 3300046691 | Bacteria | 1170 |
| 510 | Ga0495676_0009977 | 3300047321 | Bacteria | 8629 |
| 511 | Ga0495680_0086867 | 3300047322 | Bacteria | 2353 |
| 512 | Ga0495593_0165794 | 3300047673 | Bacteria | 1114 |
| 513 | Ga0495615_0000968 | 3300048090 | Bacteria | 4080 |
| 514 | Ga0496102_0086239 | 3300048905 | Bacteria | 2899 |
| 515 | Ga0496102_0181582 | 3300048905 | Bacteria | 1983 |
| 516 | Ga0496103_0078808 | 3300048906 | Bacteria | 2069 |
| 517 | Ga0496104_0010890 | 3300048907 | Bacteria | 8135 |
| 518 | Ga0496105_0001768 | 3300048908 | Bacteria | 15456 |
| 519 | Ga0496106_0155367 | 3300048909 | Bacteria | 1806 |
| 520 | Ga0496109_0081034 | 3300048912 | Bacteria | 2991 |
| 521 | Ga0496109_0254069 | 3300048912 | Bacteria | 1655 |
| 522 | Ga0496110_0324266 | 3300048913 | Bacteria | 1403 |
| 523 | Ga0496114_0098290 | 3300048917 | Bacteria | 2495 |
| 524 | Ga0496117_0000166 | 3300048920 | Bacteria | 138665 |
| 525 | Ga0496117_0042827 | 3300048920 | Bacteria | 3300 |
| 526 | Ga0496117_0073959 | 3300048920 | Bacteria | 2271 |
| 527 | Ga0496117_0107684 | 3300048920 | Bacteria | 1745 |
| 528 | Ga0496118_0008215 | 3300048921 | Bacteria | 10841 |
| 529 | Ga0496118_0009204 | 3300048921 | Bacteria | 10031 |
| 530 | Ga0496121_0000187 | 3300048924 | Bacteria | 138361 |
| 531 | Ga0496121_0031937 | 3300048924 | Bacteria | 4799 |
| 532 | Ga0496121_0081487 | 3300048924 | Bacteria | 2561 |
| 533 | Ga0496121_0192386 | 3300048924 | Bacteria | 1461 |
| 534 | Ga0496122_0013572 | 3300048925 | Bacteria | 7957 |
| 535 | Ga0496122_0060650 | 3300048925 | Bacteria | 2784 |
| 536 | Ga0496122_0073012 | 3300048925 | Bacteria | 2436 |
| 537 | Ga0496123_0001126 | 3300048926 | Bacteria | 39890 |
| 538 | Ga0496123_0028778 | 3300048926 | Bacteria | 4107 |
| 539 | Ga0496123_0058815 | 3300048926 | Bacteria | 2490 |
| 540 | Ga0496123_0121532 | 3300048926 | Bacteria | 1468 |
| 541 | Ga0496124_0005536 | 3300048927 | Bacteria | 14150 |
| 542 | Ga0496124_0041510 | 3300048927 | Bacteria | 3969 |
| 543 | Ga0496124_0095827 | 3300048927 | Bacteria | 2411 |
| 544 | Ga0496125_0002287 | 3300048928 | Bacteria | 25337 |
| 545 | Ga0496125_0012190 | 3300048928 | Bacteria | 8554 |
| 546 | Ga0496125_0012633 | 3300048928 | Bacteria | 8360 |
| 547 | Ga0496125_0037939 | 3300048928 | Bacteria | 4181 |
| 548 | Ga0496125_0039882 | 3300048928 | Bacteria | 4036 |
| 549 | Ga0496125_0133162 | 3300048928 | Bacteria | 1745 |
| 550 | Ga0501034_0209785 | 3300049571 | Bacteria | 1903 |
| 551 | Ga0501046_0046217 | 3300049580 | Bacteria | 3457 |
| 552 | Ga0501047_0208380 | 3300049581 | Bacteria | 1814 |
| 553 | Ga0501048_0068176 | 3300049582 | Bacteria | 2514 |
| 554 | Ga0501069_0102787 | 3300049585 | Bacteria | 1623 |
| 555 | Ga0501072_0046328 | 3300049588 | Bacteria | 3422 |
| 556 | Ga0501249_002771 | 3300049679 | Bacteria | 3528 |
| 557 | Ga0501257_050029 | 3300049686 | Bacteria | 1041 |
| 558 | Ga0501225_0026111 | 3300049705 | Bacteria | 1607 |
| 559 | Ga0501080_0358444 | 3300049742 | Bacteria | 1316 |
| 560 | Ga0501081_0091872 | 3300049743 | Bacteria | 2135 |
| 561 | Ga0501262_000249 | 3300049759 | Bacteria | 6596 |
| 562 | Ga0501035_0051331 | 3300049822 | Bacteria | 3693 |
| 563 | nmdc:mga03683_2050_c1 | 3300050489 | Bacteria | 6177 |
| 564 | nmdc:mga03683_39668_c2 | 3300050489 | Bacteria | 873 |
| 565 | nmdc:mga03683_47448_c1 | 3300050489 | Bacteria | 1782 |
| 566 | nmdc:mga03683_51802_c1 | 3300050489 | Bacteria | 1715 |
| 567 | nmdc:mga03n38_160566_c1 | 3300050490 | Bacteria | 1138 |
| 568 | nmdc:mga00v17_36402_c1 | 3300050491 | Bacteria | 2933 |
| 569 | nmdc:mga0yw44_24689_c1 | 3300050492 | Bacteria | 3405 |
| 570 | nmdc:mga0k408_14139_c1 | 3300050493 | Bacteria | 4391 |
| 571 | nmdc:mga0k408_14754_c1 | 3300050493 | Bacteria | 4311 |
| 572 | nmdc:mga0k408_194963_c1 | 3300050493 | Bacteria | 1209 |
| 573 | nmdc:mga0k408_197313_c1 | 3300050493 | Bacteria | 1201 |
| 574 | nmdc:mga0k408_34900_c1 | 3300050493 | Bacteria | 2882 |
| 575 | nmdc:mga0k408_40749_c1 | 3300050493 | Bacteria | 2673 |
| 576 | nmdc:mga0k408_56778_c1 | 3300050493 | Bacteria | 2272 |
| 577 | nmdc:mga0k408_5749_c1 | 3300050493 | Bacteria | 6599 |
| 578 | nmdc:mga0k408_9371_c1 | 3300050493 | Bacteria | 5276 |
| 579 | nmdc:mga06z11_253318_c1 | 3300050494 | Bacteria | 1037 |
| 580 | nmdc:mga06z11_320472_c1 | 3300050494 | Bacteria | 924 |
| 581 | nmdc:mga06z11_33598_c1 | 3300050494 | Bacteria | 2511 |
| 582 | nmdc:mga04h51_2488_c1 | 3300050495 | Bacteria | 4378 |
| 583 | nmdc:mga07m45_14730_c1 | 3300050496 | Bacteria | 4174 |
| 584 | nmdc:mga07m45_1917_c1 | 3300050496 | Bacteria | 9613 |
| 585 | nmdc:mga07m45_46008_c1 | 3300050496 | Bacteria | 2451 |
| 586 | nmdc:mga07m45_75177_c1 | 3300050496 | Bacteria | 1925 |
| 587 | nmdc:mga0qj67_82537_c1 | 3300050509 | Bacteria | 2577 |
| 588 | nmdc:mga0n895_58_c1 | 3300050512 | Bacteria | 65261 |
| 589 | nmdc:mga0n895_619_c1 | 3300050512 | Bacteria | 24714 |
| 590 | nmdc:mga0rr50_12556_c1 | 3300050513 | Bacteria | 5482 |
| 591 | nmdc:mga0rr50_3841_c1 | 3300050513 | Bacteria | 8723 |
| 592 | nmdc:mga08x19_727_c1 | 3300050514 | Bacteria | 21023 |
| 593 | nmdc:mga0a205_173783_c1 | 3300050515 | Bacteria | 2050 |
| 594 | nmdc:mga0a205_4300_c1 | 3300050515 | Bacteria | 12783 |
| 595 | nmdc:mga0sz30_37496_c1 | 3300050516 | Bacteria | 2029 |
| 596 | nmdc:mga0sz30_9757_c1 | 3300050516 | Bacteria | 3660 |
| 597 | Ga0500610_0000495 | 3300053079 | Bacteria | 12122 |
| 598 | Ga0500610_0005628 | 3300053079 | Bacteria | 5162 |
| 599 | Ga0500643_002223 | 3300053087 | Bacteria | 10250 |
| 600 | Ga0500644_0056391 | 3300053088 | Bacteria | 1367 |
| 601 | Ga0500647_0088775 | 3300053091 | Bacteria | 1481 |
| 602 | Ga0500583_0105989 | 3300053092 | Bacteria | 1381 |
| 603 | Ga0500651_0000353 | 3300053093 | Bacteria | 25788 |
| 604 | Ga0500651_0012001 | 3300053093 | Bacteria | 5240 |
| 605 | Ga0500566_0053538 | 3300053094 | Bacteria | 2303 |
| 606 | Ga0500650_0000718 | 3300053098 | Bacteria | 8906 |
| 607 | Ga0500650_0031206 | 3300053098 | Bacteria | 2421 |
| 608 | Ga0500562_003594 | 3300053108 | Bacteria | 3892 |
| 609 | Ga0500571_000114 | 3300053110 | Bacteria | 26125 |
| 610 | Ga0500593_002014 | 3300053117 | Bacteria | 7371 |
| 611 | Ga0500593_003386 | 3300053117 | Bacteria | 6013 |
| 612 | Ga0500594_0020643 | 3300053118 | Bacteria | 1645 |
| 613 | Ga0500618_001358 | 3300053125 | Bacteria | 11139 |
| 614 | Ga0500623_035386 | 3300053127 | Bacteria | 2571 |
| 615 | Ga0500642_0001092 | 3300053130 | Bacteria | 7776 |
| 616 | Ga0500652_000099 | 3300053131 | Bacteria | 34685 |
| 617 | Ga0500655_001134 | 3300053133 | Bacteria | 5067 |
| 618 | Ga0500655_012038 | 3300053133 | Bacteria | 1571 |
| 619 | Ga0500559_0065092 | 3300053136 | Bacteria | 1632 |
| 620 | Ga0500568_0008532 | 3300053139 | Bacteria | 4931 |
| 621 | Ga0500568_0021455 | 3300053139 | Bacteria | 2777 |
| 622 | Ga0500574_018941 | 3300053141 | Bacteria | 1706 |
| 623 | Ga0500616_0009122 | 3300053153 | Bacteria | 6064 |
| 624 | Ga0500622_0000097 | 3300053156 | Bacteria | 89802 |
| 625 | Ga0500627_0000364 | 3300053158 | Bacteria | 12279 |
| 626 | Ga0500634_0034126 | 3300053161 | Bacteria | 2772 |
| 627 | Ga0500625_048548 | 3300053729 | Bacteria | 1970 |
| 628 | Ga0500645_000274 | 3300053730 | Bacteria | 36869 |
| 629 | Ga0500645_001839 | 3300053730 | Bacteria | 10172 |
| 630 | Ga0501084_0020258 | 3300054114 | Bacteria | 5545 |
| 631 | Ga0500661_002343 | 3300055283 | Bacteria | 3573 |
| 632 | Ga0590071_000677 | 3300059421 | Bacteria | 9667 |
| 633 | 2644294982 | 2643221652 | Bacteria | 5140275 |
| 634 | 2511245562 | 2511231002 | Bacteria | 5042903 |
| 635 | 2513227396 | 2513020051 | Bacteria | 6053213 |
| 636 | 2548498315 | 2547132374 | Bacteria | 5530232 |
| 637 | 2548501295 | 2547132374 | Bacteria | 5530232 |
| 638 | 2587727937 | 2585428057 | Bacteria | 6737412 |
| 639 | 2587733756 | 2585428058 | Bacteria | 6853932 |
| 640 | 2599624499 | 2599185214 | Bacteria | 8209958 |
| 641 | 2599672639 | 2599185226 | Bacteria | 8233575 |
| 642 | 2599683639 | 2599185227 | Bacteria | 8246414 |
| 643 | 2599694248 | 2599185229 | Bacteria | 8216126 |
| 644 | 2643867582 | 2643221570 | Bacteria | 5103772 |
| 645 | 2643990502 | 2643221596 | Bacteria | 5006805 |
| 646 | 2644062927 | 2643221609 | Bacteria | 6756331 |
| 647 | 2644070610 | 2643221611 | Bacteria | 6820941 |
| 648 | 2644159451 | 2643221628 | Bacteria | 5745828 |
| 649 | 2644248993 | 2643221644 | Bacteria | 6865017 |
| 650 | 2644328068 | 2643221658 | Bacteria | 6064537 |
| 651 | 2644340150 | 2643221660 | Bacteria | 4208257 |
| 652 | 2644398623 | 2643221672 | Bacteria | 6322190 |
| 653 | 2644468576 | 2643221683 | Bacteria | 5749203 |
| 654 | 2644648849 | 2643221717 | Bacteria | 5676132 |
| 655 | 2644649161 | 2643221717 | Bacteria | 5676132 |
| 656 | 2722884597 | 2721755523 | Bacteria | 6430384 |
| 657 | 2738720199 | 2738541277 | Bacteria | 7458140 |
| 658 | 2738881741 | 2738541307 | Bacteria | 8606193 |
| 659 | 2739243748 | 2738543012 | Bacteria | 7115078 |
| 660 | 2739250885 | 2738543013 | Bacteria | 5618633 |
| 661 | 2739279398 | 2738543019 | Bacteria | 7459457 |
| 662 | 2816472587 | 2816332133 | Bacteria | 7249298 |
| 663 | 2819595912 | 2818991446 | Bacteria | 7757362 |
| 664 | 2831266938 | 2831265667 | Bacteria | 7184833 |
| 665 | 2838056997 | 2838054893 | Bacteria | 7451788 |
| 666 | 2839143197 | 2839138175 | Bacteria | 6549354 |
| 667 | 2842678809 | 2842677519 | Bacteria | 5615038 |
| 668 | 2842720273 | 2842718218 | Bacteria | 4560148 |
| 669 | 2842735539 | 2842733646 | Bacteria | 5716726 |
| 670 | 2842751368 | 2842747753 | Bacteria | 5578255 |
| 671 | 2881102349 | 2881101125 | Bacteria | 4590519 |
| 672 | 2885192840 | 2885192300 | Bacteria | 5882526 |
| 673 | 2885199007 | 2885198086 | Bacteria | 7212419 |
| 674 | 2885212730 | 2885211737 | Bacteria | 7212420 |
| 675 | 2894026654 | 2894023352 | Bacteria | 5167372 |
| 676 | 2899925260 | 2899924645 | Bacteria | 7487985 |
| 677 | 2904454574 | 2904449895 | Bacteria | 6927402 |
| 678 | 2904460983 | 2904456579 | Bacteria | 6819253 |
| 679 | 2904548365 | 2904541872 | Bacteria | 8915136 |
| 680 | 2919465861 | 2919462493 | Bacteria | 5817112 |
| 681 | 2919688522 | 2919688452 | Bacteria | 4595932 |
| 682 | 2919704792 | 2919704043 | Bacteria | 5560311 |
| 683 | 2928038617 | 2928037797 | Bacteria | 7273642 |
| 684 | 2928045778 | 2928044640 | Bacteria | 7271509 |
| 685 | 2928053395 | 2928051484 | Bacteria | 7773759 |
| 686 | 2928067000 | 2928064002 | Bacteria | 7419480 |
| 687 | 2928071101 | 2928070936 | Bacteria | 8062541 |
| 688 | 2928084958 | 2928084124 | Bacteria | 7159212 |
| 689 | 2928116220 | 2928115317 | Bacteria | 6477646 |
| 690 | 2929163758 | 2929160207 | Bacteria | 9075316 |
| 691 | 2929526866 | 2929520902 | Bacteria | 6765052 |
| 692 | 2932423624 | 2932422444 | Bacteria | 4678430 |
| 693 | 2945912418 | 2945909444 | Bacteria | 7065066 |
| 694 | 2945948332 | 2945945610 | Bacteria | 5951079 |
| 695 | 2945977027 | 2945972063 | Bacteria | 6086495 |
| 696 | 2945985264 | 2945984333 | Bacteria | 7358892 |
| 697 | 2974322737 | 2974320154 | Bacteria | 4571377 |
| 698 | 2990713096 | 2990710928 | Bacteria | 5002431 |
| 699 | JGI24740J21852_10011138 | |||
| 700 | JGI24740J21852_10013604 | |||
| 701 | JGI25156J39149_1000002 | |||
| 702 | JGI25154J39366_1000010 | |||
| 703 | JGI25157J39369_1000001 | |||
| 704 | JGI25152J39213_1003097 | |||
| 705 | JGI25152J39213_1006587 | |||
| 706 | JGI25150J39212_1002336 | |||
| 707 | JGI25150J39212_1011673 | |||
| 708 | JGI25159J45721_1001031 | |||
| 709 | JGI25159J45721_1001487 | |||
| 710 | JGI25159J45721_1008017 | |||
| 711 | JGI25159J45721_1012808 | |||
| 712 | JGI25151J46595_10000849 | |||
| 713 | JGI25151J46595_10005377 | |||
| 714 | JGI25151J46595_10005605 | |||
| 715 | JGI25151J46595_10006891 | |||
| 716 | JGI25151J46595_10009023 | |||
| 717 | JGI25151J46595_10011921 | |||
| 718 | JGI25153J46596_10006648 | |||
| 719 | JGI25160J50197_1000301 | |||
| 720 | JGI25160J50197_1015284 | |||
| 721 | JGI25161J50226_1000043 | |||
| 722 | JGI25161J50226_1002461 | |||
| 723 | Ga0006562J51391_1151955 | |||
| 724 | Ga0006562J51391_1151956 | |||
| 725 | Ga0055535_1000263 | |||
| 726 | Ga0055542_1000004 | |||
| 727 | Ga0055526_1000766 | |||
| 728 | Ga0055526_1005571 | |||
| 729 | Ga0055526_1009308 | |||
| 730 | Ga0055526_1009358 | |||
| 731 | Ga0055537_1000124 | |||
| 732 | Ga0055537_1000365 | |||
| 733 | Ga0055537_1000479 | |||
| 734 | Ga0055537_1003569 | |||
| 735 | Ga0055524_1000130 | |||
| 736 | Ga0055524_1000167 | |||
| 737 | Ga0055524_1007210 | |||
| 738 | Ga0055524_1013103 | |||
| 739 | Ga0055536_1000896 | |||
| 740 | Ga0055536_1001627 | |||
| 741 | Ga0055536_1002373 | |||
| 742 | Ga0055536_1013807 | |||
| 743 | Ga0055536_1016391 | |||
| 744 | Ga0055536_1019956 | |||
| 745 | Ga0055534_1000117 | |||
| 746 | Ga0055534_1003009 | |||
| 747 | Ga0055534_1004914 | |||
| 748 | Ga0055534_1005542 | |||
| 749 | Ga0055534_1006602 | |||
| 750 | Ga0055528_1000145 | |||
| 751 | Ga0055528_1001213 | |||
| 752 | Ga0055528_1007631 | |||
| 753 | Ga0055528_1022869 | |||
| 754 | Ga0055530_10000265 | |||
| 755 | Ga0055530_10005615 | |||
| 756 | Ga0055530_10006721 | |||
| 757 | Ga0055530_10013110 | |||
| 758 | Ga0055530_10018585 | |||
| 759 | Ga0055540_1000079 | |||
| 760 | Ga0055540_1000086 | |||
| 761 | Ga0055540_1000578 | |||
| 762 | Ga0055540_1001104 | |||
| 763 | Ga0055540_1004004 | |||
| 764 | Ga0055540_1014383 | |||
| 765 | Ga0055540_1017767 | |||
| 766 | Ga0055531_10000536 | |||
| 767 | Ga0055531_10001363 | |||
| 768 | Ga0055531_10010642 | |||
| 769 | Ga0055531_10013529 | |||
| 770 | Ga0055531_10020052 | |||
| 771 | Ga0055531_10022816 | |||
| 772 | Ga0055531_10022924 | |||
| 773 | Ga0055543_1000805 | |||
| 774 | Ga0055543_1001896 | |||
| 775 | Ga0055543_1002001 | |||
| 776 | Ga0065165_1005107 | |||
| 777 | Ga0065165_1008339 | |||
| 778 | Ga0065165_1008653 | |||
| 779 | Ga0065165_1012867 | |||
| 780 | Ga0065714_10124086 | |||
| 781 | Ga0065704_10081381 | |||
| 782 | Ga0070676_10081865 | |||
| 783 | Ga0070683_100096688 | |||
| 784 | Ga0070690_100046592 | |||
| 785 | Ga0070680_100098501 | |||
| 786 | Ga0068868_100439366 | |||
| 787 | Ga0070689_100167342 | |||
| 788 | Ga0070687_100028560 | |||
| 789 | Ga0070661_100002671 | |||
| 790 | Ga0070669_100198122 | |||
| 791 | Ga0070659_100133938 | |||
| 792 | Ga0070667_100162647 | |||
| 793 | Ga0070710_10028644 | |||
| 794 | Ga0070662_100009317 | |||
| 795 | Ga0068867_100160666 | |||
| 796 | Ga0070679_100187766 | |||
| 797 | Ga0070679_100614913 | |||
| 798 | Ga0070686_100013770 | |||
| 799 | Ga0070665_100279277 | |||
| 800 | Ga0070665_100334758 | |||
| 801 | Ga0068855_100096209 | |||
| 802 | Ga0070664_100027002 | |||
| 803 | Ga0070664_100259811 | |||
| 804 | Ga0070664_100298088 | |||
| 805 | Ga0070664_100599947 | |||
| 806 | Ga0068857_100030969 | |||
| 807 | Ga0068854_100221493 | |||
| 808 | Ga0070702_100354814 | |||
| 809 | Ga0068852_100007651 | |||
| 810 | Ga0068852_100030084 | |||
| 811 | Ga0068859_100101309 | |||
| 812 | Ga0068858_100088828 | |||
| 813 | Ga0081539_10001356 | |||
| 814 | Ga0075365_10021178 | |||
| 815 | Ga0075365_10027325 | |||
| 816 | Ga0075365_10051968 | |||
| 817 | Ga0075365_10059315 | |||
| 818 | Ga0075368_10002580 | |||
| 819 | Ga0075363_100009495 | |||
| 820 | Ga0075363_100011657 | |||
| 821 | Ga0075363_100118134 | |||
| 822 | Ga0075364_10006781 | |||
| 823 | Ga0075364_10096910 | |||
| 824 | Ga0075362_10004271 | |||
| 825 | Ga0075362_10008739 | |||
| 826 | Ga0075362_10010016 | |||
| 827 | Ga0075362_10017847 | |||
| 828 | Ga0075362_10020067 | |||
| 829 | Ga0075362_10072510 | |||
| 830 | Ga0075362_10138525 | |||
| 831 | Ga0075367_10003242 | |||
| 832 | Ga0075367_10160279 | |||
| 833 | Ga0075369_10047418 | |||
| 834 | Ga0075366_10001774 | |||
| 835 | Ga0075366_10007976 | |||
| 836 | Ga0075366_10013528 | |||
| 837 | Ga0075366_10027503 | |||
| 838 | Ga0075366_10067359 | |||
| 839 | Ga0075366_10078028 | |||
| 840 | Ga0097621_100001352 | |||
| 841 | Ga0075370_10000855 | |||
| 842 | Ga0075370_10000948 | |||
| 843 | Ga0075370_10003921 | |||
| 844 | Ga0075370_10016758 | |||
| 845 | Ga0075370_10019514 | |||
| 846 | Ga0075370_10027582 | |||
| 847 | Ga0075370_10031657 | |||
| 848 | Ga0075370_10034068 | |||
| 849 | Ga0075370_10159443 | |||
| 850 | Ga0075370_10192607 | |||
| 851 | Ga0068871_100072909 | |||
| 852 | Ga0068871_100293739 | |||
| 853 | Ga0075433_10000369 | |||
| 854 | Ga0075434_100000187 | |||
| 855 | Ga0075434_100001022 | |||
| 856 | Ga0075429_100090684 | |||
| 857 | Ga0075436_100016561 | |||
| 858 | Ga0075436_100039260 | |||
| 859 | Ga0097620_100101314 | |||
| 860 | Ga0079104_1000034 | |||
| 861 | Ga0079104_1000100 | |||
| 862 | Ga0079104_1011656 | |||
| 863 | Ga0099826_10000831 | |||
| 864 | Ga0075435_100000126 | |||
| 865 | Ga0075435_100013976 | |||
| 866 | Ga0099794_10001777 | |||
| 867 | Ga0105244_10000699 | |||
| 868 | Ga0105250_10028913 | |||
| 869 | Ga0105240_10085376 | |||
| 870 | Ga0105240_10088473 | |||
| 871 | Ga0111539_10055258 | |||
| 872 | Ga0105243_10003962 | |||
| 873 | Ga0105243_10007155 | |||
| 874 | Ga0105243_10009092 | |||
| 875 | Ga0105243_10034358 | |||
| 876 | Ga0105243_10042495 | |||
| 877 | Ga0105241_10055398 | |||
| 878 | Ga0105241_10312537 | |||
| 879 | Ga0105242_10006957 | |||
| 880 | Ga0105242_10350059 | |||
| 881 | Ga0105242_10410953 | |||
| 882 | Ga0105237_10011096 | |||
| 883 | Ga0105238_10197750 | |||
| 884 | Ga0105238_10289003 | |||
| 885 | Ga0105239_10594363 | |||
| 886 | Ga0105246_10071480 | |||
| 887 | Ga0105246_10291497 | |||
| 888 | Ga0105246_10309044 | |||
| 889 | Ga0157373_10075329 | |||
| 890 | Ga0157373_10132358 | |||
| 891 | Ga0157373_10158989 | |||
| 892 | Ga0157370_10022578 | |||
| 893 | Ga0157370_10730574 | |||
| 894 | Ga0157369_10044036 | |||
| 895 | Ga0157378_10069662 | |||
| 896 | Ga0163163_10652925 | |||
| 897 | Ga0182008_10000418 | |||
| 898 | Ga0182008_10008154 | |||
| 899 | Ga0182008_10032416 | |||
| 900 | Ga0182008_10096862 | |||
| 901 | Ga0157376_10021945 | |||
| 902 | Ga0157376_10932236 | |||
| 903 | Ga0182006_1000867 | |||
| 904 | Ga0182006_1055366 | |||
| 905 | Ga0182007_10000627 | |||
| 906 | Ga0182007_10002274 | |||
| 907 | Ga0182005_1048620 | |||
| 908 | Ga0183362_10001 | |||
| 909 | Ga0163161_10031156 | |||
| 910 | Ga0163161_10037236 | |||
| 911 | Ga0213872_10000074 | |||
| 912 | Ga0213872_10012229 | |||
| 913 | Ga0209435_100001 | |||
| 914 | Ga0209436_105671 | |||
| 915 | Ga0209672_100775 | |||
| 916 | Ga0209147_100541 | |||
| 917 | Ga0209258_100022 | |||
| 918 | Ga0207425_1000154 | |||
| 919 | Ga0207425_1000959 | |||
| 920 | Ga0207425_1002619 | |||
| 921 | Ga0207425_1005184 | |||
| 922 | Ga0209646_1000001 | |||
| 923 | Ga0209026_1000001 | |||
| 924 | Ga0209148_1000034 | |||
| 925 | Ga0209759_1000001 | |||
| 926 | Ga0209129_1000023 | |||
| 927 | Ga0209129_1001811 | |||
| 928 | Ga0209129_1003387 | |||
| 929 | Ga0209129_1026680 | |||
| 930 | Ga0209565_1000096 | |||
| 931 | Ga0209565_1000114 | |||
| 932 | Ga0209565_1000125 | |||
| 933 | Ga0209565_1001491 | |||
| 934 | Ga0209565_1004038 | |||
| 935 | Ga0209565_1019267 | |||
| 936 | Ga0209673_1000192 | |||
| 937 | Ga0209673_1000232 | |||
| 938 | Ga0209673_1000572 | |||
| 939 | Ga0209673_1000583 | |||
| 940 | Ga0209673_1002127 | |||
| 941 | Ga0209130_1000041 | |||
| 942 | Ga0209130_1000113 | |||
| 943 | Ga0209130_1000508 | |||
| 944 | Ga0209130_1000752 | |||
| 945 | Ga0209130_1001465 | |||
| 946 | Ga0209675_1000029 | |||
| 947 | Ga0209675_1000705 | |||
| 948 | Ga0209675_1001714 | |||
| 949 | Ga0209675_1001840 | |||
| 950 | Ga0209675_1003283 | |||
| 951 | Ga0209675_1019065 | |||
| 952 | Ga0209675_1025320 | |||
| 953 | Ga0209675_1034908 | |||
| 954 | Ga0209676_1000005 | |||
| 955 | Ga0209676_1000054 | |||
| 956 | Ga0209676_1000285 | |||
| 957 | Ga0209676_1000418 | |||
| 958 | Ga0209676_1000705 | |||
| 959 | Ga0209676_1002444 | |||
| 960 | Ga0209676_1003024 | |||
| 961 | Ga0209676_1004565 | |||
| 962 | Ga0209676_1024486 | |||
| 963 | Ga0209025_1000531 | |||
| 964 | Ga0209025_1000745 | |||
| 965 | Ga0209025_1001493 | |||
| 966 | Ga0209025_1003514 | |||
| 967 | Ga0209025_1003579 | |||
| 968 | Ga0209025_1006274 | |||
| 969 | Ga0209025_1008516 | |||
| 970 | Ga0209564_1000270 | |||
| 971 | Ga0209564_1000817 | |||
| 972 | Ga0209564_1000912 | |||
| 973 | Ga0209564_1001098 | |||
| 974 | Ga0209758_1000064 | |||
| 975 | Ga0209758_1006195 | |||
| 976 | Ga0209758_1024025 | |||
| 977 | Ga0209050_1000007 | |||
| 978 | Ga0209050_1000066 | |||
| 979 | Ga0209050_1000570 | |||
| 980 | Ga0209050_1000690 | |||
| 981 | Ga0209050_1002884 | |||
| 982 | Ga0209050_1003061 | |||
| 983 | Ga0209050_1006842 | |||
| 984 | Ga0209050_1006996 | |||
| 985 | Ga0209050_1008118 | |||
| 986 | Ga0209050_1019941 | |||
| 987 | Ga0209256_1000003 | |||
| 988 | Ga0209256_1000020 | |||
| 989 | Ga0209256_1000356 | |||
| 990 | Ga0209256_1000577 | |||
| 991 | Ga0207426_1000001 | |||
| 992 | Ga0207426_1000031 | |||
| 993 | Ga0207426_1000061 | |||
| 994 | Ga0207426_1001299 | |||
| 995 | Ga0209051_1000009 | |||
| 996 | Ga0209051_1000044 | |||
| 997 | Ga0209051_1000210 | |||
| 998 | Ga0209051_1000327 | |||
| 999 | Ga0209051_1000363 | |||
| 1000 | Ga0209051_1000491 | |||
| 1001 | Ga0209051_1000564 | |||
| 1002 | Ga0209051_1018878 | |||
| 1003 | Ga0209257_1000011 | |||
| 1004 | Ga0209257_1000055 | |||
| 1005 | Ga0209257_1000082 | |||
| 1006 | Ga0209257_1000314 | |||
| 1007 | Ga0209257_1000502 | |||
| 1008 | Ga0209257_1002902 | |||
| 1009 | Ga0209257_1006390 | |||
| 1010 | Ga0209257_1007389 | |||
| 1011 | Ga0209257_1011545 | |||
| 1012 | Ga0207655_1001588 | |||
| 1013 | Ga0207692_10117664 | |||
| 1014 | Ga0207654_10028668 | |||
| 1015 | Ga0207660_10113961 | |||
| 1016 | Ga0207662_10056620 | |||
| 1017 | Ga0207649_10005908 | |||
| 1018 | Ga0207649_10082370 | |||
| 1019 | Ga0207681_10129901 | |||
| 1020 | Ga0207690_10008693 | |||
| 1021 | Ga0207706_10006639 | |||
| 1022 | Ga0207706_10007228 | |||
| 1023 | Ga0207706_10027392 | |||
| 1024 | Ga0207686_10002673 | |||
| 1025 | Ga0207709_10000019 | |||
| 1026 | Ga0207709_10001066 | |||
| 1027 | Ga0207709_10002413 | |||
| 1028 | Ga0207709_10015195 | |||
| 1029 | Ga0207670_10483498 | |||
| 1030 | Ga0207669_10037359 | |||
| 1031 | Ga0207691_10293971 | |||
| 1032 | Ga0207689_10325742 | |||
| 1033 | Ga0207661_10108995 | |||
| 1034 | Ga0207679_10001480 | |||
| 1035 | Ga0207679_10003955 | |||
| 1036 | Ga0207667_10664516 | |||
| 1037 | Ga0207651_10162408 | |||
| 1038 | Ga0207640_10117256 | |||
| 1039 | Ga0207677_10015245 | |||
| 1040 | Ga0207677_10397527 | |||
| 1041 | Ga0207703_10014663 | |||
| 1042 | Ga0207639_10025392 | |||
| 1043 | Ga0207639_10355771 | |||
| 1044 | Ga0207678_10117897 | |||
| 1045 | Ga0207648_10459777 | |||
| 1046 | Ga0207676_10119487 | |||
| 1047 | Ga0207674_10531007 | |||
| 1048 | Ga0207683_10287041 | |||
| 1049 | Ga0207698_10034650 | |||
| 1050 | Ga0207698_10507377 | |||
| 1051 | Ga0209281_1000005 | |||
| 1052 | Ga0209281_1004678 | |||
| 1053 | Ga0209282_1001130 | |||
| 1054 | Ga0209813_10002277 | |||
| 1055 | Ga0209974_10082148 | |||
| 1056 | Ga0209974_10099729 | |||
| 1057 | Ga0207428_10071917 | |||
| 1058 | Ga0268266_10049385 | |||
| 1059 | Ga0307515_10000026 | |||
| 1060 | Ga0307515_10000028 | |||
| 1061 | Ga0307515_10000358 | |||
| 1062 | Ga0307515_10000702 | |||
| 1063 | Ga0307515_10290805 | |||
| 1064 | Ga0316177_1015869 | |||
| 1065 | Ga0316176_1179678 | |||
| 1066 | Ga0314311_1173925 | |||
| 1067 | Ga0265330_10024749 | |||
| 1068 | Ga0265332_10000002 | |||
| 1069 | Ga0265332_10000003 | |||
| 1070 | Ga0265332_10029887 | |||
| 1071 | Ga0265325_10001303 | |||
| 1072 | Ga0265340_10023487 | |||
| 1073 | Ga0265327_10000293 | |||
| 1074 | Ga0265327_10013279 | |||
| 1075 | Ga0307513_10000012 | |||
| 1076 | Ga0307513_10000021 | |||
| 1077 | Ga0307513_10177396 | |||
| 1078 | Ga0307408_100001814 | |||
| 1079 | Ga0307408_100021024 | |||
| 1080 | Ga0307408_100111097 | |||
| 1081 | Ga0307408_100126179 | |||
| 1082 | Ga0307408_100487569 | |||
| 1083 | Ga0307408_100523765 | |||
| 1084 | Ga0307514_10011048 | |||
| 1085 | Ga0307514_10064235 | |||
| 1086 | Ga0265314_10000066 | |||
| 1087 | Ga0265314_10013569 | |||
| 1088 | Ga0265342_10053711 | |||
| 1089 | Ga0307516_10019825 | |||
| 1090 | Ga0307516_10281440 | |||
| 1091 | Ga0307405_10038723 | |||
| 1092 | Ga0307405_10111779 | |||
| 1093 | Ga0307405_10253448 | |||
| 1094 | Ga0307405_10371177 | |||
| 1095 | Ga0307406_10001092 | |||
| 1096 | Ga0307406_10004344 | |||
| 1097 | Ga0307407_10031017 | |||
| 1098 | Ga0307412_10007370 | |||
| 1099 | Ga0307412_10085187 | |||
| 1100 | Ga0307412_10091354 | |||
| 1101 | Ga0307412_10276440 | |||
| 1102 | Ga0307412_10362637 | |||
| 1103 | Ga0307416_100008192 | |||
| 1104 | Ga0307416_100917673 | |||
| 1105 | Ga0307414_10004678 | |||
| 1106 | Ga0307411_10187615 | |||
| 1107 | Ga0307510_10299490 | |||
| 1108 | Ga0373923_0056557 | |||
| 1109 | Ga0373953_0021435 | |||
| 1110 | Ga0373954_0040264 | |||
| 1111 | Ga0373956_0105734 | |||
| 1112 | Ga0373955_0026390 | |||
| 1113 | Ga0373942_0002461 | |||
| 1114 | Ga0373924_0022331 | |||
| 1115 | Ga0373933_0078880 | |||
| 1116 | Ga0373947_0212293 | |||
| 1117 | Ga0373937_0351316 | |||
| 1118 | Ga0395899_0001484 | |||
| 1119 | Ga0395905_0000763 | |||
| 1120 | Ga0395905_0003434 | |||
| 1121 | Ga0395905_0010399 | |||
| 1122 | Ga0395905_0013696 | |||
| 1123 | Ga0395905_0016368 | |||
| 1124 | Ga0395905_0084023 | |||
| 1125 | Ga0395905_0127497 | |||
| 1126 | Ga0395905_0474924 | |||
| 1127 | Ga0395901_0166457 | |||
| 1128 | Ga0395901_0562302 | |||
| 1129 | Ga0436361_0292057 | |||
| 1130 | Ga0436361_0531535 | |||
| 1131 | Ga0439436_0007968 | |||
| 1132 | Ga0439439_0002537 | |||
| 1133 | Ga0439439_0035232 | |||
| 1134 | Ga0451789_0899535 | |||
| 1135 | Ga0451795_0091317 | |||
| 1136 | Ga0451800_0943611 | |||
| 1137 | Ga0451804_0073610 | |||
| 1138 | Ga0439431_0000588 | |||
| 1139 | Ga0439442_020156 | |||
| 1140 | Ga0439432_015682 | |||
| 1141 | Ga0439449_0000431 | |||
| 1142 | Ga0439449_0000884 | |||
| 1143 | Ga0439449_0001803 | |||
| 1144 | Ga0439449_0014807 | |||
| 1145 | Ga0439449_0020448 | |||
| 1146 | Ga0439449_0077836 | |||
| 1147 | Ga0439452_021393 | |||
| 1148 | Ga0439462_0006427 | |||
| 1149 | Ga0439462_0016415 | |||
| 1150 | Ga0450911_000110 | |||
| 1151 | Ga0450919_007990 | |||
| 1152 | Ga0450894_006311 | |||
| 1153 | Ga0450906_006599 | |||
| 1154 | Ga0450910_014396 | |||
| 1155 | Ga0439446_0021019 | |||
| 1156 | Ga0450908_001993 | |||
| 1157 | Ga0439434_0013581 | |||
| 1158 | Ga0439434_0018542 | |||
| 1159 | Ga0439434_0035255 | |||
| 1160 | Ga0450918_000575 | |||
| 1161 | Ga0450893_0003213 | |||
| 1162 | Ga0451577_0000141 | |||
| 1163 | Ga0451577_0000728 | |||
| 1164 | Ga0451577_0011015 | |||
| 1165 | Ga0451577_0175728 | |||
| 1166 | Ga0451577_0328749 | |||
| 1167 | Ga0466969_0114690 | |||
| 1168 | Ga0466972_0002814 | |||
| 1169 | Ga0453683_0000580 | |||
| 1170 | Ga0453683_0028768 | |||
| 1171 | Ga0466965_0062178 | |||
| 1172 | Ga0466965_0136060 | |||
| 1173 | Ga0466966_0038123 | |||
| 1174 | Ga0466964_0019078 | |||
| 1175 | Ga0453684_0000121 | |||
| 1176 | Ga0453684_0000463 | |||
| 1177 | Ga0453684_0158722 | |||
| 1178 | Ga0466970_0052586 | |||
| 1179 | Ga0466960_0034649 | |||
| 1180 | Ga0451576_0003962 | |||
| 1181 | Ga0451576_0009346 | |||
| 1182 | Ga0451576_0038430 | |||
| 1183 | Ga0466958_0199132 | |||
| 1184 | Ga0466967_0000299 | |||
| 1185 | Ga0495627_030565 | |||
| 1186 | Ga0495627_046255 | |||
| 1187 | Ga0495638_0009953 | |||
| 1188 | Ga0495610_0036121 | |||
| 1189 | Ga0495616_0004462 | |||
| 1190 | Ga0495620_0012665 | |||
| 1191 | Ga0495631_0000492 | |||
| 1192 | Ga0495632_0006419 | |||
| 1193 | Ga0495637_0001313 | |||
| 1194 | Ga0495663_0039039 | |||
| 1195 | Ga0495654_0002302 | |||
| 1196 | Ga0495654_0015854 | |||
| 1197 | Ga0495597_0002478 | |||
| 1198 | Ga0495633_0000652 | |||
| 1199 | Ga0495633_0104937 | |||
| 1200 | Ga0495656_0000110 | |||
| 1201 | Ga0495656_0065897 | |||
| 1202 | Ga0495625_0001291 | |||
| 1203 | Ga0495625_0048664 | |||
| 1204 | Ga0495588_0062888 | |||
| 1205 | Ga0495588_0123934 | |||
| 1206 | Ga0495588_0149065 | |||
| 1207 | Ga0495670_0163620 | |||
| 1208 | Ga0495676_0009977 | |||
| 1209 | Ga0495680_0086867 | |||
| 1210 | Ga0495593_0165794 | |||
| 1211 | Ga0495615_0000968 | |||
| 1212 | Ga0496102_0086239 | |||
| 1213 | Ga0496102_0181582 | |||
| 1214 | Ga0496103_0078808 | |||
| 1215 | Ga0496104_0010890 | |||
| 1216 | Ga0496105_0001768 | |||
| 1217 | Ga0496106_0155367 | |||
| 1218 | Ga0496109_0081034 | |||
| 1219 | Ga0496109_0254069 | |||
| 1220 | Ga0496110_0324266 | |||
| 1221 | Ga0496114_0098290 | |||
| 1222 | Ga0496117_0000166 | |||
| 1223 | Ga0496117_0042827 | |||
| 1224 | Ga0496117_0073959 | |||
| 1225 | Ga0496117_0107684 | |||
| 1226 | Ga0496118_0008215 | |||
| 1227 | Ga0496118_0009204 | |||
| 1228 | Ga0496121_0000187 | |||
| 1229 | Ga0496121_0031937 | |||
| 1230 | Ga0496121_0081487 | |||
| 1231 | Ga0496121_0192386 | |||
| 1232 | Ga0496122_0013572 | |||
| 1233 | Ga0496122_0060650 | |||
| 1234 | Ga0496122_0073012 | |||
| 1235 | Ga0496123_0001126 | |||
| 1236 | Ga0496123_0028778 | |||
| 1237 | Ga0496123_0058815 | |||
| 1238 | Ga0496123_0121532 | |||
| 1239 | Ga0496124_0005536 | |||
| 1240 | Ga0496124_0041510 | |||
| 1241 | Ga0496124_0095827 | |||
| 1242 | Ga0496125_0002287 | |||
| 1243 | Ga0496125_0012190 | |||
| 1244 | Ga0496125_0012633 | |||
| 1245 | Ga0496125_0037939 | |||
| 1246 | Ga0496125_0039882 | |||
| 1247 | Ga0496125_0133162 | |||
| 1248 | Ga0501034_0209785 | |||
| 1249 | Ga0501046_0046217 | |||
| 1250 | Ga0501047_0208380 | |||
| 1251 | Ga0501048_0068176 | |||
| 1252 | Ga0501069_0102787 | |||
| 1253 | Ga0501072_0046328 | |||
| 1254 | Ga0501249_002771 | |||
| 1255 | Ga0501257_050029 | |||
| 1256 | Ga0501225_0026111 | |||
| 1257 | Ga0501080_0358444 | |||
| 1258 | Ga0501081_0091872 | |||
| 1259 | Ga0501262_000249 | |||
| 1260 | Ga0501035_0051331 | |||
| 1261 | nmdc:mga03683_2050_c1 | |||
| 1262 | nmdc:mga03683_39668_c2 | |||
| 1263 | nmdc:mga03683_47448_c1 | |||
| 1264 | nmdc:mga03683_51802_c1 | |||
| 1265 | nmdc:mga03n38_160566_c1 | |||
| 1266 | nmdc:mga00v17_36402_c1 | |||
| 1267 | nmdc:mga0yw44_24689_c1 | |||
| 1268 | nmdc:mga0k408_14139_c1 | |||
| 1269 | nmdc:mga0k408_14754_c1 | |||
| 1270 | nmdc:mga0k408_194963_c1 | |||
| 1271 | nmdc:mga0k408_197313_c1 | |||
| 1272 | nmdc:mga0k408_34900_c1 | |||
| 1273 | nmdc:mga0k408_40749_c1 | |||
| 1274 | nmdc:mga0k408_56778_c1 | |||
| 1275 | nmdc:mga0k408_5749_c1 | |||
| 1276 | nmdc:mga0k408_9371_c1 | |||
| 1277 | nmdc:mga06z11_253318_c1 | |||
| 1278 | nmdc:mga06z11_320472_c1 | |||
| 1279 | nmdc:mga06z11_33598_c1 | |||
| 1280 | nmdc:mga04h51_2488_c1 | |||
| 1281 | nmdc:mga07m45_14730_c1 | |||
| 1282 | nmdc:mga07m45_1917_c1 | |||
| 1283 | nmdc:mga07m45_46008_c1 | |||
| 1284 | nmdc:mga07m45_75177_c1 | |||
| 1285 | nmdc:mga0qj67_82537_c1 | |||
| 1286 | nmdc:mga0n895_58_c1 | |||
| 1287 | nmdc:mga0n895_619_c1 | |||
| 1288 | nmdc:mga0rr50_12556_c1 | |||
| 1289 | nmdc:mga0rr50_3841_c1 | |||
| 1290 | nmdc:mga08x19_727_c1 | |||
| 1291 | nmdc:mga0a205_173783_c1 | |||
| 1292 | nmdc:mga0a205_4300_c1 | |||
| 1293 | nmdc:mga0sz30_37496_c1 | |||
| 1294 | nmdc:mga0sz30_9757_c1 | |||
| 1295 | Ga0500610_0000495 | |||
| 1296 | Ga0500610_0005628 | |||
| 1297 | Ga0500643_002223 | |||
| 1298 | Ga0500644_0056391 | |||
| 1299 | Ga0500647_0088775 | |||
| 1300 | Ga0500583_0105989 | |||
| 1301 | Ga0500651_0000353 | |||
| 1302 | Ga0500651_0012001 | |||
| 1303 | Ga0500566_0053538 | |||
| 1304 | Ga0500650_0000718 | |||
| 1305 | Ga0500650_0031206 | |||
| 1306 | Ga0500562_003594 | |||
| 1307 | Ga0500571_000114 | |||
| 1308 | Ga0500593_002014 | |||
| 1309 | Ga0500593_003386 | |||
| 1310 | Ga0500594_0020643 | |||
| 1311 | Ga0500618_001358 | |||
| 1312 | Ga0500623_035386 | |||
| 1313 | Ga0500642_0001092 | |||
| 1314 | Ga0500652_000099 | |||
| 1315 | Ga0500655_001134 | |||
| 1316 | Ga0500655_012038 | |||
| 1317 | Ga0500559_0065092 | |||
| 1318 | Ga0500568_0008532 | |||
| 1319 | Ga0500568_0021455 | |||
| 1320 | Ga0500574_018941 | |||
| 1321 | Ga0500616_0009122 | |||
| 1322 | Ga0500622_0000097 | |||
| 1323 | Ga0500627_0000364 | |||
| 1324 | Ga0500634_0034126 | |||
| 1325 | Ga0500625_048548 | |||
| 1326 | Ga0500645_000274 | |||
| 1327 | Ga0500645_001839 | |||
| 1328 | Ga0501084_0020258 | |||
| 1329 | Ga0500661_002343 | |||
| 1330 | Ga0590071_000677 | |||
| 1331 | 2644294982 | |||
| 1332 | 2511245562 | |||
| 1333 | 2513227396 | |||
| 1334 | 2548498315 | |||
| 1335 | 2548501295 | |||
| 1336 | 2587727937 | |||
| 1337 | 2587733756 | |||
| 1338 | 2599624499 | |||
| 1339 | 2599672639 | |||
| 1340 | 2599683639 | |||
| 1341 | 2599694248 | |||
| 1342 | 2643867582 | |||
| 1343 | 2643990502 | |||
| 1344 | 2644062927 | |||
| 1345 | 2644070610 | |||
| 1346 | 2644159451 | |||
| 1347 | 2644248993 | |||
| 1348 | 2644328068 | |||
| 1349 | 2644340150 | |||
| 1350 | 2644398623 | |||
| 1351 | 2644468576 | |||
| 1352 | 2644648849 | |||
| 1353 | 2644649161 | |||
| 1354 | 2722884597 | |||
| 1355 | 2738720199 | |||
| 1356 | 2738881741 | |||
| 1357 | 2739243748 | |||
| 1358 | 2739250885 | |||
| 1359 | 2739279398 | |||
| 1360 | 2816472587 | |||
| 1361 | 2819595912 | |||
| 1362 | 2831266938 | |||
| 1363 | 2838056997 | |||
| 1364 | 2839143197 | |||
| 1365 | 2842678809 | |||
| 1366 | 2842720273 | |||
| 1367 | 2842735539 | |||
| 1368 | 2842751368 | |||
| 1369 | 2881102349 | |||
| 1370 | 2885192840 | |||
| 1371 | 2885199007 | |||
| 1372 | 2885212730 | |||
| 1373 | 2894026654 | |||
| 1374 | 2899925260 | |||
| 1375 | 2904454574 | |||
| 1376 | 2904460983 | |||
| 1377 | 2904548365 | |||
| 1378 | 2919465861 | |||
| 1379 | 2919688522 | |||
| 1380 | 2919704792 | |||
| 1381 | 2928038617 | |||
| 1382 | 2928045778 | |||
| 1383 | 2928053395 | |||
| 1384 | 2928067000 | |||
| 1385 | 2928071101 | |||
| 1386 | 2928084958 | |||
| 1387 | 2928116220 | |||
| 1388 | 2929163758 | |||
| 1389 | 2929526866 | |||
| 1390 | 2932423624 | |||
| 1391 | 2945912418 | |||
| 1392 | 2945948332 | |||
| 1393 | 2945977027 | |||
| 1394 | 2945985264 | |||
| 1395 | 2974322737 | |||
| 1396 | 2990713096 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5azc-assembly1.cif.gz_A | crystal structure of escherichia coli lgt in complex with phosphatidylglycerol | 0.7944 | 2 | 263 |
| 5azc-assembly1.cif.gz_A | crystal structure of escherichia coli lgt in complex with phosphatidylglycerol | 0.7753 | 2 | 263 |
| 4u99-assembly2.cif.gz_B | crystal structure of an h-nox protein from s. oneidensis in the fe(ii) ligation state, q154a/q155a/k156a mutant | 0.6131 | 95 | 142 |
| 7d3e-assembly1.cif.gz_B | cryo-em structure of human duox1-duoxa1 in low-calcium state | 0.5272 | 176 | 261 |
| 2zzf-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase without oligomerization domain | 0.3857 | 109 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7K1I4_1_105_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.6599 | 187 | 259 | 1.20.120.350 |
| af_Q8L7H8_5_108_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.5661 | 178 | 260 | 1.10.10.1740 |
| af_Q8LD38_5_108_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.5637 | 178 | 260 | 1.10.10.1740 |
| af_O01578_26_133_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.5467 | 187 | 260 | 1.10.10.1740 |
| af_A0A1D6PYC9_52_155_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.4462 | 21 | 145 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519M239-F1-model_v4 | Prolipoprotein diacylglyceryl transferase | 0.9746 | 123 | 268 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A655YEH0-F1-model_v4 | Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) | 0.9711 | 112 | 260 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A1E7YRZ7-F1-model_v4 | Prolipoprotein diacylglyceryl transferase | 0.969 | 119 | 260 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A6N9SNN2-F1-model_v4 | Prolipoprotein diacylglyceryl transferase | 0.9678 | 143 | 260 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A348ZWD3-F1-model_v4 | Prolipoprotein diacylglyceryl transferase | 0.961 | 128 | 254 |
GO:0005886
GO:0008961 GO:0042158 |