F476113

General Info

Members Datasets Scaffolds Average Seq Length
700 254 642 334

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0001252|Ga0495583_0001252_22284_23498
Length 404
Sequence MPRALLLTLPAGRRSKLARDLPGTGSKPCEYGAADTANVPDFAAASRQIASKLAPTPCGQKRDRIPHFREIQPMRLIQFENSQGQRQVGVVEGSQVNVVRNTTRTRELALAAIRSQHSLEAEVESRGTESGPDYAGLLQNGQILPPLDHEDPAHCLISGTGLTHLGSASARDKMHQHDGQVEAGMTDTMKIFKWGIEGGKPAQGQVGAQPEWFYKGDGSIVVRPGADFPVPAFAEDAGEEPELTGLYVVGDDGQPYRLGYALGNEFSDHVMERRNYLYLAHSKLRYCAYGPELRVGELPRHLAGMSRIKRNGEVIWEKEFLSGEDNMCHSLANLEYHHFKYAQFLRPGDVHIHYFGTATLSFADGVKTQPGDRFQISLDAFGAPLENGIGEGPRPVAIGQIKAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231021 Pseudomonas sp. GM78 Isolate Nodule
11 2511231022 Pseudomonas sp. GM79 Isolate Nodule
12 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
13 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
14 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
15 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
16 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
17 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
18 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
19 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
20 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
21 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
22 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
23 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
24 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
25 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
26 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
27 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
28 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
29 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
30 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
31 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
32 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
33 2842711865 Duganella sp. R-73148 Isolate Unclassified
34 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
35 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
36 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
37 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
38 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
39 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
40 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
41 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
42 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
43 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
44 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
45 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
46 2952252522 Salinicola sp. DM10 Isolate Unclassified
47 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
48 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
49 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
50 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
51 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
52 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
53 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
54 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
57 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
58 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
59 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
128 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
133 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
134 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
135 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
140 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
250 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
251 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
252 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
253 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
254 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.71
Metatranscriptomes 0
Isolates 8.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 2.86
Nodule 1.29
Rhizoplane 3.86
Rhizosphere 79.29
Stem 0
Stem Tuber 0
Unclassified 12.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_137913 2162886007 Bacteria 2725
2 SwRhRL2b_contig_3254133 2162886007 Bacteria 3019
3 SwRhRL2b_contig_493770 2162886007 Bacteria 1654
4 JGI25155J39150_1000196 3300002704 Bacteria 25624
5 JGI25156J39149_1000283 3300002705 Bacteria 34253
6 JGI25156J39149_1009113 3300002705 Bacteria 2439
7 JGI25162J39368_1003489 3300002737 Bacteria 4490
8 JGI25154J39366_1000252 3300002738 Bacteria 34253
9 JGI25154J39366_1000261 3300002738 Bacteria 33723
10 JGI25157J39369_1000319 3300002741 Bacteria 34439
11 Ga0055532_1000136 3300003758 Bacteria 72117
12 Ga0055535_1005923 3300003761 Bacteria 2572
13 Ga0055530_10016747 3300003791 Bacteria 2324
14 Ga0065714_10006879 3300005288 Bacteria 3805
15 Ga0065714_10068176 3300005288 Bacteria 4914
16 Ga0065714_10083506 3300005288 Bacteria 2245
17 Ga0065714_10090000 3300005288 Bacteria 1953
18 Ga0065714_10119120 3300005288 Bacteria 1338
19 Ga0065704_10077534 3300005289 Bacteria 4703
20 Ga0065704_10077768 3300005289 Bacteria 4622
21 Ga0068868_100024080 3300005338 Bacteria 4615
22 Ga0068857_100175589 3300005577 Bacteria 1949
23 Ga0081539_10046229 3300005985 Bacteria 2496
24 Ga0075432_10003685 3300006058 Bacteria 5216
25 Ga0075432_10012381 3300006058 Bacteria 2898
26 Ga0075432_10032493 3300006058 Bacteria 1808
27 Ga0079104_1000145 3300006946 Bacteria 100111
28 Ga0105251_10000106 3300009011 Bacteria 82337
29 Ga0105251_10000114 3300009011 Bacteria 80239
30 Ga0105251_10007117 3300009011 Bacteria 6965
31 Ga0105251_10009234 3300009011 Bacteria 5845
32 Ga0105244_10001696 3300009036 Bacteria 17393
33 Ga0105244_10005743 3300009036 Bacteria 8186
34 Ga0105244_10007542 3300009036 Bacteria 6906
35 Ga0105244_10017532 3300009036 Bacteria 4043
36 Ga0105244_10024687 3300009036 Bacteria 3278
37 Ga0105244_10027836 3300009036 Bacteria 3041
38 Ga0105250_10025832 3300009092 Bacteria 2366
39 Ga0105247_10000054 3300009101 Bacteria 134359
40 Ga0105243_10051821 3300009148 Bacteria 3247
41 Ga0105243_10107248 3300009148 Bacteria 2329
42 Ga0105238_10040887 3300009551 Bacteria 4697
43 Ga0105246_10018262 3300011119 Bacteria 4469
44 Ga0157373_10247008 3300013100 Bacteria 1262
45 Ga0157371_10000131 3300013102 Bacteria 113432
46 Ga0157371_10000583 3300013102 Bacteria 43268
47 Ga0157371_10006453 3300013102 Bacteria 9672
48 Ga0157371_10133985 3300013102 Bacteria 1764
49 Ga0157370_10000675 3300013104 Bacteria 42506
50 Ga0157370_10038239 3300013104 Bacteria 4642
51 Ga0157369_10002079 3300013105 Bacteria 24196
52 Ga0157378_10136013 3300013297 Bacteria 2279
53 Ga0163162_10361274 3300013306 Bacteria 1585
54 Ga0157372_10429274 3300013307 Bacteria 1540
55 Ga0157375_10333062 3300013308 Bacteria 1683
56 Ga0182008_10000863 3300014497 Bacteria 21045
57 Ga0182008_10009128 3300014497 Bacteria 5369
58 Ga0182008_10098227 3300014497 Bacteria 1446
59 Ga0182005_1003356 3300015265 Bacteria 5453
60 Ga0182005_1009573 3300015265 Bacteria 2814
61 Ga0182005_1028066 3300015265 Bacteria 1535
62 Ga0163161_10001364 3300017792 Bacteria 18118
63 Ga0163161_10004147 3300017792 Bacteria 10133
64 Ga0163161_10019833 3300017792 Bacteria 4718
65 Ga0163161_10081340 3300017792 Bacteria 2385
66 Ga0163161_10168017 3300017792 Bacteria 1676
67 Ga0209435_100018 3300025206 Bacteria 274625
68 Ga0209435_100106 3300025206 Bacteria 32841
69 Ga0209147_100051 3300025229 Bacteria 274605
70 Ga0209437_100611 3300025233 Bacteria 21911
71 Ga0209258_100324 3300025242 Bacteria 72141
72 Ga0209646_1000172 3300025246 Bacteria 84840
73 Ga0209646_1000186 3300025246 Bacteria 77615
74 Ga0209026_1000042 3300025250 Bacteria 273111
75 Ga0209026_1001244 3300025250 Bacteria 11663
76 Ga0209759_1000273 3300025256 Bacteria 73308
77 Ga0209759_1000765 3300025256 Bacteria 27365
78 Ga0209455_1011110 3300025272 Bacteria 2237
79 Ga0209676_1002229 3300025292 Bacteria 14345
80 Ga0209676_1002811 3300025292 Bacteria 11520
81 Ga0209758_1000048 3300025297 Bacteria 358400
82 Ga0209050_1000593 3300025298 Bacteria 57753
83 Ga0209050_1010331 3300025298 Bacteria 4612
84 Ga0209051_1011189 3300025303 Bacteria 4452
85 Ga0209257_1001223 3300025304 Bacteria 32018
86 Ga0207696_1000006 3300025711 Bacteria 616498
87 Ga0207696_1009191 3300025711 Bacteria 3700
88 Ga0207655_1000077 3300025728 Bacteria 219418
89 Ga0207655_1005361 3300025728 Bacteria 8748
90 Ga0207655_1007591 3300025728 Bacteria 7017
91 Ga0207655_1011146 3300025728 Bacteria 5379
92 Ga0207655_1011656 3300025728 Bacteria 5212
93 Ga0207655_1020903 3300025728 Bacteria 3344
94 Ga0207655_1035626 3300025728 Bacteria 2219
95 Ga0207655_1035906 3300025728 Bacteria 2206
96 Ga0207713_1000159 3300025735 Bacteria 101793
97 Ga0207713_1000200 3300025735 Bacteria 82983
98 Ga0207713_1002310 3300025735 Bacteria 14016
99 Ga0207713_1019496 3300025735 Bacteria 3314
100 Ga0207713_1034033 3300025735 Bacteria 2218
101 Ga0207713_1034985 3300025735 Bacteria 2174
102 Ga0207710_10000123 3300025900 Bacteria 93866
103 Ga0207695_10010174 3300025913 Bacteria 11537
104 Ga0207694_10087791 3300025924 Bacteria 2451
105 Ga0207650_10144046 3300025925 Bacteria 1875
106 Ga0207709_10011017 3300025935 Bacteria 4985
107 Ga0207709_10021985 3300025935 Bacteria 3615
108 Ga0207709_10038036 3300025935 Bacteria 2862
109 Ga0207665_10077118 3300025939 Bacteria 2287
110 Ga0207698_10011991 3300026142 Bacteria 5649
111 Ga0209281_1000271 3300027111 Bacteria 100141
112 Ga0209371_1000127 3300027312 Bacteria 127069
113 Ga0209995_1000919 3300027471 Bacteria 4576
114 Ga0209983_1007174 3300027665 Bacteria 2288
115 Ga0209971_1001025 3300027682 Bacteria 7137
116 Ga0207428_10004838 3300027907 Bacteria 12715
117 Ga0207428_10028722 3300027907 Bacteria 4618
118 Ga0307517_10176051 3300028786 Bacteria 1393
119 Ga0268256_1000104 3300030500 Bacteria 127069
120 Ga0307408_100000002 3300031548 Bacteria 827227
121 Ga0307413_10021231 3300031824 Bacteria 3472
122 Ga0307413_10061116 3300031824 Bacteria 2323
123 Ga0307414_10012356 3300032004 Bacteria 5045
124 Ga0395899_0009127 3300037312 Bacteria 7618
125 Ga0395900_0166574 3300037418 Bacteria 2245
126 Ga0395898_0069113 3300037466 Bacteria 3418
127 Ga0395905_0000888 3300037471 Bacteria 39004
128 Ga0395901_0044824 3300038443 Bacteria 4587
129 Ga0436361_0591059 3300039447 Bacteria 3293
130 Ga0439438_000324 3300041405 Bacteria 21467
131 Ga0439438_000831 3300041405 Bacteria 13793
132 Ga0439438_002627 3300041405 Bacteria 7590
133 Ga0439438_005965 3300041405 Bacteria 4397
134 Ga0439447_006642 3300041407 Bacteria 3735
135 Ga0439447_040847 3300041407 Bacteria 1130
136 Ga0439466_0002293 3300041411 Bacteria 7504
137 Ga0439466_0002437 3300041411 Bacteria 7290
138 Ga0439466_0007098 3300041411 Bacteria 4241
139 Ga0439466_0013923 3300041411 Bacteria 2937
140 Ga0439466_0016670 3300041411 Bacteria 2653
141 Ga0439466_0024576 3300041411 Bacteria 2110
142 Ga0439466_0034537 3300041411 Bacteria 1714
143 Ga0451793_1750779 3300041452 Bacteria 2929
144 Ga0439432_000440 3300042006 Bacteria 15454
145 Ga0439432_042605 3300042006 Bacteria 1435
146 Ga0439451_001308 3300042009 Bacteria 4915
147 Ga0439452_000503 3300042010 Bacteria 21254
148 Ga0439452_000911 3300042010 Bacteria 13464
149 Ga0439452_002403 3300042010 Bacteria 6938
150 Ga0439452_003327 3300042010 Bacteria 5657
151 Ga0439452_003458 3300042010 Bacteria 5521
152 Ga0439456_026299 3300042013 Bacteria 1237
153 Ga0450911_001112 3300042115 Bacteria 6701
154 Ga0450911_003098 3300042115 Bacteria 3027
155 Ga0450923_003652 3300042125 Bacteria 2348
156 Ga0450902_000168 3300042137 Bacteria 7424
157 Ga0450902_017276 3300042137 Bacteria 1178
158 Ga0450903_001039 3300042138 Bacteria 5297
159 Ga0450905_000045 3300042142 Bacteria 10663
160 Ga0450905_002010 3300042142 Bacteria 2593
161 Ga0450905_009496 3300042142 Bacteria 1338
162 Ga0450909_000039 3300042185 Bacteria 10772
163 Ga0439434_0006394 3300042435 Bacteria 3440
164 Ga0439459_0000617 3300042438 Bacteria 4775
165 Ga0439464_0007672 3300042439 Bacteria 2823
166 Ga0439460_0001928 3300042461 Bacteria 4959
167 Ga0450901_000085 3300042533 Bacteria 9755
168 Ga0450901_000633 3300042533 Bacteria 4136
169 Ga0466972_0079308 3300044658 Bacteria 1563
170 Ga0466970_0054731 3300044765 Bacteria 2131
171 Ga0466960_0010487 3300044901 Bacteria 3850
172 Ga0495617_001498 3300046452 Bacteria 10186
173 Ga0495617_027591 3300046452 Bacteria 1910
174 Ga0495617_041659 3300046452 Bacteria 1534
175 Ga0495627_000104 3300046453 Bacteria 104176
176 Ga0495627_000250 3300046453 Bacteria 55806
177 Ga0495627_000667 3300046453 Bacteria 26425
178 Ga0495627_003239 3300046453 Bacteria 7309
179 Ga0495627_019897 3300046453 Bacteria 2245
180 Ga0495627_022639 3300046453 Bacteria 2065
181 Ga0495603_0004673 3300046455 Bacteria 8187
182 Ga0495590_0000143 3300046457 Bacteria 43197
183 Ga0495590_0006161 3300046457 Bacteria 4697
184 Ga0495590_0007272 3300046457 Bacteria 4281
185 Ga0495590_0009908 3300046457 Bacteria 3603
186 Ga0495591_000167 3300046458 Bacteria 70044
187 Ga0495591_000232 3300046458 Bacteria 54458
188 Ga0495591_002372 3300046458 Bacteria 10571
189 Ga0495591_002394 3300046458 Bacteria 10489
190 Ga0495591_003361 3300046458 Bacteria 8316
191 Ga0495591_004106 3300046458 Bacteria 7246
192 Ga0495591_006840 3300046458 Bacteria 4956
193 Ga0495591_007182 3300046458 Bacteria 4772
194 Ga0495591_008762 3300046458 Bacteria 4105
195 Ga0495591_010134 3300046458 Bacteria 3680
196 Ga0495591_010247 3300046458 Bacteria 3648
197 Ga0495591_021303 3300046458 Bacteria 2118
198 Ga0495591_024114 3300046458 Bacteria 1934
199 Ga0495638_0000007 3300046460 Bacteria 602783
200 Ga0495638_0001278 3300046460 Bacteria 23475
201 Ga0495638_0001733 3300046460 Bacteria 19207
202 Ga0495638_0002251 3300046460 Bacteria 15994
203 Ga0495638_0002940 3300046460 Bacteria 13608
204 Ga0495638_0005766 3300046460 Bacteria 9119
205 Ga0495638_0006300 3300046460 Bacteria 8650
206 Ga0495638_0009186 3300046460 Bacteria 6951
207 Ga0495638_0048991 3300046460 Bacteria 2642
208 Ga0495653_0000338 3300046463 Bacteria 38422
209 Ga0495653_0148156 3300046463 Bacteria 1642
210 Ga0495650_0000354 3300046471 Bacteria 81084
211 Ga0495650_0001850 3300046471 Bacteria 18948
212 Ga0495650_0002085 3300046471 Bacteria 17242
213 Ga0495650_0002558 3300046471 Bacteria 14444
214 Ga0495650_0003013 3300046471 Bacteria 12712
215 Ga0495650_0003106 3300046471 Bacteria 12460
216 Ga0495650_0005873 3300046471 Bacteria 7809
217 Ga0495605_0000033 3300046474 Bacteria 209203
218 Ga0495605_0000140 3300046474 Bacteria 93059
219 Ga0495605_0000167 3300046474 Bacteria 83036
220 Ga0495605_0001070 3300046474 Bacteria 18257
221 Ga0495605_0001630 3300046474 Bacteria 14506
222 Ga0495605_0003513 3300046474 Bacteria 9318
223 Ga0495605_0008959 3300046474 Bacteria 5639
224 Ga0495605_0018354 3300046474 Bacteria 3751
225 Ga0495605_0023904 3300046474 Bacteria 3205
226 Ga0495605_0025919 3300046474 Bacteria 3050
227 Ga0495584_0000733 3300046491 Bacteria 21643
228 Ga0495584_0003484 3300046491 Bacteria 8645
229 Ga0495584_0004315 3300046491 Bacteria 7657
230 Ga0495584_0007418 3300046491 Bacteria 5721
231 Ga0495584_0008431 3300046491 Bacteria 5339
232 Ga0495584_0014254 3300046491 Bacteria 4049
233 Ga0495584_0045907 3300046491 Bacteria 2203
234 Ga0495585_0000376 3300046492 Bacteria 42971
235 Ga0495585_0000958 3300046492 Bacteria 24270
236 Ga0495585_0001334 3300046492 Bacteria 19601
237 Ga0495585_0001401 3300046492 Bacteria 18994
238 Ga0495585_0005161 3300046492 Bacteria 8292
239 Ga0495585_0012339 3300046492 Bacteria 5034
240 Ga0495585_0015090 3300046492 Bacteria 4489
241 Ga0495585_0078505 3300046492 Bacteria 1790
242 Ga0495594_0000853 3300046499 Bacteria 15708
243 Ga0495596_0000597 3300046500 Bacteria 22660
244 Ga0495596_0004457 3300046500 Bacteria 6811
245 Ga0495607_0000340 3300046501 Bacteria 48340
246 Ga0495607_0000703 3300046501 Bacteria 32246
247 Ga0495607_0001373 3300046501 Bacteria 21652
248 Ga0495607_0001890 3300046501 Bacteria 17769
249 Ga0495607_0002954 3300046501 Bacteria 13362
250 Ga0495607_0006927 3300046501 Bacteria 7904
251 Ga0495607_0008484 3300046501 Bacteria 7021
252 Ga0495607_0011519 3300046501 Bacteria 5883
253 Ga0495607_0014827 3300046501 Bacteria 5065
254 Ga0495607_0015462 3300046501 Bacteria 4946
255 Ga0495607_0015614 3300046501 Bacteria 4919
256 Ga0495607_0020691 3300046501 Bacteria 4153
257 Ga0495607_0020916 3300046501 Bacteria 4124
258 Ga0495607_0021012 3300046501 Bacteria 4112
259 Ga0495607_0028406 3300046501 Bacteria 3452
260 Ga0495607_0075810 3300046501 Bacteria 1862
261 Ga0495583_0000031 3300046506 Bacteria 253982
262 Ga0495583_0000040 3300046506 Bacteria 236558
263 Ga0495583_0000086 3300046506 Bacteria 165176
264 Ga0495583_0001252 3300046506 Bacteria 26787
265 Ga0495583_0001565 3300046506 Bacteria 22606
266 Ga0495583_0001979 3300046506 Bacteria 18812
267 Ga0495583_0002064 3300046506 Bacteria 18165
268 Ga0495583_0002446 3300046506 Bacteria 15854
269 Ga0495583_0003785 3300046506 Bacteria 11239
270 Ga0495583_0004591 3300046506 Bacteria 9789
271 Ga0495583_0024102 3300046506 Bacteria 3064
272 Ga0495606_0000313 3300046507 Bacteria 83765
273 Ga0495606_0000334 3300046507 Bacteria 81008
274 Ga0495606_0000909 3300046507 Bacteria 43944
275 Ga0495606_0001195 3300046507 Bacteria 36567
276 Ga0495606_0002620 3300046507 Bacteria 20518
277 Ga0495606_0009230 3300046507 Bacteria 8375
278 Ga0495606_0013461 3300046507 Bacteria 6457
279 Ga0495606_0036071 3300046507 Bacteria 3373
280 Ga0495606_0079296 3300046507 Bacteria 2045
281 Ga0495610_0001974 3300046512 Bacteria 17557
282 Ga0495610_0003251 3300046512 Bacteria 12838
283 Ga0495610_0006013 3300046512 Bacteria 8480
284 Ga0495610_0009589 3300046512 Bacteria 6106
285 Ga0495610_0010437 3300046512 Bacteria 5770
286 Ga0495610_0027105 3300046512 Bacteria 3051
287 Ga0495610_0047177 3300046512 Bacteria 2120
288 Ga0495610_0058438 3300046512 Bacteria 1845
289 Ga0495610_0069719 3300046512 Bacteria 1644
290 Ga0495610_0094434 3300046512 Bacteria 1350
291 Ga0495610_0110359 3300046512 Bacteria 1219
292 Ga0495616_0008681 3300046513 Bacteria 5996
293 Ga0495616_0015169 3300046513 Bacteria 4287
294 Ga0495616_0016241 3300046513 Bacteria 4124
295 Ga0495616_0041382 3300046513 Bacteria 2350
296 Ga0495616_0100448 3300046513 Bacteria 1357
297 Ga0495620_0000006 3300046515 Bacteria 273098
298 Ga0495620_0000099 3300046515 Bacteria 69356
299 Ga0495620_0000727 3300046515 Bacteria 20296
300 Ga0495620_0001709 3300046515 Bacteria 12963
301 Ga0495620_0002517 3300046515 Bacteria 10622
302 Ga0495620_0019020 3300046515 Bacteria 3389
303 Ga0495620_0070771 3300046515 Bacteria 1428
304 Ga0495620_0084979 3300046515 Bacteria 1275
305 Ga0495630_0081453 3300046517 Bacteria 2442
306 Ga0495631_0001975 3300046518 Bacteria 12018
307 Ga0495631_0002303 3300046518 Bacteria 10898
308 Ga0495631_0002434 3300046518 Bacteria 10494
309 Ga0495631_0005888 3300046518 Bacteria 6389
310 Ga0495631_0008156 3300046518 Bacteria 5287
311 Ga0495631_0021251 3300046518 Bacteria 3023
312 Ga0495631_0022212 3300046518 Bacteria 2950
313 Ga0495632_0000074 3300046519 Bacteria 103136
314 Ga0495632_0001508 3300046519 Bacteria 19247
315 Ga0495632_0003449 3300046519 Bacteria 11214
316 Ga0495632_0005605 3300046519 Bacteria 8261
317 Ga0495632_0007232 3300046519 Bacteria 7006
318 Ga0495632_0014140 3300046519 Bacteria 4527
319 Ga0495632_0033121 3300046519 Bacteria 2655
320 Ga0495632_0062718 3300046519 Bacteria 1801
321 Ga0495632_0088481 3300046519 Bacteria 1471
322 Ga0495637_0000059 3300046520 Bacteria 96238
323 Ga0495637_0000549 3300046520 Bacteria 26977
324 Ga0495637_0000871 3300046520 Bacteria 19649
325 Ga0495637_0001245 3300046520 Bacteria 15405
326 Ga0495637_0002366 3300046520 Bacteria 10451
327 Ga0495637_0004597 3300046520 Bacteria 7133
328 Ga0495637_0005349 3300046520 Bacteria 6560
329 Ga0495637_0007088 3300046520 Bacteria 5581
330 Ga0495637_0010585 3300046520 Bacteria 4454
331 Ga0495637_0016594 3300046520 Bacteria 3441
332 Ga0495637_0021751 3300046520 Bacteria 2935
333 Ga0495643_0000029 3300046522 Bacteria 261028
334 Ga0495643_0000484 3300046522 Bacteria 50541
335 Ga0495643_0020788 3300046522 Bacteria 3777
336 Ga0495643_0025132 3300046522 Bacteria 3373
337 Ga0495643_0065704 3300046522 Bacteria 1915
338 Ga0495643_0146382 3300046522 Bacteria 1173
339 Ga0495644_0000483 3300046523 Bacteria 17205
340 Ga0495644_0000497 3300046523 Bacteria 16789
341 Ga0495644_0004900 3300046523 Bacteria 5255
342 Ga0495644_0006726 3300046523 Bacteria 4451
343 Ga0495644_0010235 3300046523 Bacteria 3613
344 Ga0495644_0025903 3300046523 Bacteria 2225
345 Ga0495644_0033901 3300046523 Bacteria 1928
346 Ga0495648_0000126 3300046524 Bacteria 90189
347 Ga0495648_0001662 3300046524 Bacteria 21561
348 Ga0495648_0001683 3300046524 Bacteria 21391
349 Ga0495648_0001868 3300046524 Bacteria 20138
350 Ga0495648_0010575 3300046524 Bacteria 7017
351 Ga0495648_0024589 3300046524 Bacteria 4097
352 Ga0495648_0048367 3300046524 Bacteria 2618
353 Ga0495648_0059135 3300046524 Bacteria 2288
354 Ga0495648_0142275 3300046524 Bacteria 1261
355 Ga0495663_0000484 3300046525 Bacteria 14454
356 Ga0495663_0050362 3300046525 Bacteria 1288
357 Ga0495666_0000597 3300046526 Bacteria 16163
358 Ga0495654_0000117 3300046530 Bacteria 89307
359 Ga0495654_0000877 3300046530 Bacteria 22571
360 Ga0495654_0001099 3300046530 Bacteria 19580
361 Ga0495654_0003545 3300046530 Bacteria 9515
362 Ga0495654_0005465 3300046530 Bacteria 7375
363 Ga0495654_0007771 3300046530 Bacteria 5967
364 Ga0495654_0013603 3300046530 Bacteria 4351
365 Ga0495654_0024468 3300046530 Bacteria 3118
366 Ga0495654_0028704 3300046530 Bacteria 2842
367 Ga0495654_0029436 3300046530 Bacteria 2800
368 Ga0495654_0030232 3300046530 Bacteria 2757
369 Ga0495654_0044183 3300046530 Bacteria 2204
370 Ga0495654_0073847 3300046530 Bacteria 1612
371 Ga0495587_0010308 3300046536 Bacteria 5955
372 Ga0495598_0011535 3300046537 Bacteria 2146
373 Ga0495609_0000018 3300046538 Bacteria 302609
374 Ga0495609_0000123 3300046538 Bacteria 86194
375 Ga0495609_0000194 3300046538 Bacteria 60772
376 Ga0495609_0001033 3300046538 Bacteria 19567
377 Ga0495609_0017431 3300046538 Bacteria 3334
378 Ga0495609_0019388 3300046538 Bacteria 3148
379 Ga0495609_0118190 3300046538 Bacteria 1141
380 Ga0495621_0002311 3300046539 Bacteria 5114
381 Ga0495597_0000066 3300046542 Bacteria 90474
382 Ga0495597_0003474 3300046542 Bacteria 9156
383 Ga0495597_0014160 3300046542 Bacteria 3800
384 Ga0495597_0047027 3300046542 Bacteria 1911
385 Ga0495622_0009645 3300046557 Bacteria 4464
386 Ga0495622_0037388 3300046557 Bacteria 2261
387 Ga0495622_0038809 3300046557 Bacteria 2217
388 Ga0495633_0000150 3300046558 Bacteria 92357
389 Ga0495633_0004584 3300046558 Bacteria 8716
390 Ga0495633_0094236 3300046558 Bacteria 1391
391 Ga0495656_0002512 3300046615 Bacteria 6101
392 Ga0495656_0010817 3300046615 Bacteria 3331
393 Ga0495656_0041043 3300046615 Bacteria 1931
394 Ga0495668_0001701 3300046616 Bacteria 20338
395 Ga0495668_0003884 3300046616 Bacteria 10909
396 Ga0495668_0027078 3300046616 Bacteria 3248
397 Ga0495668_0029803 3300046616 Bacteria 3083
398 Ga0495668_0192922 3300046616 Bacteria 1116
399 Ga0495634_0000967 3300046642 Bacteria 27121
400 Ga0495611_0002236 3300046648 Bacteria 8989
401 Ga0495611_0012393 3300046648 Bacteria 3625
402 Ga0495611_0021512 3300046648 Bacteria 2785
403 Ga0495611_0022541 3300046648 Bacteria 2725
404 Ga0495611_0039833 3300046648 Bacteria 2093
405 Ga0495611_0041467 3300046648 Bacteria 2053
406 Ga0495625_0000202 3300046660 Bacteria 94655
407 Ga0495625_0001669 3300046660 Bacteria 25981
408 Ga0495625_0002757 3300046660 Bacteria 18579
409 Ga0495625_0003927 3300046660 Bacteria 14294
410 Ga0495625_0018771 3300046660 Bacteria 5387
411 Ga0495625_0029963 3300046660 Bacteria 4063
412 Ga0495625_0031061 3300046660 Bacteria 3976
413 Ga0495625_0048376 3300046660 Bacteria 3062
414 Ga0495635_0000752 3300046663 Bacteria 21018
415 Ga0495661_0000007 3300046665 Bacteria 411832
416 Ga0495661_0000016 3300046665 Bacteria 213593
417 Ga0495661_0000133 3300046665 Bacteria 88428
418 Ga0495661_0003731 3300046665 Bacteria 11158
419 Ga0495661_0012890 3300046665 Bacteria 5633
420 Ga0495661_0020175 3300046665 Bacteria 4356
421 Ga0495661_0025621 3300046665 Bacteria 3807
422 Ga0495661_0026900 3300046665 Bacteria 3699
423 Ga0495661_0028312 3300046665 Bacteria 3588
424 Ga0495661_0037367 3300046665 Bacteria 3032
425 Ga0495588_0017415 3300046674 Bacteria 3489
426 Ga0495623_0001344 3300046679 Bacteria 16659
427 Ga0495623_0022120 3300046679 Bacteria 4106
428 Ga0495669_0001634 3300046684 Bacteria 9211
429 Ga0495613_0045064 3300046689 Bacteria 3263
430 Ga0495670_0000517 3300046691 Bacteria 18209
431 Ga0495670_0020875 3300046691 Bacteria 3229
432 Ga0495670_0021422 3300046691 Bacteria 3187
433 Ga0495670_0022375 3300046691 Bacteria 3121
434 Ga0495670_0025453 3300046691 Bacteria 2927
435 Ga0495670_0029628 3300046691 Bacteria 2717
436 Ga0495670_0040942 3300046691 Bacteria 2311
437 Ga0495670_0054333 3300046691 Bacteria 2006
438 Ga0495671_0000534 3300046692 Bacteria 28736
439 Ga0495671_0000866 3300046692 Bacteria 21682
440 Ga0495671_0000908 3300046692 Bacteria 21076
441 Ga0495671_0004085 3300046692 Bacteria 8806
442 Ga0495671_0011911 3300046692 Bacteria 4765
443 Ga0495671_0015085 3300046692 Bacteria 4148
444 Ga0495671_0026857 3300046692 Bacteria 2979
445 Ga0495671_0036475 3300046692 Bacteria 2490
446 Ga0495671_0049837 3300046692 Bacteria 2086
447 Ga0495649_0000021 3300046694 Bacteria 180395
448 Ga0495649_0003039 3300046694 Bacteria 11507
449 Ga0495649_0014160 3300046694 Bacteria 4580
450 Ga0495649_0014597 3300046694 Bacteria 4495
451 Ga0495649_0022179 3300046694 Bacteria 3552
452 Ga0495649_0026092 3300046694 Bacteria 3252
453 Ga0495649_0026904 3300046694 Bacteria 3194
454 Ga0495649_0089331 3300046694 Bacteria 1643
455 Ga0495589_0000777 3300046794 Bacteria 20260
456 Ga0495589_0000880 3300046794 Bacteria 18652
457 Ga0495589_0005031 3300046794 Bacteria 6989
458 Ga0495589_0012693 3300046794 Bacteria 4356
459 Ga0495589_0014506 3300046794 Bacteria 4055
460 Ga0495589_0015050 3300046794 Bacteria 3981
461 Ga0495589_0030802 3300046794 Bacteria 2701
462 Ga0495600_0159173 3300046809 Bacteria 1460
463 Ga0495660_0001112 3300046810 Bacteria 19211
464 Ga0495660_0001176 3300046810 Bacteria 18465
465 Ga0495660_0002171 3300046810 Bacteria 12636
466 Ga0495660_0010697 3300046810 Bacteria 5332
467 Ga0495660_0015582 3300046810 Bacteria 4391
468 Ga0495660_0016636 3300046810 Bacteria 4239
469 Ga0495660_0017574 3300046810 Bacteria 4116
470 Ga0495660_0018095 3300046810 Bacteria 4052
471 Ga0495660_0029196 3300046810 Bacteria 3113
472 Ga0495660_0029606 3300046810 Bacteria 3088
473 Ga0495660_0054407 3300046810 Bacteria 2168
474 Ga0495660_0059066 3300046810 Bacteria 2063
475 Ga0495660_0087624 3300046810 Bacteria 1623
476 Ga0495604_0020525 3300047317 Bacteria 5276
477 Ga0495604_0027922 3300047317 Bacteria 4488
478 Ga0495674_0011531 3300047319 Bacteria 8339
479 Ga0495672_0001238 3300047320 Bacteria 25658
480 Ga0495672_0001807 3300047320 Bacteria 20501
481 Ga0495672_0002756 3300047320 Bacteria 15741
482 Ga0495672_0004755 3300047320 Bacteria 10965
483 Ga0495672_0007231 3300047320 Bacteria 8379
484 Ga0495672_0047147 3300047320 Bacteria 2565
485 Ga0495672_0107302 3300047320 Bacteria 1504
486 Ga0495672_0178767 3300047320 Bacteria 1076
487 Ga0495676_0000053 3300047321 Bacteria 95693
488 Ga0495676_0010908 3300047321 Bacteria 8213
489 Ga0495683_0000013 3300047323 Bacteria 200428
490 Ga0495683_0000082 3300047323 Bacteria 94515
491 Ga0495683_0000322 3300047323 Bacteria 40105
492 Ga0495683_0000902 3300047323 Bacteria 20949
493 Ga0495683_0001877 3300047323 Bacteria 13174
494 Ga0495683_0010758 3300047323 Bacteria 4824
495 Ga0495683_0014135 3300047323 Bacteria 4159
496 Ga0495683_0045005 3300047323 Bacteria 2218
497 Ga0495683_0059574 3300047323 Bacteria 1894
498 Ga0495683_0113042 3300047323 Bacteria 1294
499 Ga0495687_000267 3300047443 Bacteria 69887
500 Ga0495677_0000391 3300047445 Bacteria 18764
501 Ga0495679_000305 3300047446 Bacteria 39514
502 Ga0495679_000401 3300047446 Bacteria 32512
503 Ga0495679_002698 3300047446 Bacteria 8863
504 Ga0495685_000857 3300047447 Bacteria 9265
505 Ga0495673_0000704 3300047469 Bacteria 32460
506 Ga0495673_0001195 3300047469 Bacteria 21704
507 Ga0495673_0001907 3300047469 Bacteria 15577
508 Ga0495673_0006264 3300047469 Bacteria 7022
509 Ga0495673_0006963 3300047469 Bacteria 6579
510 Ga0495673_0007660 3300047469 Bacteria 6166
511 Ga0495673_0008275 3300047469 Bacteria 5865
512 Ga0495673_0009234 3300047469 Bacteria 5471
513 Ga0495673_0014835 3300047469 Bacteria 4038
514 Ga0495681_0000934 3300047470 Bacteria 22514
515 Ga0495681_0001149 3300047470 Bacteria 20081
516 Ga0495681_0001209 3300047470 Bacteria 19630
517 Ga0495681_0002225 3300047470 Bacteria 13966
518 Ga0495681_0003597 3300047470 Bacteria 10788
519 Ga0495681_0004898 3300047470 Bacteria 9047
520 Ga0495681_0005109 3300047470 Bacteria 8848
521 Ga0495681_0006570 3300047470 Bacteria 7617
522 Ga0495681_0012148 3300047470 Bacteria 5074
523 Ga0495681_0014634 3300047470 Bacteria 4483
524 Ga0495681_0016871 3300047470 Bacteria 4074
525 Ga0495681_0020425 3300047470 Bacteria 3594
526 Ga0495681_0045664 3300047470 Bacteria 2094
527 Ga0495681_0110461 3300047470 Bacteria 1191
528 Ga0495686_0002081 3300047472 Bacteria 19680
529 Ga0495686_0010688 3300047472 Bacteria 6516
530 Ga0495686_0015304 3300047472 Bacteria 5244
531 Ga0495686_0069629 3300047472 Bacteria 2168
532 Ga0495593_0001146 3300047673 Bacteria 15452
533 Ga0495593_0069783 3300047673 Bacteria 1826
534 Ga0495602_0094405 3300048088 Bacteria 2472
535 Ga0495615_0005575 3300048090 Bacteria 2272
536 Ga0495626_0000230 3300048091 Bacteria 65859
537 Ga0495626_0000261 3300048091 Bacteria 60058
538 Ga0495626_0000263 3300048091 Bacteria 59779
539 Ga0495626_0000577 3300048091 Bacteria 36311
540 Ga0495626_0001223 3300048091 Bacteria 21166
541 Ga0495626_0001586 3300048091 Bacteria 17767
542 Ga0495626_0003251 3300048091 Bacteria 10513
543 Ga0496102_0000991 3300048905 Bacteria 26693
544 Ga0496102_0064371 3300048905 Bacteria 3358
545 Ga0496102_0164203 3300048905 Bacteria 2089
546 Ga0496103_0000997 3300048906 Bacteria 19928
547 Ga0496103_0052047 3300048906 Bacteria 2536
548 Ga0496104_0404797 3300048907 Bacteria 1277
549 Ga0496108_0081946 3300048911 Bacteria 2735
550 Ga0496110_0074113 3300048913 Bacteria 3022
551 Ga0496110_0080002 3300048913 Bacteria 2911
552 Ga0496110_0142968 3300048913 Bacteria 2163
553 Ga0496110_0216348 3300048913 Bacteria 1742
554 Ga0496110_0231744 3300048913 Bacteria 1680
555 Ga0496110_0290406 3300048913 Bacteria 1489
556 Ga0496114_0001183 3300048917 Bacteria 19768
557 Ga0496114_0229159 3300048917 Bacteria 1632
558 Ga0496116_0010802 3300048919 Bacteria 7617
559 Ga0496116_0019909 3300048919 Bacteria 5118
560 Ga0496116_0076686 3300048919 Bacteria 2092
561 Ga0496117_0000272 3300048920 Bacteria 96736
562 Ga0496117_0001072 3300048920 Bacteria 41510
563 Ga0496117_0005059 3300048920 Bacteria 14125
564 Ga0496117_0005414 3300048920 Bacteria 13429
565 Ga0496117_0060097 3300048920 Bacteria 2622
566 Ga0496117_0119463 3300048920 Bacteria 1623
567 Ga0496118_0000481 3300048921 Bacteria 66228
568 Ga0496118_0000891 3300048921 Bacteria 46918
569 Ga0496118_0003581 3300048921 Bacteria 19339
570 Ga0496118_0004818 3300048921 Bacteria 15738
571 Ga0496118_0011481 3300048921 Bacteria 8637
572 Ga0496118_0049861 3300048921 Bacteria 3219
573 Ga0496118_0062105 3300048921 Bacteria 2761
574 Ga0496118_0066879 3300048921 Bacteria 2621
575 Ga0496119_0136971 3300048922 Bacteria 1327
576 Ga0496121_0000179 3300048924 Bacteria 141214
577 Ga0496121_0001913 3300048924 Bacteria 33249
578 Ga0496121_0004078 3300048924 Bacteria 20060
579 Ga0496121_0066481 3300048924 Bacteria 2927
580 Ga0496121_0219750 3300048924 Bacteria 1339
581 Ga0496122_0000757 3300048925 Bacteria 62588
582 Ga0496122_0001397 3300048925 Bacteria 39198
583 Ga0496122_0001719 3300048925 Bacteria 33983
584 Ga0496122_0002240 3300048925 Bacteria 28103
585 Ga0496122_0006102 3300048925 Bacteria 14034
586 Ga0496122_0025615 3300048925 Bacteria 5116
587 Ga0496122_0044075 3300048925 Bacteria 3487
588 Ga0496123_0000376 3300048926 Bacteria 83875
589 Ga0496123_0000432 3300048926 Bacteria 75431
590 Ga0496123_0000523 3300048926 Bacteria 66280
591 Ga0496123_0005135 3300048926 Bacteria 13348
592 Ga0496123_0005292 3300048926 Bacteria 13077
593 Ga0496123_0014472 3300048926 Bacteria 6536
594 Ga0496123_0041111 3300048926 Bacteria 3209
595 Ga0496123_0078286 3300048926 Bacteria 2026
596 Ga0496124_0000035 3300048927 Bacteria 318099
597 Ga0496124_0001973 3300048927 Bacteria 28002
598 Ga0496124_0002847 3300048927 Bacteria 21864
599 Ga0496124_0019274 3300048927 Bacteria 6357
600 Ga0496124_0027809 3300048927 Bacteria 5067
601 Ga0496124_0031645 3300048927 Bacteria 4681
602 Ga0496124_0055857 3300048927 Bacteria 3334
603 Ga0496124_0057804 3300048927 Bacteria 3266
604 Ga0496124_0093868 3300048927 Bacteria 2441
605 Ga0496125_0000038 3300048928 Bacteria 328120
606 Ga0496125_0000216 3300048928 Bacteria 117897
607 Ga0496125_0003263 3300048928 Bacteria 19972
608 Ga0496125_0024504 3300048928 Bacteria 5548
609 Ga0496125_0061485 3300048928 Bacteria 3011
610 Ga0496125_0061519 3300048928 Bacteria 3010
611 Ga0496125_0123966 3300048928 Bacteria 1836
612 Ga0495678_000021 3300049459 Bacteria 239150
613 Ga0495678_000243 3300049459 Bacteria 61378
614 Ga0495678_001147 3300049459 Bacteria 22023
615 Ga0495678_004133 3300049459 Bacteria 8584
616 Ga0495678_008654 3300049459 Bacteria 5115
617 Ga0495678_011927 3300049459 Bacteria 4139
618 Ga0495678_013031 3300049459 Bacteria 3918
619 Ga0495678_014362 3300049459 Bacteria 3683
620 Ga0495678_016818 3300049459 Bacteria 3331
621 Ga0495678_030842 3300049459 Bacteria 2240
622 Ga0495678_037636 3300049459 Bacteria 1964
623 Ga0495678_049652 3300049459 Bacteria 1629
624 Ga0495682_0000111 3300049460 Bacteria 71459
625 Ga0495682_0000336 3300049460 Bacteria 34757
626 Ga0495682_0000906 3300049460 Bacteria 18195
627 Ga0495682_0003082 3300049460 Bacteria 7560
628 Ga0501038_0275732 3300049574 Bacteria 1325
629 Ga0501043_0025883 3300049579 Bacteria 4603
630 Ga0501047_0149862 3300049581 Bacteria 2209
631 Ga0501070_0032759 3300049586 Bacteria 4348
632 Ga0501073_0046342 3300049589 Bacteria 3058
633 Ga0501080_0019366 3300049742 Bacteria 6307
634 Ga0501035_0041406 3300049822 Bacteria 4159
635 Ga0501044_0026142 3300049823 Bacteria 6182
636 nmdc:mga08x19_122233_c1 3300050514 Bacteria 1746
637 nmdc:mga08x19_174724_c1 3300050514 Bacteria 1464
638 Ga0500566_0097431 3300053094 Bacteria 1617
639 Ga0500618_001338 3300053125 Bacteria 11270
640 Ga0500658_0079124 3300053134 Bacteria 1402
641 Ga0500573_0121799 3300053140 Bacteria 1451
642 Ga0500616_0002300 3300053153 Bacteria 16151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2952252522 2952254604 325
2 iso_pu_bacteria 8054929484 8054932050 325
3 iso_pu_bacteria 2510065053 2510281121 327
4 iso_pu_bacteria 2510065055 2510295772 327
5 iso_pu_bacteria 2510065058 2510309269 327
6 iso_pu_bacteria 2511231003 2511248837 327
7 iso_pu_bacteria 2511231008 2511276310 327
8 iso_pu_bacteria 2511231012 2511300464 327
9 iso_pu_bacteria 2511231018 2511338399 327
10 iso_pu_bacteria 2511231019 2511346705 327
11 iso_pu_bacteria 2511231021 2511354245 327
12 iso_pu_bacteria 2511231022 2511363095 327
13 iso_pu_bacteria 2554235132 2554815454 327
14 iso_pu_bacteria 2554235341 2555668508 327
15 iso_pu_bacteria 2599185160 2599355505 327
16 iso_pu_bacteria 2599185164 2599380611 327
17 iso_pu_bacteria 2599185165 2599387058 327
18 iso_pu_bacteria 2599185181 2599462339 327
19 iso_pu_bacteria 2599185186 2599490569 327
20 iso_pu_bacteria 2599185356 2600214961 327
21 iso_pu_bacteria 2600255283 2601623427 327
22 iso_pu_bacteria 2600255313 2601774334 327
23 iso_pu_bacteria 2606217733 2608383760 327
24 iso_pu_bacteria 2643221565 2643845150 327
25 iso_pu_bacteria 2773857672 2774132062 327
26 iso_pu_bacteria 2808606377 2808929976 327
27 iso_pu_bacteria 2808606381 2808951948 327
28 iso_pu_bacteria 2818991445 2819595410 327
29 iso_pu_bacteria 2823421272 2823425851 327
30 iso_pu_bacteria 2842711865 2842713677 327
31 iso_pu_bacteria 2860339153 2860340210 327
32 iso_pu_bacteria 2884836552 2884841400 327
33 iso_pu_bacteria 2884852848 2884856274 327
34 iso_pu_bacteria 2896154374 2896156800 327
35 iso_pu_bacteria 2917070673 2917072276 327
36 iso_pu_bacteria 2917832318 2917834882 327
37 iso_pu_bacteria 2919125081 2919128783 327
38 iso_pu_bacteria 2919456309 2919461942 327
39 iso_pu_bacteria 2919501602 2919502607 327
40 iso_pu_bacteria 2926063275 2926064280 327
41 iso_pu_bacteria 2931396565 2931399892 327
42 iso_pu_bacteria 2974298342 2974300974 327
43 iso_pu_bacteria 2984499530 2984503450 327
44 iso_pu_bacteria 2984504281 2984508069 327
45 iso_pu_bacteria 3007252601 3007255488 327
46 iso_pu_bacteria 3007315729 3007320418 327
47 iso_pu_bacteria 3007511990 3007512839 327
48 iso_pu_bacteria 3007619802 3007620575 327
49 iso_pu_bacteria 637000220 637318867 327
50 iso_pu_bacteria 8034962539 8034965187 327
51 iso_pu_bacteria 8056125926 8056130353 327
52 iso_pu_bacteria 8056177738 8056180172 327
53 3300009011 Ga0105251_10009234 Ga0105251_100092343 328
54 3300025728 Ga0207655_1020903 Ga0207655_10209032 328
55 3300046501 Ga0495607_0015614 Ga0495607_0015614_2256_3245 328
56 3300049589 Ga0501073_0046342 Ga0501073_0046342_766_1755 328
57 iso_pu_bacteria 2554235231 2555246758 328
58 iso_pu_bacteria 2675903507 2678231379 328
59 iso_pu_bacteria 2773857770 2774437176 328
60 iso_pu_bacteria 2919182534 2919182604 328
61 iso_pu_bacteria 8055878733 8055881797 328
62 3300025292 Ga0209676_1002229 Ga0209676_100222912 329
63 3300031824 Ga0307413_10021231 Ga0307413_100212313 329
64 3300037312 Ga0395899_0009127 Ga0395899_0009127_670_1662 329
65 3300037418 Ga0395900_0166574 Ga0395900_0166574_316_1308 329
66 3300038443 Ga0395901_0044824 Ga0395901_0044824_2190_3182 329
67 3300046665 Ga0495661_0020175 Ga0495661_0020175_1662_2663 329
68 3300048925 Ga0496122_0044075 Ga0496122_0044075_2366_3355 329
69 3300048926 Ga0496123_0078286 Ga0496123_0078286_247_1236 329
70 3300049574 Ga0501038_0275732 Ga0501038_0275732_216_1208 329
71 3300005985 Ga0081539_10046229 Ga0081539_100462291 330
72 3300025297 Ga0209758_1000048 Ga0209758_100004854 330
73 3300025298 Ga0209050_1010331 Ga0209050_10103312 330
74 3300025303 Ga0209051_1011189 Ga0209051_10111893 330
75 3300025304 Ga0209257_1001223 Ga0209257_100122319 330
76 3300046537 Ga0495598_0011535 Ga0495598_0011535_133_1140 330
77 3300046539 Ga0495621_0002311 Ga0495621_0002311_407_1414 330
78 3300048905 Ga0496102_0064371 Ga0496102_0064371_1828_2835 330
79 3300048906 Ga0496103_0052047 Ga0496103_0052047_1386_2393 330
80 3300048907 Ga0496104_0404797 Ga0496104_0404797_99_1106 330
81 3300048911 Ga0496108_0081946 Ga0496108_0081946_655_1662 330
82 3300048913 Ga0496110_0074113 Ga0496110_0074113_809_1816 330
83 3300048913 Ga0496110_0231744 Ga0496110_0231744_591_1598 330
84 3300048917 Ga0496114_0229159 Ga0496114_0229159_266_1273 330
85 3300049579 Ga0501043_0025883 Ga0501043_0025883_1145_2140 330
86 3300049581 Ga0501047_0149862 Ga0501047_0149862_1087_2082 330
87 3300049586 Ga0501070_0032759 Ga0501070_0032759_1084_2079 330
88 3300049742 Ga0501080_0019366 Ga0501080_0019366_1649_2644 330
89 3300049822 Ga0501035_0041406 Ga0501035_0041406_1279_2274 330
90 3300049823 Ga0501044_0026142 Ga0501044_0026142_3858_4853 330
91 3300053094 Ga0500566_0097431 Ga0500566_0097431_511_1506 330
92 3300053134 Ga0500658_0079124 Ga0500658_0079124_158_1153 330
93 3300053153 Ga0500616_0002300 Ga0500616_0002300_12277_13272 330
94 3300002704 JGI25155J39150_1000196 JGI25155J39150_10001961 331
95 3300002705 JGI25156J39149_1000283 JGI25156J39149_10002833 331
96 3300002705 JGI25156J39149_1009113 JGI25156J39149_10091132 331
97 3300002737 JGI25162J39368_1003489 JGI25162J39368_10034894 331
98 3300002738 JGI25154J39366_1000252 JGI25154J39366_100025231 331
99 3300002738 JGI25154J39366_1000261 JGI25154J39366_10002614 331
100 3300002741 JGI25157J39369_1000319 JGI25157J39369_10003193 331
101 3300003758 Ga0055532_1000136 Ga0055532_100013612 331
102 3300003761 Ga0055535_1005923 Ga0055535_10059233 331
103 3300003791 Ga0055530_10016747 Ga0055530_100167472 331
104 3300005288 Ga0065714_10006879 Ga0065714_100068793 331
105 3300005288 Ga0065714_10068176 Ga0065714_100681763 331
106 3300005288 Ga0065714_10083506 Ga0065714_100835062 331
107 3300005288 Ga0065714_10090000 Ga0065714_100900002 331
108 3300005288 Ga0065714_10119120 Ga0065714_101191202 331
109 3300005338 Ga0068868_100024080 Ga0068868_1000240804 331
110 3300005577 Ga0068857_100175589 Ga0068857_1001755892 331
111 3300006058 Ga0075432_10003685 Ga0075432_100036852 331
112 3300006058 Ga0075432_10012381 Ga0075432_100123812 331
113 3300006058 Ga0075432_10032493 Ga0075432_100324932 331
114 3300006946 Ga0079104_1000145 Ga0079104_100014549 331
115 3300009011 Ga0105251_10000114 Ga0105251_1000011423 331
116 3300009011 Ga0105251_10007117 Ga0105251_100071172 331
117 3300009036 Ga0105244_10017532 Ga0105244_100175322 331
118 3300009036 Ga0105244_10027836 Ga0105244_100278362 331
119 3300009148 Ga0105243_10051821 Ga0105243_100518212 331
120 3300009551 Ga0105238_10040887 Ga0105238_100408875 331
121 3300011119 Ga0105246_10018262 Ga0105246_100182623 331
122 3300013100 Ga0157373_10247008 Ga0157373_102470082 331
123 3300013102 Ga0157371_10000131 Ga0157371_1000013167 331
124 3300013102 Ga0157371_10000583 Ga0157371_1000058322 331
125 3300013102 Ga0157371_10006453 Ga0157371_100064537 331
126 3300013102 Ga0157371_10133985 Ga0157371_101339852 331
127 3300013104 Ga0157370_10000675 Ga0157370_100006755 331
128 3300013104 Ga0157370_10038239 Ga0157370_100382392 331
129 3300013105 Ga0157369_10002079 Ga0157369_1000207920 331
130 3300013297 Ga0157378_10136013 Ga0157378_101360131 331
131 3300013306 Ga0163162_10361274 Ga0163162_103612742 331
132 3300013307 Ga0157372_10429274 Ga0157372_104292741 331
133 3300013308 Ga0157375_10333062 Ga0157375_103330621 331
134 3300014497 Ga0182008_10000863 Ga0182008_100008635 331
135 3300014497 Ga0182008_10009128 Ga0182008_100091282 331
136 3300015265 Ga0182005_1003356 Ga0182005_10033561 331
137 3300015265 Ga0182005_1009573 Ga0182005_10095732 331
138 3300015265 Ga0182005_1028066 Ga0182005_10280662 331
139 3300017792 Ga0163161_10001364 Ga0163161_100013643 331
140 3300017792 Ga0163161_10004147 Ga0163161_100041479 331
141 3300017792 Ga0163161_10168017 Ga0163161_101680172 331
142 3300025206 Ga0209435_100018 Ga0209435_10001811 331
143 3300025206 Ga0209435_100106 Ga0209435_1001062 331
144 3300025229 Ga0209147_100051 Ga0209147_10005111 331
145 3300025233 Ga0209437_100611 Ga0209437_10061113 331
146 3300025242 Ga0209258_100324 Ga0209258_10032412 331
147 3300025246 Ga0209646_1000172 Ga0209646_100017211 331
148 3300025246 Ga0209646_1000186 Ga0209646_100018666 331
149 3300025250 Ga0209026_1000042 Ga0209026_1000042234 331
150 3300025250 Ga0209026_1001244 Ga0209026_100124412 331
151 3300025256 Ga0209759_1000273 Ga0209759_100027362 331
152 3300025256 Ga0209759_1000765 Ga0209759_100076511 331
153 3300025272 Ga0209455_1011110 Ga0209455_10111103 331
154 3300025292 Ga0209676_1002811 Ga0209676_10028114 331
155 3300025298 Ga0209050_1000593 Ga0209050_100059312 331
156 3300025728 Ga0207655_1007591 Ga0207655_10075914 331
157 3300025728 Ga0207655_1011656 Ga0207655_10116564 331
158 3300025728 Ga0207655_1035626 Ga0207655_10356262 331
159 3300025728 Ga0207655_1035906 Ga0207655_10359062 331
160 3300025735 Ga0207713_1000200 Ga0207713_100020050 331
161 3300025735 Ga0207713_1019496 Ga0207713_10194962 331
162 3300025735 Ga0207713_1034033 Ga0207713_10340332 331
163 3300025913 Ga0207695_10010174 Ga0207695_100101742 331
164 3300025924 Ga0207694_10087791 Ga0207694_100877911 331
165 3300025925 Ga0207650_10144046 Ga0207650_101440461 331
166 3300025935 Ga0207709_10021985 Ga0207709_100219853 331
167 3300025939 Ga0207665_10077118 Ga0207665_100771182 331
168 3300026142 Ga0207698_10011991 Ga0207698_100119914 331
169 3300027111 Ga0209281_1000271 Ga0209281_100027144 331
170 3300027312 Ga0209371_1000127 Ga0209371_100012727 331
171 3300027471 Ga0209995_1000919 Ga0209995_10009193 331
172 3300027665 Ga0209983_1007174 Ga0209983_10071742 331
173 3300027682 Ga0209971_1001025 Ga0209971_10010255 331
174 3300027907 Ga0207428_10004838 Ga0207428_100048387 331
175 3300027907 Ga0207428_10028722 Ga0207428_100287222 331
176 3300028786 Ga0307517_10176051 Ga0307517_101760511 331
177 3300030500 Ga0268256_1000104 Ga0268256_100010427 331
178 3300031548 Ga0307408_100000002 Ga0307408_100000002532 331
179 3300031824 Ga0307413_10061116 Ga0307413_100611162 331
180 3300032004 Ga0307414_10012356 Ga0307414_100123562 331
181 3300037471 Ga0395905_0000888 Ga0395905_0000888_27881_28879 331
182 3300041405 Ga0439438_000324 Ga0439438_000324_1615_2610 331
183 3300041405 Ga0439438_000831 Ga0439438_000831_8727_9722 331
184 3300041405 Ga0439438_002627 Ga0439438_002627_841_1836 331
185 3300041405 Ga0439438_005965 Ga0439438_005965_3148_4143 331
186 3300041407 Ga0439447_006642 Ga0439447_006642_784_1779 331
187 3300041407 Ga0439447_040847 Ga0439447_040847_110_1105 331
188 3300041411 Ga0439466_0002293 Ga0439466_0002293_5343_6338 331
189 3300041411 Ga0439466_0002437 Ga0439466_0002437_3647_4642 331
190 3300041411 Ga0439466_0007098 Ga0439466_0007098_1018_2013 331
191 3300041411 Ga0439466_0013923 Ga0439466_0013923_1487_2482 331
192 3300041411 Ga0439466_0016670 Ga0439466_0016670_632_1627 331
193 3300041411 Ga0439466_0024576 Ga0439466_0024576_941_1936 331
194 3300041411 Ga0439466_0034537 Ga0439466_0034537_249_1244 331
195 3300041452 Ga0451793_1750779 Ga0451793_1750779_240_1235 331
196 3300042006 Ga0439432_000440 Ga0439432_000440_8897_9892 331
197 3300042006 Ga0439432_042605 Ga0439432_042605_246_1241 331
198 3300042009 Ga0439451_001308 Ga0439451_001308_1045_2040 331
199 3300042010 Ga0439452_000503 Ga0439452_000503_10955_11950 331
200 3300042010 Ga0439452_000911 Ga0439452_000911_9424_10419 331
201 3300042010 Ga0439452_002403 Ga0439452_002403_2661_3656 331
202 3300042010 Ga0439452_003327 Ga0439452_003327_553_1548 331
203 3300042010 Ga0439452_003458 Ga0439452_003458_867_1862 331
204 3300042013 Ga0439456_026299 Ga0439456_026299_108_1103 331
205 3300042115 Ga0450911_001112 Ga0450911_001112_4889_5884 331
206 3300042115 Ga0450911_003098 Ga0450911_003098_1007_2002 331
207 3300042125 Ga0450923_003652 Ga0450923_003652_105_1100 331
208 3300042137 Ga0450902_000168 Ga0450902_000168_4408_5403 331
209 3300042137 Ga0450902_017276 Ga0450902_017276_142_1137 331
210 3300042138 Ga0450903_001039 Ga0450903_001039_3215_4210 331
211 3300042142 Ga0450905_000045 Ga0450905_000045_5004_5999 331
212 3300042142 Ga0450905_002010 Ga0450905_002010_1160_2155 331
213 3300042142 Ga0450905_009496 Ga0450905_009496_202_1197 331
214 3300042185 Ga0450909_000039 Ga0450909_000039_2100_3095 331
215 3300042435 Ga0439434_0006394 Ga0439434_0006394_1748_2743 331
216 3300042438 Ga0439459_0000617 Ga0439459_0000617_3181_4176 331
217 3300042439 Ga0439464_0007672 Ga0439464_0007672_29_1024 331
218 3300042461 Ga0439460_0001928 Ga0439460_0001928_1685_2680 331
219 3300042533 Ga0450901_000085 Ga0450901_000085_2340_3335 331
220 3300046452 Ga0495617_027591 Ga0495617_027591_743_1738 331
221 3300046452 Ga0495617_041659 Ga0495617_041659_234_1229 331
222 3300046453 Ga0495627_000104 Ga0495627_000104_62085_63080 331
223 3300046453 Ga0495627_000250 Ga0495627_000250_18271_19266 331
224 3300046453 Ga0495627_003239 Ga0495627_003239_3431_4426 331
225 3300046453 Ga0495627_019897 Ga0495627_019897_91_1086 331
226 3300046453 Ga0495627_022639 Ga0495627_022639_1009_2004 331
227 3300046457 Ga0495590_0000143 Ga0495590_0000143_9669_10667 331
228 3300046457 Ga0495590_0006161 Ga0495590_0006161_3269_4264 331
229 3300046457 Ga0495590_0009908 Ga0495590_0009908_837_1832 331
230 3300046458 Ga0495591_000167 Ga0495591_000167_34960_35955 331
231 3300046458 Ga0495591_000232 Ga0495591_000232_16396_17391 331
232 3300046458 Ga0495591_002372 Ga0495591_002372_1788_2783 331
233 3300046458 Ga0495591_002394 Ga0495591_002394_8039_9034 331
234 3300046458 Ga0495591_003361 Ga0495591_003361_5511_6506 331
235 3300046458 Ga0495591_004106 Ga0495591_004106_3376_4371 331
236 3300046458 Ga0495591_006840 Ga0495591_006840_2148_3143 331
237 3300046458 Ga0495591_007182 Ga0495591_007182_2307_3302 331
238 3300046458 Ga0495591_010134 Ga0495591_010134_1975_2970 331
239 3300046458 Ga0495591_021303 Ga0495591_021303_501_1496 331
240 3300046458 Ga0495591_024114 Ga0495591_024114_638_1633 331
241 3300046460 Ga0495638_0000007 Ga0495638_0000007_185892_186893 331
242 3300046460 Ga0495638_0001278 Ga0495638_0001278_4921_5916 331
243 3300046460 Ga0495638_0001733 Ga0495638_0001733_3905_4900 331
244 3300046460 Ga0495638_0002251 Ga0495638_0002251_5099_6094 331
245 3300046460 Ga0495638_0002940 Ga0495638_0002940_634_1629 331
246 3300046460 Ga0495638_0005766 Ga0495638_0005766_6338_7333 331
247 3300046460 Ga0495638_0006300 Ga0495638_0006300_3534_4529 331
248 3300046460 Ga0495638_0009186 Ga0495638_0009186_1104_2099 331
249 3300046463 Ga0495653_0148156 Ga0495653_0148156_341_1336 331
250 3300046471 Ga0495650_0000354 Ga0495650_0000354_67020_68015 331
251 3300046471 Ga0495650_0002085 Ga0495650_0002085_14539_15534 331
252 3300046471 Ga0495650_0002558 Ga0495650_0002558_4793_5788 331
253 3300046471 Ga0495650_0005873 Ga0495650_0005873_5846_6841 331
254 3300046474 Ga0495605_0000033 Ga0495605_0000033_19258_20253 331
255 3300046474 Ga0495605_0000140 Ga0495605_0000140_40634_41629 331
256 3300046474 Ga0495605_0000167 Ga0495605_0000167_56189_57184 331
257 3300046474 Ga0495605_0001630 Ga0495605_0001630_12497_13492 331
258 3300046474 Ga0495605_0003513 Ga0495605_0003513_2787_3782 331
259 3300046474 Ga0495605_0008959 Ga0495605_0008959_1495_2490 331
260 3300046474 Ga0495605_0018354 Ga0495605_0018354_2604_3599 331
261 3300046491 Ga0495584_0003484 Ga0495584_0003484_2527_3522 331
262 3300046491 Ga0495584_0004315 Ga0495584_0004315_4865_5860 331
263 3300046491 Ga0495584_0008431 Ga0495584_0008431_1292_2287 331
264 3300046491 Ga0495584_0014254 Ga0495584_0014254_650_1645 331
265 3300046492 Ga0495585_0000376 Ga0495585_0000376_16768_17763 331
266 3300046492 Ga0495585_0001401 Ga0495585_0001401_14324_15319 331
267 3300046492 Ga0495585_0005161 Ga0495585_0005161_6660_7655 331
268 3300046492 Ga0495585_0012339 Ga0495585_0012339_2798_3793 331
269 3300046492 Ga0495585_0015090 Ga0495585_0015090_1771_2766 331
270 3300046499 Ga0495594_0000853 Ga0495594_0000853_13915_14910 331
271 3300046500 Ga0495596_0000597 Ga0495596_0000597_5845_6840 331
272 3300046500 Ga0495596_0004457 Ga0495596_0004457_2797_3792 331
273 3300046501 Ga0495607_0000340 Ga0495607_0000340_29109_30104 331
274 3300046501 Ga0495607_0001373 Ga0495607_0001373_17262_18257 331
275 3300046501 Ga0495607_0001890 Ga0495607_0001890_16670_17665 331
276 3300046501 Ga0495607_0008484 Ga0495607_0008484_3345_4340 331
277 3300046501 Ga0495607_0011519 Ga0495607_0011519_3071_4066 331
278 3300046501 Ga0495607_0014827 Ga0495607_0014827_2618_3613 331
279 3300046501 Ga0495607_0020916 Ga0495607_0020916_1860_2855 331
280 3300046501 Ga0495607_0021012 Ga0495607_0021012_811_1806 331
281 3300046501 Ga0495607_0028406 Ga0495607_0028406_1615_2610 331
282 3300046501 Ga0495607_0075810 Ga0495607_0075810_169_1164 331
283 3300046506 Ga0495583_0000031 Ga0495583_0000031_234206_235201 331
284 3300046506 Ga0495583_0000040 Ga0495583_0000040_171701_172696 331
285 3300046506 Ga0495583_0001565 Ga0495583_0001565_13706_14701 331
286 3300046506 Ga0495583_0001979 Ga0495583_0001979_3431_4426 331
287 3300046506 Ga0495583_0002446 Ga0495583_0002446_11425_12420 331
288 3300046506 Ga0495583_0004591 Ga0495583_0004591_5424_6419 331
289 3300046506 Ga0495583_0024102 Ga0495583_0024102_400_1395 331
290 3300046507 Ga0495606_0000334 Ga0495606_0000334_63860_64855 331
291 3300046507 Ga0495606_0001195 Ga0495606_0001195_14202_15197 331
292 3300046507 Ga0495606_0002620 Ga0495606_0002620_7075_8070 331
293 3300046507 Ga0495606_0013461 Ga0495606_0013461_1979_2974 331
294 3300046507 Ga0495606_0079296 Ga0495606_0079296_346_1341 331
295 3300046512 Ga0495610_0001974 Ga0495610_0001974_4860_5855 331
296 3300046512 Ga0495610_0003251 Ga0495610_0003251_10514_11509 331
297 3300046512 Ga0495610_0006013 Ga0495610_0006013_2130_3125 331
298 3300046512 Ga0495610_0009589 Ga0495610_0009589_4800_5795 331
299 3300046512 Ga0495610_0010437 Ga0495610_0010437_3780_4775 331
300 3300046512 Ga0495610_0047177 Ga0495610_0047177_863_1858 331
301 3300046512 Ga0495610_0058438 Ga0495610_0058438_50_1045 331
302 3300046512 Ga0495610_0069719 Ga0495610_0069719_461_1456 331
303 3300046512 Ga0495610_0094434 Ga0495610_0094434_236_1231 331
304 3300046512 Ga0495610_0110359 Ga0495610_0110359_43_1038 331
305 3300046513 Ga0495616_0015169 Ga0495616_0015169_3151_4146 331
306 3300046513 Ga0495616_0041382 Ga0495616_0041382_430_1425 331
307 3300046515 Ga0495620_0000099 Ga0495620_0000099_18902_19897 331
308 3300046515 Ga0495620_0000727 Ga0495620_0000727_3806_4801 331
309 3300046515 Ga0495620_0002517 Ga0495620_0002517_4825_5820 331
310 3300046515 Ga0495620_0070771 Ga0495620_0070771_206_1201 331
311 3300046515 Ga0495620_0084979 Ga0495620_0084979_63_1058 331
312 3300046517 Ga0495630_0081453 Ga0495630_0081453_660_1655 331
313 3300046518 Ga0495631_0002303 Ga0495631_0002303_1679_2674 331
314 3300046518 Ga0495631_0002434 Ga0495631_0002434_1404_2399 331
315 3300046518 Ga0495631_0008156 Ga0495631_0008156_2892_3887 331
316 3300046518 Ga0495631_0021251 Ga0495631_0021251_557_1552 331
317 3300046518 Ga0495631_0022212 Ga0495631_0022212_460_1455 331
318 3300046519 Ga0495632_0003449 Ga0495632_0003449_4564_5559 331
319 3300046519 Ga0495632_0005605 Ga0495632_0005605_18_1013 331
320 3300046519 Ga0495632_0007232 Ga0495632_0007232_2168_3163 331
321 3300046519 Ga0495632_0014140 Ga0495632_0014140_2849_3844 331
322 3300046519 Ga0495632_0033121 Ga0495632_0033121_855_1850 331
323 3300046519 Ga0495632_0062718 Ga0495632_0062718_191_1186 331
324 3300046519 Ga0495632_0088481 Ga0495632_0088481_24_1019 331
325 3300046520 Ga0495637_0000059 Ga0495637_0000059_30164_31159 331
326 3300046520 Ga0495637_0000549 Ga0495637_0000549_16595_17590 331
327 3300046520 Ga0495637_0000871 Ga0495637_0000871_2849_3844 331
328 3300046520 Ga0495637_0001245 Ga0495637_0001245_5108_6103 331
329 3300046520 Ga0495637_0004597 Ga0495637_0004597_3309_4304 331
330 3300046520 Ga0495637_0005349 Ga0495637_0005349_264_1259 331
331 3300046520 Ga0495637_0007088 Ga0495637_0007088_1895_2890 331
332 3300046520 Ga0495637_0010585 Ga0495637_0010585_1962_2957 331
333 3300046520 Ga0495637_0016594 Ga0495637_0016594_535_1530 331
334 3300046520 Ga0495637_0021751 Ga0495637_0021751_537_1532 331
335 3300046522 Ga0495643_0020788 Ga0495643_0020788_277_1272 331
336 3300046522 Ga0495643_0025132 Ga0495643_0025132_2067_3062 331
337 3300046522 Ga0495643_0146382 Ga0495643_0146382_118_1113 331
338 3300046523 Ga0495644_0000483 Ga0495644_0000483_5645_6640 331
339 3300046523 Ga0495644_0000497 Ga0495644_0000497_5251_6246 331
340 3300046523 Ga0495644_0004900 Ga0495644_0004900_3282_4277 331
341 3300046523 Ga0495644_0006726 Ga0495644_0006726_3145_4140 331
342 3300046523 Ga0495644_0025903 Ga0495644_0025903_80_1075 331
343 3300046523 Ga0495644_0033901 Ga0495644_0033901_784_1779 331
344 3300046524 Ga0495648_0001662 Ga0495648_0001662_3142_4137 331
345 3300046524 Ga0495648_0001683 Ga0495648_0001683_10874_11869 331
346 3300046524 Ga0495648_0010575 Ga0495648_0010575_655_1650 331
347 3300046524 Ga0495648_0024589 Ga0495648_0024589_1121_2116 331
348 3300046524 Ga0495648_0142275 Ga0495648_0142275_123_1118 331
349 3300046525 Ga0495663_0050362 Ga0495663_0050362_28_1023 331
350 3300046526 Ga0495666_0000597 Ga0495666_0000597_3606_4601 331
351 3300046530 Ga0495654_0000877 Ga0495654_0000877_5146_6141 331
352 3300046530 Ga0495654_0001099 Ga0495654_0001099_12373_13368 331
353 3300046530 Ga0495654_0003545 Ga0495654_0003545_6703_7698 331
354 3300046530 Ga0495654_0005465 Ga0495654_0005465_2881_3876 331
355 3300046530 Ga0495654_0007771 Ga0495654_0007771_3297_4292 331
356 3300046530 Ga0495654_0013603 Ga0495654_0013603_2271_3266 331
357 3300046530 Ga0495654_0028704 Ga0495654_0028704_1547_2542 331
358 3300046530 Ga0495654_0029436 Ga0495654_0029436_365_1360 331
359 3300046530 Ga0495654_0044183 Ga0495654_0044183_60_1055 331
360 3300046530 Ga0495654_0073847 Ga0495654_0073847_513_1508 331
361 3300046536 Ga0495587_0010308 Ga0495587_0010308_1611_2606 331
362 3300046538 Ga0495609_0000018 Ga0495609_0000018_118996_119991 331
363 3300046538 Ga0495609_0000123 Ga0495609_0000123_62048_63043 331
364 3300046538 Ga0495609_0000194 Ga0495609_0000194_5788_6783 331
365 3300046538 Ga0495609_0019388 Ga0495609_0019388_1575_2570 331
366 3300046538 Ga0495609_0118190 Ga0495609_0118190_109_1104 331
367 3300046542 Ga0495597_0000066 Ga0495597_0000066_48579_49574 331
368 3300046542 Ga0495597_0003474 Ga0495597_0003474_6375_7370 331
369 3300046542 Ga0495597_0014160 Ga0495597_0014160_142_1137 331
370 3300046542 Ga0495597_0047027 Ga0495597_0047027_183_1178 331
371 3300046557 Ga0495622_0009645 Ga0495622_0009645_1994_2989 331
372 3300046557 Ga0495622_0037388 Ga0495622_0037388_649_1644 331
373 3300046557 Ga0495622_0038809 Ga0495622_0038809_450_1445 331
374 3300046558 Ga0495633_0000150 Ga0495633_0000150_17194_18189 331
375 3300046558 Ga0495633_0004584 Ga0495633_0004584_3476_4471 331
376 3300046558 Ga0495633_0094236 Ga0495633_0094236_48_1043 331
377 3300046615 Ga0495656_0010817 Ga0495656_0010817_1074_2069 331
378 3300046615 Ga0495656_0041043 Ga0495656_0041043_619_1614 331
379 3300046616 Ga0495668_0001701 Ga0495668_0001701_16047_17042 331
380 3300046616 Ga0495668_0003884 Ga0495668_0003884_9493_10491 331
381 3300046616 Ga0495668_0027078 Ga0495668_0027078_436_1431 331
382 3300046616 Ga0495668_0029803 Ga0495668_0029803_345_1340 331
383 3300046616 Ga0495668_0192922 Ga0495668_0192922_76_1071 331
384 3300046642 Ga0495634_0000967 Ga0495634_0000967_16714_17709 331
385 3300046648 Ga0495611_0002236 Ga0495611_0002236_5699_6694 331
386 3300046648 Ga0495611_0012393 Ga0495611_0012393_62_1057 331
387 3300046648 Ga0495611_0021512 Ga0495611_0021512_535_1530 331
388 3300046648 Ga0495611_0039833 Ga0495611_0039833_714_1709 331
389 3300046648 Ga0495611_0041467 Ga0495611_0041467_153_1148 331
390 3300046660 Ga0495625_0000202 Ga0495625_0000202_63521_64516 331
391 3300046660 Ga0495625_0001669 Ga0495625_0001669_23563_24558 331
392 3300046660 Ga0495625_0002757 Ga0495625_0002757_3921_4916 331
393 3300046660 Ga0495625_0003927 Ga0495625_0003927_8850_9848 331
394 3300046660 Ga0495625_0031061 Ga0495625_0031061_2839_3834 331
395 3300046660 Ga0495625_0048376 Ga0495625_0048376_94_1089 331
396 3300046663 Ga0495635_0000752 Ga0495635_0000752_16415_17410 331
397 3300046665 Ga0495661_0000016 Ga0495661_0000016_2738_3733 331
398 3300046665 Ga0495661_0000133 Ga0495661_0000133_64160_65155 331
399 3300046665 Ga0495661_0003731 Ga0495661_0003731_6698_7693 331
400 3300046665 Ga0495661_0026900 Ga0495661_0026900_2055_3050 331
401 3300046665 Ga0495661_0028312 Ga0495661_0028312_83_1078 331
402 3300046674 Ga0495588_0017415 Ga0495588_0017415_1555_2550 331
403 3300046679 Ga0495623_0001344 Ga0495623_0001344_11866_12861 331
404 3300046679 Ga0495623_0022120 Ga0495623_0022120_1528_2523 331
405 3300046689 Ga0495613_0045064 Ga0495613_0045064_919_1914 331
406 3300046691 Ga0495670_0020875 Ga0495670_0020875_1330_2325 331
407 3300046691 Ga0495670_0021422 Ga0495670_0021422_2023_3018 331
408 3300046691 Ga0495670_0025453 Ga0495670_0025453_703_1698 331
409 3300046691 Ga0495670_0029628 Ga0495670_0029628_1070_2065 331
410 3300046691 Ga0495670_0040942 Ga0495670_0040942_238_1233 331
411 3300046691 Ga0495670_0054333 Ga0495670_0054333_843_1838 331
412 3300046692 Ga0495671_0000534 Ga0495671_0000534_25903_26898 331
413 3300046692 Ga0495671_0000866 Ga0495671_0000866_19729_20724 331
414 3300046692 Ga0495671_0000908 Ga0495671_0000908_4809_5804 331
415 3300046692 Ga0495671_0004085 Ga0495671_0004085_2518_3513 331
416 3300046692 Ga0495671_0015085 Ga0495671_0015085_2453_3448 331
417 3300046692 Ga0495671_0026857 Ga0495671_0026857_1944_2939 331
418 3300046692 Ga0495671_0049837 Ga0495671_0049837_188_1183 331
419 3300046694 Ga0495649_0003039 Ga0495649_0003039_7598_8593 331
420 3300046694 Ga0495649_0014160 Ga0495649_0014160_3268_4263 331
421 3300046694 Ga0495649_0022179 Ga0495649_0022179_1070_2065 331
422 3300046694 Ga0495649_0026092 Ga0495649_0026092_390_1385 331
423 3300046694 Ga0495649_0089331 Ga0495649_0089331_625_1620 331
424 3300046794 Ga0495589_0000777 Ga0495589_0000777_4776_5771 331
425 3300046794 Ga0495589_0005031 Ga0495589_0005031_557_1552 331
426 3300046794 Ga0495589_0012693 Ga0495589_0012693_2731_3726 331
427 3300046794 Ga0495589_0015050 Ga0495589_0015050_2826_3821 331
428 3300046794 Ga0495589_0030802 Ga0495589_0030802_249_1244 331
429 3300046809 Ga0495600_0159173 Ga0495600_0159173_450_1445 331
430 3300046810 Ga0495660_0001112 Ga0495660_0001112_7041_8036 331
431 3300046810 Ga0495660_0001176 Ga0495660_0001176_85_1080 331
432 3300046810 Ga0495660_0002171 Ga0495660_0002171_561_1556 331
433 3300046810 Ga0495660_0015582 Ga0495660_0015582_11_1006 331
434 3300046810 Ga0495660_0017574 Ga0495660_0017574_105_1100 331
435 3300046810 Ga0495660_0018095 Ga0495660_0018095_153_1148 331
436 3300046810 Ga0495660_0029196 Ga0495660_0029196_1749_2744 331
437 3300046810 Ga0495660_0029606 Ga0495660_0029606_1708_2703 331
438 3300046810 Ga0495660_0054407 Ga0495660_0054407_1162_2157 331
439 3300046810 Ga0495660_0059066 Ga0495660_0059066_15_1010 331
440 3300046810 Ga0495660_0087624 Ga0495660_0087624_197_1192 331
441 3300047317 Ga0495604_0020525 Ga0495604_0020525_223_1218 331
442 3300047317 Ga0495604_0027922 Ga0495604_0027922_912_1907 331
443 3300047319 Ga0495674_0011531 Ga0495674_0011531_3711_4706 331
444 3300047320 Ga0495672_0001238 Ga0495672_0001238_19841_20836 331
445 3300047320 Ga0495672_0001807 Ga0495672_0001807_14252_15247 331
446 3300047320 Ga0495672_0002756 Ga0495672_0002756_1583_2578 331
447 3300047320 Ga0495672_0004755 Ga0495672_0004755_2893_3888 331
448 3300047320 Ga0495672_0007231 Ga0495672_0007231_2239_3234 331
449 3300047320 Ga0495672_0047147 Ga0495672_0047147_1282_2277 331
450 3300047320 Ga0495672_0107302 Ga0495672_0107302_92_1087 331
451 3300047320 Ga0495672_0178767 Ga0495672_0178767_38_1033 331
452 3300047321 Ga0495676_0000053 Ga0495676_0000053_64521_65516 331
453 3300047323 Ga0495683_0000082 Ga0495683_0000082_74618_75613 331
454 3300047323 Ga0495683_0000902 Ga0495683_0000902_5341_6336 331
455 3300047323 Ga0495683_0001877 Ga0495683_0001877_2083_3078 331
456 3300047323 Ga0495683_0014135 Ga0495683_0014135_2341_3336 331
457 3300047323 Ga0495683_0045005 Ga0495683_0045005_1054_2049 331
458 3300047323 Ga0495683_0059574 Ga0495683_0059574_436_1431 331
459 3300047323 Ga0495683_0113042 Ga0495683_0113042_169_1164 331
460 3300047443 Ga0495687_000267 Ga0495687_000267_22403_23398 331
461 3300047446 Ga0495679_000305 Ga0495679_000305_19068_20063 331
462 3300047446 Ga0495679_000401 Ga0495679_000401_1524_2519 331
463 3300047469 Ga0495673_0001195 Ga0495673_0001195_2834_3829 331
464 3300047469 Ga0495673_0001907 Ga0495673_0001907_4501_5496 331
465 3300047469 Ga0495673_0006264 Ga0495673_0006264_3265_4260 331
466 3300047469 Ga0495673_0006963 Ga0495673_0006963_5118_6113 331
467 3300047469 Ga0495673_0007660 Ga0495673_0007660_2638_3633 331
468 3300047469 Ga0495673_0008275 Ga0495673_0008275_134_1129 331
469 3300047469 Ga0495673_0009234 Ga0495673_0009234_2073_3068 331
470 3300047469 Ga0495673_0014835 Ga0495673_0014835_1430_2425 331
471 3300047470 Ga0495681_0000934 Ga0495681_0000934_9877_10872 331
472 3300047470 Ga0495681_0001149 Ga0495681_0001149_15796_16791 331
473 3300047470 Ga0495681_0001209 Ga0495681_0001209_11263_12258 331
474 3300047470 Ga0495681_0002225 Ga0495681_0002225_4797_5792 331
475 3300047470 Ga0495681_0003597 Ga0495681_0003597_260_1255 331
476 3300047470 Ga0495681_0004898 Ga0495681_0004898_4691_5686 331
477 3300047470 Ga0495681_0005109 Ga0495681_0005109_3759_4754 331
478 3300047470 Ga0495681_0012148 Ga0495681_0012148_1122_2117 331
479 3300047470 Ga0495681_0014634 Ga0495681_0014634_629_1624 331
480 3300047470 Ga0495681_0016871 Ga0495681_0016871_1674_2669 331
481 3300047470 Ga0495681_0045664 Ga0495681_0045664_616_1611 331
482 3300047470 Ga0495681_0110461 Ga0495681_0110461_117_1112 331
483 3300047472 Ga0495686_0002081 Ga0495686_0002081_4715_5710 331
484 3300047472 Ga0495686_0010688 Ga0495686_0010688_3996_4991 331
485 3300047472 Ga0495686_0069629 Ga0495686_0069629_752_1747 331
486 3300047673 Ga0495593_0001146 Ga0495593_0001146_11291_12286 331
487 3300047673 Ga0495593_0069783 Ga0495593_0069783_413_1408 331
488 3300048088 Ga0495602_0094405 Ga0495602_0094405_883_1878 331
489 3300048090 Ga0495615_0005575 Ga0495615_0005575_785_1780 331
490 3300048091 Ga0495626_0000261 Ga0495626_0000261_24536_25531 331
491 3300048091 Ga0495626_0000263 Ga0495626_0000263_42955_43950 331
492 3300048091 Ga0495626_0000577 Ga0495626_0000577_19528_20523 331
493 3300048091 Ga0495626_0001223 Ga0495626_0001223_14371_15366 331
494 3300048091 Ga0495626_0003251 Ga0495626_0003251_9136_10134 331
495 3300048905 Ga0496102_0000991 Ga0496102_0000991_16412_17407 331
496 3300048905 Ga0496102_0164203 Ga0496102_0164203_298_1293 331
497 3300048906 Ga0496103_0000997 Ga0496103_0000997_15537_16532 331
498 3300048913 Ga0496110_0080002 Ga0496110_0080002_779_1774 331
499 3300048913 Ga0496110_0142968 Ga0496110_0142968_177_1172 331
500 3300048913 Ga0496110_0290406 Ga0496110_0290406_169_1164 331
501 3300048919 Ga0496116_0019909 Ga0496116_0019909_621_1616 331
502 3300048919 Ga0496116_0076686 Ga0496116_0076686_346_1434 331
503 3300048920 Ga0496117_0001072 Ga0496117_0001072_27971_28966 331
504 3300048920 Ga0496117_0005059 Ga0496117_0005059_9690_10685 331
505 3300048920 Ga0496117_0060097 Ga0496117_0060097_911_1906 331
506 3300048920 Ga0496117_0119463 Ga0496117_0119463_447_1442 331
507 3300048921 Ga0496118_0000481 Ga0496118_0000481_27850_28845 331
508 3300048921 Ga0496118_0004818 Ga0496118_0004818_3257_4252 331
509 3300048921 Ga0496118_0011481 Ga0496118_0011481_1871_2866 331
510 3300048921 Ga0496118_0049861 Ga0496118_0049861_1524_2519 331
511 3300048921 Ga0496118_0062105 Ga0496118_0062105_784_1779 331
512 3300048921 Ga0496118_0066879 Ga0496118_0066879_1574_2569 331
513 3300048922 Ga0496119_0136971 Ga0496119_0136971_200_1195 331
514 3300048924 Ga0496121_0000179 Ga0496121_0000179_10749_11744 331
515 3300048924 Ga0496121_0001913 Ga0496121_0001913_14578_15573 331
516 3300048924 Ga0496121_0004078 Ga0496121_0004078_17598_18593 331
517 3300048924 Ga0496121_0219750 Ga0496121_0219750_213_1301 331
518 3300048925 Ga0496122_0000757 Ga0496122_0000757_1523_2611 331
519 3300048925 Ga0496122_0001397 Ga0496122_0001397_24896_25891 331
520 3300048925 Ga0496122_0001719 Ga0496122_0001719_16069_17064 331
521 3300048925 Ga0496122_0006102 Ga0496122_0006102_7350_8345 331
522 3300048925 Ga0496122_0025615 Ga0496122_0025615_1118_2113 331
523 3300048926 Ga0496123_0000376 Ga0496123_0000376_57840_58835 331
524 3300048926 Ga0496123_0000432 Ga0496123_0000432_24894_25889 331
525 3300048926 Ga0496123_0000523 Ga0496123_0000523_63163_64251 331
526 3300048926 Ga0496123_0005135 Ga0496123_0005135_6681_7676 331
527 3300048926 Ga0496123_0014472 Ga0496123_0014472_3683_4678 331
528 3300048926 Ga0496123_0041111 Ga0496123_0041111_93_1088 331
529 3300048927 Ga0496124_0001973 Ga0496124_0001973_21645_22640 331
530 3300048927 Ga0496124_0002847 Ga0496124_0002847_3405_4400 331
531 3300048927 Ga0496124_0027809 Ga0496124_0027809_452_1447 331
532 3300048927 Ga0496124_0057804 Ga0496124_0057804_1310_2305 331
533 3300048928 Ga0496125_0000216 Ga0496125_0000216_25097_26092 331
534 3300048928 Ga0496125_0003263 Ga0496125_0003263_17209_18312 331
535 3300048928 Ga0496125_0061485 Ga0496125_0061485_535_1623 331
536 3300048928 Ga0496125_0061519 Ga0496125_0061519_316_1311 331
537 3300048928 Ga0496125_0123966 Ga0496125_0123966_780_1775 331
538 3300049459 Ga0495678_000021 Ga0495678_000021_18893_19888 331
539 3300049459 Ga0495678_000243 Ga0495678_000243_7615_8610 331
540 3300049459 Ga0495678_001147 Ga0495678_001147_11488_12486 331
541 3300049459 Ga0495678_004133 Ga0495678_004133_3009_4004 331
542 3300049459 Ga0495678_011927 Ga0495678_011927_1509_2504 331
543 3300049459 Ga0495678_013031 Ga0495678_013031_1155_2150 331
544 3300049459 Ga0495678_014362 Ga0495678_014362_434_1429 331
545 3300049459 Ga0495678_016818 Ga0495678_016818_552_1547 331
546 3300049460 Ga0495682_0000111 Ga0495682_0000111_43162_44157 331
547 3300049460 Ga0495682_0000336 Ga0495682_0000336_21172_22167 331
548 3300049460 Ga0495682_0003082 Ga0495682_0003082_2850_3845 331
549 3300050514 nmdc:mga08x19_122233_c1 nmdc:mga08x19_122233_c1_650_1645 331
550 3300050514 nmdc:mga08x19_174724_c1 nmdc:mga08x19_174724_c1_203_1198 331
551 3300053140 Ga0500573_0121799 Ga0500573_0121799_35_1030 331
552 2162886007 SwRhRL2b_contig_493770 SwRhRL2b_0023.00003140 332
553 3300005289 Ga0065704_10077534 Ga0065704_100775342 332
554 3300005289 Ga0065704_10077768 Ga0065704_100777682 332
555 3300009011 Ga0105251_10000106 Ga0105251_1000010665 332
556 3300009036 Ga0105244_10001696 Ga0105244_100016969 332
557 3300009036 Ga0105244_10007542 Ga0105244_100075423 332
558 3300009036 Ga0105244_10024687 Ga0105244_100246872 332
559 3300009092 Ga0105250_10025832 Ga0105250_100258322 332
560 3300009101 Ga0105247_10000054 Ga0105247_1000005418 332
561 3300009148 Ga0105243_10107248 Ga0105243_101072482 332
562 3300017792 Ga0163161_10081340 Ga0163161_100813401 332
563 3300025711 Ga0207696_1000006 Ga0207696_100000678 332
564 3300025711 Ga0207696_1009191 Ga0207696_10091914 332
565 3300025728 Ga0207655_1000077 Ga0207655_1000077107 332
566 3300025728 Ga0207655_1005361 Ga0207655_10053615 332
567 3300025728 Ga0207655_1011146 Ga0207655_10111464 332
568 3300025735 Ga0207713_1000159 Ga0207713_100015913 332
569 3300025735 Ga0207713_1002310 Ga0207713_100231011 332
570 3300025735 Ga0207713_1034985 Ga0207713_10349851 332
571 3300025900 Ga0207710_10000123 Ga0207710_1000012317 332
572 3300025935 Ga0207709_10011017 Ga0207709_100110171 332
573 3300025935 Ga0207709_10038036 Ga0207709_100380362 332
574 3300046453 Ga0495627_000667 Ga0495627_000667_5886_6884 332
575 3300046455 Ga0495603_0004673 Ga0495603_0004673_2490_3488 332
576 3300046492 Ga0495585_0000958 Ga0495585_0000958_12278_13276 332
577 3300046501 Ga0495607_0020691 Ga0495607_0020691_3090_4088 332
578 3300046506 Ga0495583_0000086 Ga0495583_0000086_79664_80662 332
579 3300046513 Ga0495616_0016241 Ga0495616_0016241_428_1426 332
580 3300046515 Ga0495620_0000006 Ga0495620_0000006_80419_81417 332
581 3300046519 Ga0495632_0000074 Ga0495632_0000074_31162_32160 332
582 3300046522 Ga0495643_0000029 Ga0495643_0000029_176776_177774 332
583 3300046522 Ga0495643_0000484 Ga0495643_0000484_21517_22515 332
584 3300046524 Ga0495648_0000126 Ga0495648_0000126_46817_47815 332
585 3300046525 Ga0495663_0000484 Ga0495663_0000484_5904_6902 332
586 3300046530 Ga0495654_0000117 Ga0495654_0000117_26534_27532 332
587 3300046538 Ga0495609_0017431 Ga0495609_0017431_1083_2081 332
588 3300046665 Ga0495661_0000007 Ga0495661_0000007_354919_355917 332
589 3300046692 Ga0495671_0011911 Ga0495671_0011911_2436_3434 332
590 3300046692 Ga0495671_0036475 Ga0495671_0036475_1218_2216 332
591 3300046694 Ga0495649_0000021 Ga0495649_0000021_51337_52335 332
592 3300047321 Ga0495676_0010908 Ga0495676_0010908_3266_4264 332
593 3300047323 Ga0495683_0000013 Ga0495683_0000013_167373_168371 332
594 3300048917 Ga0496114_0001183 Ga0496114_0001183_1256_2254 332
595 3300048919 Ga0496116_0010802 Ga0496116_0010802_5204_6202 332
596 3300048920 Ga0496117_0000272 Ga0496117_0000272_88758_89756 332
597 3300048920 Ga0496117_0005414 Ga0496117_0005414_1200_2198 332
598 3300048921 Ga0496118_0003581 Ga0496118_0003581_1087_2085 332
599 3300048925 Ga0496122_0002240 Ga0496122_0002240_16659_17657 332
600 3300048926 Ga0496123_0005292 Ga0496123_0005292_3437_4435 332
601 3300048927 Ga0496124_0000035 Ga0496124_0000035_202751_203749 332
602 3300048927 Ga0496124_0019274 Ga0496124_0019274_1255_2253 332
603 3300048927 Ga0496124_0031645 Ga0496124_0031645_2533_3531 332
604 3300049459 Ga0495678_030842 Ga0495678_030842_438_1436 332
605 3300049459 Ga0495678_037636 Ga0495678_037636_166_1164 332
606 3300053125 Ga0500618_001338 Ga0500618_001338_9128_10126 332
607 3300044658 Ga0466972_0079308 Ga0466972_0079308_139_1170 333
608 3300044765 Ga0466970_0054731 Ga0466970_0054731_464_1495 333
609 3300044901 Ga0466960_0010487 Ga0466960_0010487_2346_3377 333
610 3300042533 Ga0450901_000633 Ga0450901_000633_2343_3350 335
611 iso_pu_bacteria 2511231026 2511386015 336
612 3300046665 Ga0495661_0037367 Ga0495661_0037367_245_1381 338
613 3300014497 Ga0182008_10098227 Ga0182008_100982272 339
614 3300017792 Ga0163161_10019833 Ga0163161_100198334 339
615 3300039447 Ga0436361_0591059 Ga0436361_0591059_1943_2971 339
616 3300046458 Ga0495591_008762 Ga0495591_008762_1354_2394 339
617 3300046458 Ga0495591_010247 Ga0495591_010247_571_1641 339
618 3300046471 Ga0495650_0003013 Ga0495650_0003013_11475_12515 339
619 3300046471 Ga0495650_0003106 Ga0495650_0003106_8789_9859 339
620 3300046474 Ga0495605_0023904 Ga0495605_0023904_1453_2493 339
621 3300046474 Ga0495605_0025919 Ga0495605_0025919_195_1265 339
622 3300046491 Ga0495584_0000733 Ga0495584_0000733_16570_17601 339
623 3300046491 Ga0495584_0045907 Ga0495584_0045907_1107_2147 339
624 3300046492 Ga0495585_0078505 Ga0495585_0078505_520_1560 339
625 3300046501 Ga0495607_0006927 Ga0495607_0006927_1254_2324 339
626 3300046501 Ga0495607_0015462 Ga0495607_0015462_1616_2656 339
627 3300046506 Ga0495583_0003785 Ga0495583_0003785_674_1705 339
628 3300046507 Ga0495606_0009230 Ga0495606_0009230_3186_4226 339
629 3300046507 Ga0495606_0036071 Ga0495606_0036071_83_1153 339
630 3300046512 Ga0495610_0027105 Ga0495610_0027105_179_1249 339
631 3300046513 Ga0495616_0100448 Ga0495616_0100448_57_1097 339
632 3300046515 Ga0495620_0001709 Ga0495620_0001709_7069_8139 339
633 3300046515 Ga0495620_0019020 Ga0495620_0019020_906_1946 339
634 3300046518 Ga0495631_0001975 Ga0495631_0001975_9508_10548 339
635 3300046522 Ga0495643_0065704 Ga0495643_0065704_293_1363 339
636 3300046524 Ga0495648_0048367 Ga0495648_0048367_1180_2250 339
637 3300046524 Ga0495648_0059135 Ga0495648_0059135_1150_2220 339
638 3300046530 Ga0495654_0024468 Ga0495654_0024468_675_1745 339
639 3300046530 Ga0495654_0030232 Ga0495654_0030232_396_1436 339
640 3300046660 Ga0495625_0018771 Ga0495625_0018771_1469_2509 339
641 3300046665 Ga0495661_0012890 Ga0495661_0012890_3982_5022 339
642 3300046691 Ga0495670_0022375 Ga0495670_0022375_1378_2448 339
643 3300046694 Ga0495649_0014597 Ga0495649_0014597_2879_3919 339
644 3300046794 Ga0495589_0014506 Ga0495589_0014506_1556_2596 339
645 3300046810 Ga0495660_0010697 Ga0495660_0010697_2955_4025 339
646 3300046810 Ga0495660_0016636 Ga0495660_0016636_1467_2498 339
647 3300047323 Ga0495683_0000322 Ga0495683_0000322_34265_35305 339
648 3300047446 Ga0495679_002698 Ga0495679_002698_1763_2833 339
649 3300047469 Ga0495673_0000704 Ga0495673_0000704_15905_16936 339
650 3300047470 Ga0495681_0006570 Ga0495681_0006570_2855_3886 339
651 3300047470 Ga0495681_0020425 Ga0495681_0020425_2442_3512 339
652 3300048091 Ga0495626_0000230 Ga0495626_0000230_43248_44318 339
653 3300048924 Ga0496121_0066481 Ga0496121_0066481_1424_2464 339
654 3300048927 Ga0496124_0055857 Ga0496124_0055857_1468_2508 339
655 3300048928 Ga0496125_0024504 Ga0496125_0024504_3137_4177 339
656 3300049459 Ga0495678_049652 Ga0495678_049652_304_1335 339
657 3300046524 Ga0495648_0001868 Ga0495648_0001868_15853_16905 340
658 3300047472 Ga0495686_0015304 Ga0495686_0015304_2495_3547 341
659 3300046452 Ga0495617_001498 Ga0495617_001498_6588_7619 342
660 3300046457 Ga0495590_0007272 Ga0495590_0007272_2388_3419 342
661 3300046460 Ga0495638_0048991 Ga0495638_0048991_1273_2304 342
662 3300046471 Ga0495650_0001850 Ga0495650_0001850_2632_3663 342
663 3300046474 Ga0495605_0001070 Ga0495605_0001070_2367_3398 342
664 3300046491 Ga0495584_0007418 Ga0495584_0007418_1010_2041 342
665 3300046492 Ga0495585_0001334 Ga0495585_0001334_15946_16977 342
666 3300046501 Ga0495607_0002954 Ga0495607_0002954_2597_3628 342
667 3300046506 Ga0495583_0002064 Ga0495583_0002064_2187_3218 342
668 3300046513 Ga0495616_0008681 Ga0495616_0008681_2370_3401 342
669 3300046518 Ga0495631_0005888 Ga0495631_0005888_2599_3630 342
670 3300046519 Ga0495632_0001508 Ga0495632_0001508_2626_3657 342
671 3300046520 Ga0495637_0002366 Ga0495637_0002366_2492_3523 342
672 3300046523 Ga0495644_0010235 Ga0495644_0010235_2530_3561 342
673 3300046538 Ga0495609_0001033 Ga0495609_0001033_2587_3618 342
674 3300046615 Ga0495656_0002512 Ga0495656_0002512_1415_2446 342
675 3300046648 Ga0495611_0022541 Ga0495611_0022541_249_1280 342
676 3300046660 Ga0495625_0029963 Ga0495625_0029963_446_1477 342
677 3300046665 Ga0495661_0025621 Ga0495661_0025621_2168_3199 342
678 3300046684 Ga0495669_0001634 Ga0495669_0001634_2631_3662 342
679 3300046691 Ga0495670_0000517 Ga0495670_0000517_14651_15682 342
680 3300046694 Ga0495649_0026904 Ga0495649_0026904_1915_2946 342
681 3300046794 Ga0495589_0000880 Ga0495589_0000880_2411_3442 342
682 3300047323 Ga0495683_0010758 Ga0495683_0010758_1535_2566 342
683 3300047445 Ga0495677_0000391 Ga0495677_0000391_2631_3662 342
684 3300047447 Ga0495685_000857 Ga0495685_000857_2381_3412 342
685 3300048091 Ga0495626_0001586 Ga0495626_0001586_2459_3490 342
686 3300049459 Ga0495678_008654 Ga0495678_008654_1826_2857 342
687 3300049460 Ga0495682_0000906 Ga0495682_0000906_14578_15609 342
688 3300037466 Ga0395898_0069113 Ga0395898_0069113_1617_2648 343
689 3300046506 Ga0495583_0001252 Ga0495583_0001252_22284_23498 343
690 3300046507 Ga0495606_0000313 Ga0495606_0000313_56074_57276 343
691 3300046501 Ga0495607_0000703 Ga0495607_0000703_2181_3230 344
692 2162886007 SwRhRL2b_contig_137913 SwRhRL2b_0905.00005110 345
693 2162886007 SwRhRL2b_contig_3254133 SwRhRL2b_0668.00006730 345
694 3300009036 Ga0105244_10005743 Ga0105244_100057432 345
695 3300046463 Ga0495653_0000338 Ga0495653_0000338_6434_7495 345
696 3300046507 Ga0495606_0000909 Ga0495606_0000909_30141_31202 345
697 3300048913 Ga0496110_0216348 Ga0496110_0216348_661_1698 345
698 3300048921 Ga0496118_0000891 Ga0496118_0000891_3753_4790 345
699 3300048927 Ga0496124_0093868 Ga0496124_0093868_1302_2339 345
700 3300048928 Ga0496125_0000038 Ga0496125_0000038_238049_239086 345

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.76 14 335
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.7588 14 335
2q19-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase apo form 0.7585 14 335
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7575 14 335
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.7564 14 335
ID Description Score Start End Superfamily
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7512 92 335 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7445 92 335 3.90.850.10
af_A0A1D6J3D9_373_520_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6956 181 203 3.30.470.20
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.6952 97 333 3.90.850.10
af_Q38970_1_673_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6952 181 203 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A4Q6FZ00-F1-model_v4 deleted 0.9418 16 83
AF-A0A527XGZ6-F1-model_v4 GguC protein 0.9368 237 312
AF-A0A317I7K1-F1-model_v4 FAH family protein 0.9364 149 333 GO:0003824
AF-A0A5F0LK97-F1-model_v4 FAH family protein 0.936 14 85
AF-A0A529I2C9-F1-model_v4 GguC protein 0.9357 221 345 GO:0003824

Feature Viewer

pLDDT pTM Quality
83.6 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map