F476128

General Info

Members Datasets Scaffolds Average Seq Length
700 505 475 426

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237098|2513675091
Length 477
Sequence FSHKGRREGRGPYIFLRNHRDKFNFPANRPHAIAPIKKKLAETSNMTTSEPSKAMEVAEIHDTSLLAFYRDMNLQERRTFWACASGWALDGMDFMIYPLVIGTIITLWKVDAGTAGLAGTVTLLSSAIGGWLGGYLADRIGRVRTLQLTILWFSFFSLVCAVAQNFDQLLIARAILGLGFGGEWAAGAVLMGEAIRPQYRGRAVGSVQSGWAVGWGLAVLAQAILFSILPAEIAWRWMFVIGALPALLVFYLRRYVTEPEIAAATREKQQAAGDRPSLWEIFHGPILKTTILASLAATGCQGGYYAITFWVPRFLTTERHLSIVTSTGYLAALIIGSFIGYLVGAWLADRIGRRNLFLTFSLGAIAVVLVYTQVEISNELLWVLGFPLGFFASGYFSGMGAFLTELYPTRLRGSGQGFCYNFGRGIGALFPFLVGALSTTTSLANAIAIFAVAAYAVFFLAAYALPETRGRVLHAEG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231022 Pseudomonas sp. GM79 Isolate Nodule
8 2511231024 Pseudomonas sp. GM84 Isolate Nodule
9 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
29 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
32 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
33 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
34 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
35 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
36 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
37 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
38 2773857670 Pseudomonas sp. 478 Isolate Unclassified
39 2784132072 Pseudomonas sp. 460 Isolate Unclassified
40 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
41 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
42 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
43 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
44 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
45 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
46 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
47 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
48 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
49 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
50 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
51 2818991450 Burkholderia sp. 604 Isolate Unclassified
52 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
53 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
54 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
55 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
56 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
57 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
58 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
59 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
60 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
61 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
62 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
63 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
64 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
65 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
69 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
70 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
80 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
83 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
84 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
85 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
86 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
87 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
88 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
89 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
90 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
91 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
92 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
93 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
94 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
95 2902330777 Methylobacterium sp. 2A Isolate Unclassified
96 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
97 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
98 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
101 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
102 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
106 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
107 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
108 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
109 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
110 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
111 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
112 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
113 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
114 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
115 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
116 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
117 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
118 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
119 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
120 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
121 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
122 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
123 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
124 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
125 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
126 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
127 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
128 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
129 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
130 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
131 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
132 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
133 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
134 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
135 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
136 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
137 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
138 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
139 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
140 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
141 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
142 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
143 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
144 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
145 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
146 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
147 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
148 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
149 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
154 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
155 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
156 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
157 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
158 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
159 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
160 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
161 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
162 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
163 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
164 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
165 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
166 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
167 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
168 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
169 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
170 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
171 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
172 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
173 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
174 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
175 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
176 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
177 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
178 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
179 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
180 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
181 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
182 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
183 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
184 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
185 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
186 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
187 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
188 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
189 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
190 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
191 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
192 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
193 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
194 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
195 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
198 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
199 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
200 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
201 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
202 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
205 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
206 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
207 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
208 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
209 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
210 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
211 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
212 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
213 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
214 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
215 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
217 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
218 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
219 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
220 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
221 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
222 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
223 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
224 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
225 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
226 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
227 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
228 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
229 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
230 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
231 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
232 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
233 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
234 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
235 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
236 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
237 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
238 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
239 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
240 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
241 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
242 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
243 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
244 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
245 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
246 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
247 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
248 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
252 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
255 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
256 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
259 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
261 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
262 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
293 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
294 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
295 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
296 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
297 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
298 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
299 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
301 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
302 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
303 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
306 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
307 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
308 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
309 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
310 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
311 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
314 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
315 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
319 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
320 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
321 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
322 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
323 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
324 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
325 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
326 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
332 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
333 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
334 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
335 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
336 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
337 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
350 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
351 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
352 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
353 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
354 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
357 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
360 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
366 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
389 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
390 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
391 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
392 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
393 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
394 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
395 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
396 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
397 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
398 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
399 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
400 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
418 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
423 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
424 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
425 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
428 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
433 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
434 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
435 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
438 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
439 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
440 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
441 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
442 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
443 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
444 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
445 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
446 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
447 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
448 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
449 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
452 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
455 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
456 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
457 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
458 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
459 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
460 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
461 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
462 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
463 641522639 Methylobacterium sp. 4-46 Isolate Nodule
464 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
465 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
466 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
467 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
468 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
469 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
470 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
471 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
472 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
473 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
474 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
475 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
476 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
477 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
478 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
479 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
480 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
481 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
482 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
483 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
484 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
485 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
486 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
487 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
488 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
489 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
490 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
491 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
492 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
493 8052494512 Pseudomonas putida LD6 Isolate Unclassified
494 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
495 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
496 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
497 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
498 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
499 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
500 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
501 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
502 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
503 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
504 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
505 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.1
Metatranscriptomes 0.14
Isolates 31.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 21.14
Rhizoplane 5.29
Rhizosphere 43.14
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010583 3300001979 Bacteria 3544
2 JGI24739J22299_10011334 3300001989 Bacteria 3293
3 JGI24739J22299_10015113 3300001989 Bacteria 2806
4 JGI24735J21928_10001300 3300002067 Bacteria 8849
5 JGI24735J21928_10004466 3300002067 Bacteria 4702
6 JGI25156J39149_1000818 3300002705 Bacteria 15851
7 JGI25156J39149_1003696 3300002705 Bacteria 4904
8 JGI25151J46595_10000164 3300003187 Bacteria 85682
9 JGI25165J46597_1001442 3300003214 Bacteria 12650
10 JGI25153J46596_10008743 3300003215 Bacteria 4798
11 JGI25160J50197_1001638 3300003354 Bacteria 10988
12 JGI25160J50197_1006481 3300003354 Bacteria 4730
13 JGI25160J50197_1006563 3300003354 Bacteria 4689
14 Ga0055539_1001505 3300003752 Bacteria 4276
15 Ga0055533_1000091 3300003756 Bacteria 120504
16 Ga0055533_1001086 3300003756 Bacteria 7797
17 Ga0065165_1003030 3300005262 Bacteria 12651
18 Ga0065165_1013353 3300005262 Bacteria 3272
19 Ga0065704_10092281 3300005289 Bacteria 2664
20 Ga0070658_10003071 3300005327 Bacteria 13779
21 Ga0070658_10021552 3300005327 Bacteria 5164
22 Ga0070658_10140961 3300005327 Bacteria 2014
23 Ga0070683_100024865 3300005329 Bacteria 5370
24 Ga0070680_100161931 3300005336 Bacteria 1880
25 Ga0070682_100085173 3300005337 Bacteria 2056
26 Ga0068868_100135810 3300005338 Bacteria 2016
27 Ga0070660_100001445 3300005339 Bacteria 16232
28 Ga0070661_100066102 3300005344 Bacteria 2657
29 Ga0070671_100233971 3300005355 Bacteria 1559
30 Ga0070659_100029202 3300005366 Bacteria 4261
31 Ga0070667_100014967 3300005367 Bacteria 6408
32 Ga0070667_100019760 3300005367 Bacteria 5589
33 Ga0070714_100062995 3300005435 Bacteria 3187
34 Ga0070710_10002720 3300005437 Bacteria 8411
35 Ga0070710_10051362 3300005437 Bacteria 2314
36 Ga0070711_100011167 3300005439 Bacteria 5570
37 Ga0070711_100011297 3300005439 Bacteria 5541
38 Ga0070711_100014219 3300005439 Bacteria 5012
39 Ga0070663_100117605 3300005455 Bacteria 2004
40 Ga0070681_10096508 3300005458 Bacteria 2904
41 Ga0070707_100137078 3300005468 Bacteria 2381
42 Ga0070698_100025240 3300005471 Bacteria 6192
43 Ga0070679_100070910 3300005530 Bacteria 3475
44 Ga0070684_100038231 3300005535 Bacteria 4121
45 Ga0070697_100125926 3300005536 Bacteria 2146
46 Ga0070665_100015751 3300005548 Bacteria 7596
47 Ga0068855_100009982 3300005563 Bacteria 11442
48 Ga0068855_100013142 3300005563 Bacteria 9985
49 Ga0068855_100015639 3300005563 Bacteria 9129
50 Ga0068855_100081086 3300005563 Bacteria 3762
51 Ga0068855_100141958 3300005563 Bacteria 2736
52 Ga0068861_100190632 3300005719 Bacteria 1713
53 Ga0081455_10263653 3300005937 Bacteria 1254
54 Ga0081540_1004294 3300005983 Bacteria 10918
55 Ga0081540_1028192 3300005983 Bacteria 3160
56 Ga0070717_10002236 3300006028 Bacteria 13563
57 Ga0070715_10007836 3300006163 Bacteria 3693
58 Ga0070712_100011675 3300006175 Bacteria 5579
59 Ga0075367_10024122 3300006178 Bacteria 3430
60 Ga0075369_10009131 3300006186 Bacteria 3842
61 Ga0075366_10014497 3300006195 Bacteria 4501
62 Ga0075366_10066322 3300006195 Bacteria 2147
63 Ga0097621_100046443 3300006237 Bacteria 3514
64 Ga0068871_100220908 3300006358 Bacteria 1641
65 Ga0099824_1004053 3300006942 Bacteria 21200
66 Ga0099824_1009679 3300006942 Bacteria 11728
67 Ga0099822_1000007 3300006943 Bacteria 77453
68 Ga0099823_1000074 3300006944 Bacteria 48327
69 Ga0099794_10031473 3300007265 Bacteria 2484
70 Ga0105251_10001287 3300009011 Bacteria 21693
71 Ga0105244_10005320 3300009036 Bacteria 8572
72 Ga0105244_10013814 3300009036 Bacteria 4699
73 Ga0105240_10013962 3300009093 Bacteria 10996
74 Ga0105240_10032474 3300009093 Bacteria 6758
75 Ga0105240_10034797 3300009093 Bacteria 6495
76 Ga0105240_10189508 3300009093 Bacteria 2419
77 Ga0105240_10232109 3300009093 Bacteria 2144
78 Ga0105245_10168629 3300009098 Bacteria 2083
79 Ga0105248_10024563 3300009177 Bacteria 6701
80 Ga0105248_10184864 3300009177 Bacteria 2348
81 Ga0105237_10003198 3300009545 Bacteria 19646
82 Ga0105237_10017007 3300009545 Bacteria 7548
83 Ga0105238_10181111 3300009551 Bacteria 2084
84 Ga0157373_10006624 3300013100 Bacteria 8637
85 Ga0157370_10003240 3300013104 Bacteria 19205
86 Ga0157370_10004494 3300013104 Bacteria 15984
87 Ga0157369_10000320 3300013105 Bacteria 64393
88 Ga0157369_10004182 3300013105 Bacteria 17103
89 Ga0157369_10005521 3300013105 Bacteria 14687
90 Ga0157369_10018879 3300013105 Bacteria 7726
91 Ga0157369_10221247 3300013105 Bacteria 1982
92 Ga0157374_10000219 3300013296 Bacteria 52748
93 Ga0157374_10006943 3300013296 Bacteria 9631
94 Ga0157378_10006645 3300013297 Bacteria 10105
95 Ga0163162_10002420 3300013306 Bacteria 17574
96 Ga0163162_10013288 3300013306 Bacteria 8042
97 Ga0157372_10000598 3300013307 Bacteria 39369
98 Ga0157372_10002581 3300013307 Bacteria 19627
99 Ga0157372_10067061 3300013307 Bacteria 4032
100 Ga0163163_10045070 3300014325 Bacteria 4328
101 Ga0157379_10153371 3300014968 Bacteria 2078
102 Ga0157376_10002020 3300014969 Bacteria 13604
103 Ga0182007_10000995 3300015262 Bacteria 15560
104 Ga0213873_10009034 3300021358 Bacteria 2056
105 Ga0213871_10000755 3300021441 Bacteria 4785
106 Ga0209674_100074 3300025226 Bacteria 223554
107 Ga0209674_100102 3300025226 Bacteria 155582
108 Ga0209672_100175 3300025228 Bacteria 53342
109 Ga0209563_100409 3300025230 Bacteria 15214
110 Ga0209563_103896 3300025230 Bacteria 2966
111 Ga0207427_102427 3300025231 Bacteria 5042
112 Ga0209677_100602 3300025253 Bacteria 19450
113 Ga0209677_101634 3300025253 Bacteria 9449
114 Ga0209148_1000282 3300025254 Bacteria 78016
115 Ga0209148_1006766 3300025254 Bacteria 2446
116 Ga0209759_1000009 3300025256 Bacteria 446623
117 Ga0209759_1000078 3300025256 Bacteria 175373
118 Ga0209759_1019120 3300025256 Bacteria 1634
119 Ga0209233_1000144 3300025261 Bacteria 190024
120 Ga0209233_1000493 3300025261 Bacteria 23838
121 Ga0209233_1002848 3300025261 Bacteria 6200
122 Ga0209233_1008675 3300025261 Bacteria 3128
123 Ga0209455_1002484 3300025272 Bacteria 7086
124 Ga0209130_1000522 3300025284 Bacteria 38769
125 Ga0209025_1000061 3300025294 Bacteria 304827
126 Ga0209564_1000893 3300025295 Bacteria 39189
127 Ga0209564_1005573 3300025295 Bacteria 7111
128 Ga0209564_1012951 3300025295 Bacteria 3586
129 Ga0209758_1000730 3300025297 Bacteria 48039
130 Ga0209758_1003514 3300025297 Bacteria 14143
131 Ga0209758_1004217 3300025297 Bacteria 12175
132 Ga0209758_1010070 3300025297 Bacteria 5729
133 Ga0207426_1000420 3300025302 Bacteria 69895
134 Ga0207426_1000641 3300025302 Bacteria 43707
135 Ga0207426_1001303 3300025302 Bacteria 21427
136 Ga0207426_1009896 3300025302 Bacteria 3737
137 Ga0209257_1006584 3300025304 Bacteria 7406
138 Ga0207696_1000010 3300025711 Bacteria 534681
139 Ga0207655_1000197 3300025728 Bacteria 106282
140 Ga0207655_1021092 3300025728 Bacteria 3320
141 Ga0207713_1001504 3300025735 Bacteria 18424
142 Ga0207713_1016483 3300025735 Bacteria 3748
143 Ga0207692_10025781 3300025898 Bacteria 2751
144 Ga0207647_10003817 3300025904 Bacteria 11266
145 Ga0207647_10007864 3300025904 Bacteria 7669
146 Ga0207647_10022300 3300025904 Bacteria 4208
147 Ga0207647_10028796 3300025904 Bacteria 3603
148 Ga0207699_10030227 3300025906 Bacteria 3029
149 Ga0207699_10031288 3300025906 Bacteria 2986
150 Ga0207705_10000864 3300025909 Bacteria 24824
151 Ga0207705_10086447 3300025909 Bacteria 2292
152 Ga0207684_10002632 3300025910 Bacteria 17956
153 Ga0207695_10001820 3300025913 Bacteria 33567
154 Ga0207695_10058124 3300025913 Bacteria 4015
155 Ga0207671_10005387 3300025914 Bacteria 11813
156 Ga0207671_10019380 3300025914 Bacteria 5202
157 Ga0207693_10022371 3300025915 Bacteria 5024
158 Ga0207693_10047236 3300025915 Bacteria 3382
159 Ga0207663_10000968 3300025916 Bacteria 13119
160 Ga0207663_10002301 3300025916 Bacteria 9151
161 Ga0207657_10003541 3300025919 Bacteria 16685
162 Ga0207652_10012393 3300025921 Bacteria 6889
163 Ga0207646_10042066 3300025922 Bacteria 4106
164 Ga0207664_10077427 3300025929 Bacteria 2694
165 Ga0207690_10005558 3300025932 Bacteria 7443
166 Ga0207661_10004345 3300025944 Bacteria 9925
167 Ga0207679_10036408 3300025945 Bacteria 3490
168 Ga0207667_10001900 3300025949 Bacteria 26214
169 Ga0207667_10007034 3300025949 Bacteria 13594
170 Ga0207658_10086804 3300025986 Bacteria 2414
171 Ga0207677_10105334 3300026023 Bacteria 2087
172 Ga0207639_10138607 3300026041 Bacteria 2024
173 Ga0207678_10029354 3300026067 Bacteria 4799
174 Ga0207678_10074721 3300026067 Bacteria 2904
175 Ga0207648_10143015 3300026089 Bacteria 2109
176 Ga0207648_10144107 3300026089 Bacteria 2101
177 Ga0207674_10211016 3300026116 Bacteria 1891
178 Ga0207675_100176955 3300026118 Bacteria 2041
179 Ga0207683_10039608 3300026121 Bacteria 4112
180 Ga0207698_10066465 3300026142 Bacteria 2838
181 Ga0209389_1000033 3300027296 Bacteria 131516
182 Ga0209389_1000063 3300027296 Bacteria 102403
183 Ga0209589_1000021 3300027357 Bacteria 186431
184 Ga0209589_1000040 3300027357 Bacteria 126550
185 Ga0209489_100028 3300027361 Bacteria 186431
186 Ga0209489_100045 3300027361 Bacteria 158225
187 Ga0209700_100037 3300027363 Bacteria 186431
188 Ga0307517_10000024 3300028786 Bacteria 185597
189 Ga0307515_10102094 3300028794 Bacteria 3454
190 Ga0265338_10114999 3300028800 Bacteria 2158
191 Ga0265760_10000882 3300031090 Bacteria 8669
192 Ga0265330_10006512 3300031235 Bacteria 5774
193 Ga0265340_10002209 3300031247 Bacteria 11138
194 Ga0265339_10001277 3300031249 Bacteria 18834
195 Ga0265327_10006119 3300031251 Bacteria 9743
196 Ga0307408_100010843 3300031548 Bacteria 6013
197 Ga0265342_10021291 3300031712 Bacteria 4144
198 Ga0307405_10115506 3300031731 Bacteria 1826
199 Ga0307412_10000041 3300031911 Bacteria 179188
200 Ga0307510_10002474 3300033180 Bacteria 21007
201 Ga0307510_10111077 3300033180 Bacteria 2483
202 Ga0315911_1000008 3300033442 Bacteria 381285
203 Ga0373927_0022849 3300035695 Bacteria 4096
204 Ga0373927_0076765 3300035695 Bacteria 2163
205 Ga0395900_0002352 3300037418 Bacteria 20935
206 Ga0395900_0005446 3300037418 Bacteria 13337
207 Ga0395900_0139516 3300037418 Bacteria 2483
208 Ga0395900_0349623 3300037418 Bacteria 1452
209 Ga0395898_0010389 3300037466 Bacteria 9734
210 Ga0395898_0010898 3300037466 Bacteria 9487
211 Ga0395898_0023482 3300037466 Bacteria 6230
212 Ga0395898_0153209 3300037466 Bacteria 2205
213 Ga0395898_0202294 3300037466 Bacteria 1896
214 Ga0395898_0245406 3300037466 Bacteria 1708
215 Ga0395905_0005266 3300037471 Bacteria 13232
216 Ga0436364_0243938 3300037853 Bacteria 6883
217 Ga0436364_0311122 3300037853 Bacteria 1539
218 Ga0436364_0365508 3300037853 Bacteria 3664
219 Ga0436364_0819535 3300037853 Bacteria 9315
220 Ga0436364_1377417 3300037853 Bacteria 4312
221 Ga0395901_0115458 3300038443 Bacteria 2820
222 Ga0395901_0259177 3300038443 Bacteria 1810
223 Ga0436361_0406165 3300039447 Bacteria 1560
224 Ga0436361_0418089 3300039447 Bacteria 2426
225 Ga0436363_0863035 3300039450 Bacteria 4611
226 Ga0436362_0484418 3300039453 Bacteria 1761
227 Ga0439447_004255 3300041407 Bacteria 4961
228 Ga0439466_0000609 3300041411 Bacteria 13447
229 Ga0439431_0002711 3300041997 Bacteria 3894
230 Ga0439448_0000169 3300042005 Bacteria 13105
231 Ga0439432_004237 3300042006 Bacteria 5244
232 Ga0450922_001606 3300042124 Bacteria 2209
233 Ga0466969_0002550 3300044656 Bacteria 9734
234 Ga0466969_0006896 3300044656 Bacteria 6046
235 Ga0466972_0000107 3300044658 Bacteria 71873
236 Ga0466972_0050982 3300044658 Bacteria 1997
237 Ga0466965_0000619 3300044683 Bacteria 12961
238 Ga0466965_0010374 3300044683 Bacteria 4345
239 Ga0466965_0067932 3300044683 Bacteria 1789
240 Ga0466966_0000359 3300044684 Bacteria 29538
241 Ga0466966_0037473 3300044684 Bacteria 3127
242 Ga0466961_0000074 3300044693 Bacteria 61968
243 Ga0466961_0164686 3300044693 Bacteria 1381
244 Ga0466963_0003085 3300044694 Bacteria 9443
245 Ga0466963_0008953 3300044694 Bacteria 6009
246 Ga0466963_0008995 3300044694 Bacteria 5997
247 Ga0466963_0042956 3300044694 Bacteria 2970
248 Ga0466963_0059770 3300044694 Bacteria 2544
249 Ga0466971_0011223 3300044719 Bacteria 3924
250 Ga0466971_0077853 3300044719 Bacteria 1510
251 Ga0466970_0035983 3300044765 Bacteria 2622
252 Ga0466970_0099823 3300044765 Bacteria 1580
253 Ga0466957_0009691 3300044842 Bacteria 5500
254 Ga0466957_0049389 3300044842 Bacteria 2558
255 Ga0466957_0073352 3300044842 Bacteria 2121
256 Ga0466960_0077862 3300044901 Bacteria 1664
257 Ga0466959_0008397 3300045049 Bacteria 7300
258 Ga0466959_0056406 3300045049 Bacteria 2866
259 Ga0466958_0052052 3300045836 Bacteria 2481
260 Ga0466967_0005854 3300045976 Bacteria 8603
261 Ga0466967_0012787 3300045976 Bacteria 6447
262 Ga0466967_0034331 3300045976 Bacteria 4304
263 Ga0466967_0048148 3300045976 Bacteria 3721
264 Ga0495592_0021268 3300046454 Bacteria 4933
265 Ga0495603_0069349 3300046455 Bacteria 2074
266 Ga0495590_0004409 3300046457 Bacteria 5687
267 Ga0495590_0014755 3300046457 Bacteria 2848
268 Ga0495629_0000116 3300046459 Bacteria 72206
269 Ga0495638_0002571 3300046460 Bacteria 14689
270 Ga0495638_0004949 3300046460 Bacteria 10008
271 Ga0495638_0005996 3300046460 Bacteria 8904
272 Ga0495651_0067673 3300046462 Bacteria 2724
273 Ga0495653_0001724 3300046463 Bacteria 17231
274 Ga0495650_0023020 3300046471 Bacteria 2974
275 Ga0495650_0038365 3300046471 Bacteria 2076
276 Ga0495580_0009499 3300046472 Bacteria 7644
277 Ga0495580_0038307 3300046472 Bacteria 3434
278 Ga0495605_0004386 3300046474 Bacteria 8305
279 Ga0495605_0005618 3300046474 Bacteria 7287
280 Ga0495605_0010867 3300046474 Bacteria 5085
281 Ga0495639_0036242 3300046475 Bacteria 2209
282 Ga0495585_0016423 3300046492 Bacteria 4288
283 Ga0495606_0039566 3300046507 Bacteria 3175
284 Ga0495608_0017440 3300046511 Bacteria 4966
285 Ga0495610_0002054 3300046512 Bacteria 17211
286 Ga0495616_0008096 3300046513 Bacteria 6258
287 Ga0495618_0052878 3300046514 Bacteria 2568
288 Ga0495628_0094740 3300046516 Bacteria 2307
289 Ga0495628_0117156 3300046516 Bacteria 2045
290 Ga0495631_0026864 3300046518 Bacteria 2639
291 Ga0495632_0000033 3300046519 Bacteria 164240
292 Ga0495643_0000583 3300046522 Bacteria 44498
293 Ga0495644_0017788 3300046523 Bacteria 2716
294 Ga0495648_0003019 3300046524 Bacteria 15074
295 Ga0495648_0005832 3300046524 Bacteria 10143
296 Ga0495648_0041306 3300046524 Bacteria 2914
297 Ga0495648_0083895 3300046524 Bacteria 1804
298 Ga0495666_0035763 3300046526 Bacteria 2419
299 Ga0495652_0047220 3300046529 Bacteria 3693
300 Ga0495652_0100833 3300046529 Bacteria 2341
301 Ga0495654_0089521 3300046530 Bacteria 1430
302 Ga0495640_0016349 3300046533 Bacteria 5551
303 Ga0495645_0023938 3300046543 Bacteria 4427
304 Ga0495622_0025626 3300046557 Bacteria 2754
305 Ga0495667_0038343 3300046559 Bacteria 3191
306 Ga0495668_0065004 3300046616 Bacteria 2008
307 Ga0495634_0018287 3300046642 Bacteria 4991
308 Ga0495635_0025856 3300046663 Bacteria 4088
309 Ga0495661_0033690 3300046665 Bacteria 3229
310 Ga0495657_0032258 3300046675 Bacteria 3657
311 Ga0495599_0111339 3300046678 Bacteria 1705
312 Ga0495646_0035480 3300046680 Bacteria 3093
313 Ga0495613_0025234 3300046689 Bacteria 4430
314 Ga0495624_0008528 3300046690 Bacteria 7139
315 Ga0495624_0009833 3300046690 Bacteria 6616
316 Ga0495624_0022770 3300046690 Bacteria 4134
317 Ga0495624_0034395 3300046690 Bacteria 3277
318 Ga0495670_0022022 3300046691 Bacteria 3146
319 Ga0495671_0039010 3300046692 Bacteria 2399
320 Ga0495671_0082549 3300046692 Bacteria 1575
321 Ga0495649_0016179 3300046694 Bacteria 4231
322 Ga0495589_0001320 3300046794 Bacteria 14562
323 Ga0495589_0017669 3300046794 Bacteria 3660
324 Ga0495600_0041594 3300046809 Bacteria 2995
325 Ga0495581_0019686 3300047315 Bacteria 3917
326 Ga0495604_0047316 3300047317 Bacteria 3350
327 Ga0495604_0058048 3300047317 Bacteria 2973
328 Ga0495674_0009111 3300047319 Bacteria 9429
329 Ga0495676_0006058 3300047321 Bacteria 11115
330 Ga0495683_0004328 3300047323 Bacteria 8091
331 Ga0495683_0018805 3300047323 Bacteria 3568
332 Ga0495683_0038196 3300047323 Bacteria 2432
333 Ga0495687_032963 3300047443 Bacteria 2357
334 Ga0495687_049942 3300047443 Bacteria 1785
335 Ga0495679_000026 3300047446 Bacteria 196639
336 Ga0495686_0000045 3300047472 Bacteria 284761
337 Ga0495686_0064664 3300047472 Bacteria 2264
338 Ga0495602_0145876 3300048088 Bacteria 1867
339 Ga0496100_0012929 3300048903 Bacteria 4799
340 Ga0496100_0017443 3300048903 Bacteria 4238
341 Ga0496101_0040860 3300048904 Bacteria 3304
342 Ga0496102_0008119 3300048905 Bacteria 8984
343 Ga0496102_0025701 3300048905 Bacteria 5244
344 Ga0496102_0081897 3300048905 Bacteria 2976
345 Ga0496103_0004614 3300048906 Bacteria 8339
346 Ga0496104_0002854 3300048907 Bacteria 14892
347 Ga0496104_0007199 3300048907 Bacteria 9809
348 Ga0496104_0072815 3300048907 Bacteria 3268
349 Ga0496104_0080044 3300048907 Bacteria 3114
350 Ga0496105_0005297 3300048908 Bacteria 9775
351 Ga0496105_0051611 3300048908 Bacteria 3397
352 Ga0496105_0106172 3300048908 Bacteria 2318
353 Ga0496106_0000007 3300048909 Bacteria 248548
354 Ga0496106_0014006 3300048909 Bacteria 5929
355 Ga0496106_0081585 3300048909 Bacteria 2485
356 Ga0496107_0005366 3300048910 Bacteria 8769
357 Ga0496108_0009412 3300048911 Bacteria 7910
358 Ga0496108_0037116 3300048911 Bacteria 4057
359 Ga0496109_0005367 3300048912 Bacteria 10715
360 Ga0496109_0089973 3300048912 Bacteria 2838
361 Ga0496111_0017923 3300048914 Bacteria 4897
362 Ga0496112_0001903 3300048915 Bacteria 16465
363 Ga0496112_0087087 3300048915 Bacteria 3090
364 Ga0496112_0157801 3300048915 Bacteria 2235
365 Ga0496113_0006944 3300048916 Bacteria 7234
366 Ga0496113_0012420 3300048916 Bacteria 5723
367 Ga0496113_0024672 3300048916 Bacteria 4277
368 Ga0496114_0102459 3300048917 Bacteria 2445
369 Ga0496115_0002653 3300048918 Bacteria 12842
370 Ga0496115_0020741 3300048918 Bacteria 5070
371 Ga0496115_0132198 3300048918 Bacteria 2057
372 Ga0496115_0176176 3300048918 Bacteria 1768
373 Ga0496116_0003593 3300048919 Bacteria 15253
374 Ga0496117_0001160 3300048920 Bacteria 39593
375 Ga0496117_0113175 3300048920 Bacteria 1686
376 Ga0496118_0001084 3300048921 Bacteria 42357
377 Ga0496118_0001470 3300048921 Bacteria 35289
378 Ga0496118_0007125 3300048921 Bacteria 11992
379 Ga0496118_0019768 3300048921 Bacteria 6006
380 Ga0496118_0028036 3300048921 Bacteria 4753
381 Ga0496118_0039401 3300048921 Bacteria 3771
382 Ga0496118_0041430 3300048921 Bacteria 3646
383 Ga0496118_0046245 3300048921 Bacteria 3388
384 Ga0496119_0000612 3300048922 Bacteria 48284
385 Ga0496119_0035309 3300048922 Bacteria 3278
386 Ga0496119_0036985 3300048922 Bacteria 3178
387 Ga0496119_0064703 3300048922 Bacteria 2170
388 Ga0496119_0102793 3300048922 Bacteria 1601
389 Ga0496120_0001054 3300048923 Bacteria 36515
390 Ga0496120_0005151 3300048923 Bacteria 10561
391 Ga0496121_0000893 3300048924 Bacteria 53847
392 Ga0496121_0007942 3300048924 Bacteria 12680
393 Ga0496121_0008105 3300048924 Bacteria 12498
394 Ga0496121_0008996 3300048924 Bacteria 11579
395 Ga0496121_0011589 3300048924 Bacteria 9758
396 Ga0496121_0076047 3300048924 Bacteria 2679
397 Ga0496121_0091069 3300048924 Bacteria 2382
398 Ga0496121_0123379 3300048924 Bacteria 1952
399 Ga0496121_0193390 3300048924 Bacteria 1456
400 Ga0496122_0035642 3300048925 Bacteria 4042
401 Ga0496123_0035736 3300048926 Bacteria 3535
402 Ga0496124_0015892 3300048927 Bacteria 7187
403 Ga0496124_0042565 3300048927 Bacteria 3910
404 Ga0496124_0148291 3300048927 Bacteria 1843
405 Ga0496125_0000380 3300048928 Bacteria 82955
406 Ga0496125_0040402 3300048928 Bacteria 4003
407 Ga0496126_0008048 3300048929 Bacteria 11435
408 Ga0496126_0013831 3300048929 Bacteria 8186
409 Ga0496126_0014910 3300048929 Bacteria 7838
410 Ga0496126_0027307 3300048929 Bacteria 5454
411 Ga0496126_0032320 3300048929 Bacteria 4930
412 Ga0496126_0034856 3300048929 Bacteria 4722
413 Ga0496126_0100005 3300048929 Bacteria 2539
414 Ga0496126_0110829 3300048929 Bacteria 2390
415 Ga0495678_021863 3300049459 Bacteria 2809
416 Ga0495682_0059543 3300049460 Bacteria 1380
417 Ga0501031_0135917 3300049568 Bacteria 1606
418 Ga0501034_0000041 3300049571 Bacteria 229264
419 Ga0501034_0089372 3300049571 Bacteria 3078
420 Ga0501034_0165361 3300049571 Bacteria 2181
421 Ga0501039_0092666 3300049575 Bacteria 2355
422 Ga0501073_0082297 3300049589 Bacteria 2239
423 nmdc:mga03n38_15728_c1 3300050490 Bacteria 2927
424 nmdc:mga00v17_49760_c1 3300050491 Bacteria 2543
425 nmdc:mga0yw44_8827_c1 3300050492 Bacteria 4551
426 nmdc:mga06z11_9333_c1 3300050494 Bacteria 4130
427 nmdc:mga07m45_162902_c1 3300050496 Bacteria 1295
428 nmdc:mga05p37_429763_c1 3300050507 Bacteria 1534
429 Ga0495601_0015001 3300053077 Bacteria 4680
430 Ga0495612_0045343 3300053078 Bacteria 1799
431 Ga0500578_0034637 3300053086 Bacteria 3245
432 Ga0500643_000063 3300053087 Bacteria 122135
433 Ga0500646_0002286 3300053090 Bacteria 4993
434 Ga0500647_0004754 3300053091 Bacteria 5526
435 Ga0500583_0003937 3300053092 Bacteria 4764
436 Ga0500651_0001809 3300053093 Bacteria 10947
437 Ga0500651_0017933 3300053093 Bacteria 4377
438 Ga0500651_0025568 3300053093 Bacteria 3705
439 Ga0500566_0000150 3300053094 Bacteria 35703
440 Ga0500566_0000252 3300053094 Bacteria 28789
441 Ga0500566_0000871 3300053094 Bacteria 17224
442 Ga0500640_011476 3300053095 Bacteria 3612
443 Ga0500650_0022885 3300053098 Bacteria 2769
444 Ga0500556_0000006 3300053104 Bacteria 453982
445 Ga0500556_0013044 3300053104 Bacteria 2501
446 Ga0500569_000996 3300053109 Bacteria 5115
447 Ga0500572_006544 3300053111 Bacteria 2672
448 Ga0500592_008151 3300053116 Bacteria 1662
449 Ga0500595_002380 3300053119 Bacteria 9400
450 Ga0500595_025276 3300053119 Bacteria 2061
451 Ga0500608_000342 3300053122 Bacteria 18064
452 Ga0500618_010713 3300053125 Bacteria 2451
453 Ga0500642_0000004 3300053130 Bacteria 433122
454 Ga0500642_0000465 3300053130 Bacteria 12688
455 Ga0500652_000776 3300053131 Bacteria 10749
456 Ga0500659_0015158 3300053135 Bacteria 4205
457 Ga0500559_0000244 3300053136 Bacteria 42994
458 Ga0500559_0005538 3300053136 Bacteria 5798
459 Ga0500568_0042665 3300053139 Bacteria 1816
460 Ga0500604_0004291 3300053151 Bacteria 3784
461 Ga0500616_0000022 3300053153 Bacteria 460463
462 Ga0500616_0000127 3300053153 Bacteria 134777
463 Ga0500616_0009016 3300053153 Bacteria 6111
464 Ga0500622_0000837 3300053156 Bacteria 26291
465 Ga0500630_017330 3300053159 Bacteria 3551
466 Ga0500633_0041440 3300053160 Bacteria 1549
467 Ga0500636_0000197 3300053177 Bacteria 32448
468 Ga0500636_0009453 3300053177 Bacteria 5666
469 Ga0500637_0063215 3300053178 Bacteria 2122
470 Ga0500576_025060 3300053725 Bacteria 2720
471 Ga0500625_011604 3300053729 Bacteria 4006
472 Ga0500599_000158 3300053736 Bacteria 6164
473 Ga0466962_0002559 3300061719 Bacteria 8636
474 Ga0466962_0009667 3300061719 Bacteria 4624
475 Ga0466962_0014901 3300061719 Bacteria 3747

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10263653 Ga0081455_102636532 336
2 3300031090 Ga0265760_10000882 Ga0265760_100008827 363
3 3300037853 Ga0436364_1377417 Ga0436364_1377417_1151_2509 364
4 3300048909 Ga0496106_0081585 Ga0496106_0081585_30_1190 366
5 3300039447 Ga0436361_0406165 Ga0436361_0406165_264_1460 369
6 3300048088 Ga0495602_0145876 Ga0495602_0145876_23_1240 371
7 3300025261 Ga0209233_1002848 Ga0209233_10028484 381
8 3300039447 Ga0436361_0418089 Ga0436361_0418089_1125_2375 385
9 3300048905 Ga0496102_0008119 Ga0496102_0008119_29_1249 386
10 3300048918 Ga0496115_0176176 Ga0496115_0176176_15_1232 386
11 3300050496 nmdc:mga07m45_162902_c1 nmdc:mga07m45_162902_c1_26_1246 386
12 3300048918 Ga0496115_0020741 Ga0496115_0020741_3507_4820 387
13 iso_pu_bacteria 8016557553 8016557622 387
14 3300048907 Ga0496104_0007199 Ga0496104_0007199_1145_2530 388
15 3300048908 Ga0496105_0051611 Ga0496105_0051611_1815_3200 388
16 3300048911 Ga0496108_0009412 Ga0496108_0009412_6456_7841 388
17 3300048912 Ga0496109_0005367 Ga0496109_0005367_7285_8670 388
18 3300048914 Ga0496111_0017923 Ga0496111_0017923_2008_3393 388
19 3300048915 Ga0496112_0001903 Ga0496112_0001903_9391_10776 388
20 3300048916 Ga0496113_0024672 Ga0496113_0024672_1078_2463 388
21 3300025254 Ga0209148_1006766 Ga0209148_10067662 389
22 3300025272 Ga0209455_1002484 Ga0209455_10024844 389
23 3300047323 Ga0495683_0038196 Ga0495683_0038196_939_2333 389
24 3300048929 Ga0496126_0027307 Ga0496126_0027307_3977_5248 390
25 3300026089 Ga0207648_10143015 Ga0207648_101430152 391
26 3300028800 Ga0265338_10114999 Ga0265338_101149992 391
27 3300031251 Ga0265327_10006119 Ga0265327_100061193 391
28 3300037853 Ga0436364_0311122 Ga0436364_0311122_209_1492 391
29 3300037853 Ga0436364_0819535 Ga0436364_0819535_2530_3819 392
30 3300053111 Ga0500572_006544 Ga0500572_006544_811_2109 392
31 3300053136 Ga0500559_0000244 Ga0500559_0000244_21625_22923 392
32 3300053725 Ga0500576_025060 Ga0500576_025060_767_2065 392
33 iso_pu_bacteria 8016539877 8016544112 392
34 3300046524 Ga0495648_0005832 Ga0495648_0005832_4107_5348 393
35 3300048929 Ga0496126_0008048 Ga0496126_0008048_3499_4740 393
36 3300006944 Ga0099823_1000074 Ga0099823_100007446 394
37 3300027296 Ga0209389_1000063 Ga0209389_10000632 394
38 3300041997 Ga0439431_0002711 Ga0439431_0002711_1097_2362 394
39 3300042006 Ga0439432_004237 Ga0439432_004237_1127_2452 394
40 3300049571 Ga0501034_0000041 Ga0501034_0000041_20379_21704 394
41 3300053135 Ga0500659_0015158 Ga0500659_0015158_1085_2410 394
42 3300025254 Ga0209148_1000282 Ga0209148_100028269 395
43 3300048929 Ga0496126_0110829 Ga0496126_0110829_177_1469 395
44 3300003752 Ga0055539_1001505 Ga0055539_10015052 397
45 3300025230 Ga0209563_103896 Ga0209563_1038962 397
46 3300025253 Ga0209677_101634 Ga0209677_1016346 397
47 3300025261 Ga0209233_1008675 Ga0209233_10086752 397
48 3300031712 Ga0265342_10021291 Ga0265342_100212912 397
49 3300033180 Ga0307510_10111077 Ga0307510_101110772 397
50 3300037418 Ga0395900_0349623 Ga0395900_0349623_119_1411 397
51 3300044694 Ga0466963_0042956 Ga0466963_0042956_1107_2393 397
52 3300044694 Ga0466963_0059770 Ga0466963_0059770_345_1631 397
53 3300044842 Ga0466957_0049389 Ga0466957_0049389_745_2043 397
54 3300045976 Ga0466967_0012787 Ga0466967_0012787_1483_2769 397
55 3300045976 Ga0466967_0048148 Ga0466967_0048148_1045_2337 397
56 3300046462 Ga0495651_0067673 Ga0495651_0067673_1042_2337 397
57 3300046475 Ga0495639_0036242 Ga0495639_0036242_701_1996 397
58 3300046511 Ga0495608_0017440 Ga0495608_0017440_2640_3935 397
59 3300046514 Ga0495618_0052878 Ga0495618_0052878_75_1370 397
60 3300046524 Ga0495648_0083895 Ga0495648_0083895_444_1739 397
61 3300046529 Ga0495652_0047220 Ga0495652_0047220_2221_3516 397
62 3300046533 Ga0495640_0016349 Ga0495640_0016349_3837_5132 397
63 3300046557 Ga0495622_0025626 Ga0495622_0025626_752_2047 397
64 3300046642 Ga0495634_0018287 Ga0495634_0018287_3447_4742 397
65 3300046663 Ga0495635_0025856 Ga0495635_0025856_1051_2346 397
66 3300046675 Ga0495657_0032258 Ga0495657_0032258_1350_2645 397
67 3300046689 Ga0495613_0025234 Ga0495613_0025234_2103_3398 397
68 3300046690 Ga0495624_0008528 Ga0495624_0008528_5813_7108 397
69 3300046809 Ga0495600_0041594 Ga0495600_0041594_1509_2804 397
70 3300047321 Ga0495676_0006058 Ga0495676_0006058_9651_10946 397
71 3300048907 Ga0496104_0002854 Ga0496104_0002854_10231_11526 397
72 3300048908 Ga0496105_0005297 Ga0496105_0005297_4913_6208 397
73 3300048916 Ga0496113_0006944 Ga0496113_0006944_5181_6476 397
74 3300048923 Ga0496120_0005151 Ga0496120_0005151_5700_6995 397
75 3300048924 Ga0496121_0193390 Ga0496121_0193390_129_1424 397
76 3300048929 Ga0496126_0032320 Ga0496126_0032320_436_1728 397
77 3300053094 Ga0500566_0000252 Ga0500566_0000252_6894_8189 397
78 iso_pu_bacteria 2844533157 2844538014 397
79 3300005329 Ga0070683_100024865 Ga0070683_1000248653 398
80 3300005535 Ga0070684_100038231 Ga0070684_1000382312 398
81 3300025253 Ga0209677_100602 Ga0209677_1006021 398
82 3300025261 Ga0209233_1000493 Ga0209233_100049320 398
83 3300025944 Ga0207661_10004345 Ga0207661_100043454 398
84 3300045976 Ga0466967_0034331 Ga0466967_0034331_2041_3330 398
85 3300048921 Ga0496118_0041430 Ga0496118_0041430_2188_3486 398
86 3300048922 Ga0496119_0036985 Ga0496119_0036985_258_1556 398
87 3300003187 JGI25151J46595_10000164 JGI25151J46595_1000016471 399
88 3300003354 JGI25160J50197_1006481 JGI25160J50197_10064815 399
89 3300006195 Ga0075366_10066322 Ga0075366_100663221 399
90 3300025284 Ga0209130_1000522 Ga0209130_100052233 399
91 3300025294 Ga0209025_1000061 Ga0209025_100006178 399
92 3300025297 Ga0209758_1000730 Ga0209758_100073013 399
93 3300025302 Ga0207426_1000641 Ga0207426_100064133 399
94 3300037471 Ga0395905_0005266 Ga0395905_0005266_3399_4694 399
95 3300038443 Ga0395901_0259177 Ga0395901_0259177_372_1667 399
96 3300046522 Ga0495643_0000583 Ga0495643_0000583_39060_40385 399
97 3300025297 Ga0209758_1010070 Ga0209758_10100703 400
98 3300048924 Ga0496121_0091069 Ga0496121_0091069_230_1528 400
99 iso_pu_bacteria 2821443989 2821444564 400
100 iso_pu_bacteria 8055066027 8055069810 400
101 3300005262 Ga0065165_1003030 Ga0065165_10030304 401
102 3300005563 Ga0068855_100141958 Ga0068855_1001419582 401
103 3300006195 Ga0075366_10014497 Ga0075366_100144974 401
104 3300009093 Ga0105240_10034797 Ga0105240_100347974 401
105 3300009098 Ga0105245_10168629 Ga0105245_101686292 401
106 3300013105 Ga0157369_10005521 Ga0157369_100055219 401
107 3300013105 Ga0157369_10221247 Ga0157369_102212472 401
108 3300013307 Ga0157372_10067061 Ga0157372_100670612 401
109 3300025302 Ga0207426_1001303 Ga0207426_10013032 401
110 3300025304 Ga0209257_1006584 Ga0209257_10065844 401
111 3300025904 Ga0207647_10007864 Ga0207647_100078646 401
112 3300026142 Ga0207698_10066465 Ga0207698_100664652 401
113 3300037418 Ga0395900_0005446 Ga0395900_0005446_11922_13220 401
114 3300037466 Ga0395898_0153209 Ga0395898_0153209_586_1884 401
115 3300037853 Ga0436364_0243938 Ga0436364_0243938_2644_3942 401
116 3300038443 Ga0395901_0115458 Ga0395901_0115458_1298_2596 401
117 3300044694 Ga0466963_0008995 Ga0466963_0008995_3412_4707 401
118 3300044719 Ga0466971_0077853 Ga0466971_0077853_75_1370 401
119 3300044842 Ga0466957_0009691 Ga0466957_0009691_3721_5016 401
120 3300045976 Ga0466967_0005854 Ga0466967_0005854_3330_4625 401
121 3300046543 Ga0495645_0023938 Ga0495645_0023938_561_1859 401
122 3300046678 Ga0495599_0111339 Ga0495599_0111339_273_1571 401
123 3300047443 Ga0495687_049942 Ga0495687_049942_421_1716 401
124 3300048904 Ga0496101_0040860 Ga0496101_0040860_1271_2566 401
125 3300048905 Ga0496102_0081897 Ga0496102_0081897_1440_2735 401
126 3300048906 Ga0496103_0004614 Ga0496103_0004614_5063_6358 401
127 3300048911 Ga0496108_0037116 Ga0496108_0037116_1996_3291 401
128 3300048915 Ga0496112_0157801 Ga0496112_0157801_255_1550 401
129 3300048922 Ga0496119_0102793 Ga0496119_0102793_33_1328 401
130 3300048924 Ga0496121_0076047 Ga0496121_0076047_687_1988 401
131 3300050490 nmdc:mga03n38_15728_c1 nmdc:mga03n38_15728_c1_134_1429 401
132 3300050491 nmdc:mga00v17_49760_c1 nmdc:mga00v17_49760_c1_1165_2466 401
133 3300053077 Ga0495601_0015001 Ga0495601_0015001_3040_4338 401
134 3300053078 Ga0495612_0045343 Ga0495612_0045343_29_1327 401
135 3300006942 Ga0099824_1009679 Ga0099824_10096793 402
136 3300025297 Ga0209758_1004217 Ga0209758_10042178 402
137 3300025915 Ga0207693_10022371 Ga0207693_100223713 402
138 3300027296 Ga0209389_1000033 Ga0209389_100003373 402
139 3300027357 Ga0209589_1000040 Ga0209589_100004073 402
140 3300027361 Ga0209489_100045 Ga0209489_10004585 402
141 3300035695 Ga0373927_0022849 Ga0373927_0022849_1554_2822 402
142 3300044656 Ga0466969_0006896 Ga0466969_0006896_3512_4807 402
143 3300044658 Ga0466972_0000107 Ga0466972_0000107_22416_23711 402
144 3300044683 Ga0466965_0010374 Ga0466965_0010374_1761_3056 402
145 3300044683 Ga0466965_0067932 Ga0466965_0067932_62_1357 402
146 3300044684 Ga0466966_0000359 Ga0466966_0000359_17498_18793 402
147 3300044693 Ga0466961_0000074 Ga0466961_0000074_41239_42534 402
148 3300044842 Ga0466957_0073352 Ga0466957_0073352_304_1602 402
149 3300045049 Ga0466959_0008397 Ga0466959_0008397_5190_6485 402
150 3300045836 Ga0466958_0052052 Ga0466958_0052052_76_1371 402
151 3300046455 Ga0495603_0069349 Ga0495603_0069349_271_1539 402
152 3300048918 Ga0496115_0132198 Ga0496115_0132198_276_1544 402
153 3300048925 Ga0496122_0035642 Ga0496122_0035642_1295_2653 402
154 3300053093 Ga0500651_0001809 Ga0500651_0001809_4531_5832 402
155 3300005337 Ga0070682_100085173 Ga0070682_1000851732 403
156 3300005344 Ga0070661_100066102 Ga0070661_1000661021 403
157 3300013296 Ga0157374_10006943 Ga0157374_100069432 403
158 3300013306 Ga0163162_10013288 Ga0163162_100132886 403
159 3300014325 Ga0163163_10045070 Ga0163163_100450704 403
160 3300014968 Ga0157379_10153371 Ga0157379_101533712 403
161 3300014969 Ga0157376_10002020 Ga0157376_100020208 403
162 3300026067 Ga0207678_10074721 Ga0207678_100747212 403
163 3300026116 Ga0207674_10211016 Ga0207674_102110162 403
164 3300033442 Ga0315911_1000008 Ga0315911_1000008254 403
165 3300037418 Ga0395900_0002352 Ga0395900_0002352_3594_4889 403
166 3300037466 Ga0395898_0010389 Ga0395898_0010389_4679_5974 403
167 3300039450 Ga0436363_0863035 Ga0436363_0863035_2114_3412 403
168 3300048909 Ga0496106_0014006 Ga0496106_0014006_3968_5239 403
169 3300048929 Ga0496126_0014910 Ga0496126_0014910_4978_6363 403
170 3300053093 Ga0500651_0025568 Ga0500651_0025568_1555_2850 403
171 3300053109 Ga0500569_000996 Ga0500569_000996_2993_4288 403
172 3300053130 Ga0500642_0000465 Ga0500642_0000465_6746_8041 403
173 3300053177 Ga0500636_0000197 Ga0500636_0000197_2392_3687 403
174 3300053729 Ga0500625_011604 Ga0500625_011604_1617_2912 403
175 3300005355 Ga0070671_100233971 Ga0070671_1002339711 404
176 3300005367 Ga0070667_100014967 Ga0070667_1000149671 404
177 3300009177 Ga0105248_10024563 Ga0105248_100245633 404
178 3300013306 Ga0163162_10002420 Ga0163162_100024207 404
179 3300025986 Ga0207658_10086804 Ga0207658_100868042 404
180 3300046460 Ga0495638_0004949 Ga0495638_0004949_7243_8529 404
181 3300046474 Ga0495605_0010867 Ga0495605_0010867_39_1325 404
182 3300046492 Ga0495585_0016423 Ga0495585_0016423_471_1757 404
183 3300046518 Ga0495631_0026864 Ga0495631_0026864_1272_2558 404
184 3300046523 Ga0495644_0017788 Ga0495644_0017788_1239_2525 404
185 3300046530 Ga0495654_0089521 Ga0495654_0089521_65_1351 404
186 3300046794 Ga0495589_0001320 Ga0495589_0001320_5774_7060 404
187 3300047472 Ga0495686_0000045 Ga0495686_0000045_129484_130770 404
188 3300048903 Ga0496100_0017443 Ga0496100_0017443_1288_2574 404
189 3300048905 Ga0496102_0025701 Ga0496102_0025701_968_2254 404
190 3300048907 Ga0496104_0072815 Ga0496104_0072815_654_1940 404
191 3300048921 Ga0496118_0019768 Ga0496118_0019768_2682_3968 404
192 iso_pu_bacteria 2511231004 2511254475 404
193 iso_pu_bacteria 2511231016 2511329188 404
194 iso_pu_bacteria 2511231022 2511360634 404
195 iso_pu_bacteria 2554235231 2555249169 404
196 iso_pu_bacteria 8056155041 8056159321 404
197 3300005437 Ga0070710_10002720 Ga0070710_100027202 405
198 3300005719 Ga0068861_100190632 Ga0068861_1001906322 405
199 3300006942 Ga0099824_1004053 Ga0099824_10040532 405
200 3300006943 Ga0099822_1000007 Ga0099822_100000756 405
201 3300027357 Ga0209589_1000021 Ga0209589_100002164 405
202 3300027361 Ga0209489_100028 Ga0209489_10002864 405
203 3300027363 Ga0209700_100037 Ga0209700_10003764 405
204 3300037466 Ga0395898_0202294 Ga0395898_0202294_376_1671 405
205 3300047472 Ga0495686_0064664 Ga0495686_0064664_945_2225 405
206 3300048921 Ga0496118_0028036 Ga0496118_0028036_2410_3711 405
207 3300048924 Ga0496121_0007942 Ga0496121_0007942_5956_7257 405
208 iso_pu_bacteria 2511231007 2511269708 405
209 iso_pu_bacteria 2511231024 2511374803 405
210 iso_pu_bacteria 2623620446 2624493759 405
211 iso_pu_bacteria 2643221633 2644187574 405
212 iso_pu_bacteria 2773857670 2774121358 405
213 iso_pu_bacteria 2784132072 2784317299 405
214 iso_pu_bacteria 2806310737 2807409663 405
215 iso_pu_bacteria 2806310745 2807457964 405
216 iso_pu_bacteria 2808606361 2808858234 405
217 iso_pu_bacteria 2808606376 2808924143 405
218 iso_pu_bacteria 2808606378 2808938377 405
219 iso_pu_bacteria 2808606380 2808946084 405
220 iso_pu_bacteria 2808606383 2808966719 405
221 iso_pu_bacteria 2808606389 2809001549 405
222 iso_pu_bacteria 2912963787 2912965134 405
223 iso_pu_bacteria 2919155634 2919160052 405
224 iso_pu_bacteria 2919697872 2919700332 405
225 iso_pu_bacteria 2935959822 2935962683 405
226 iso_pu_bacteria 2939651529 2939653494 405
227 iso_pu_bacteria 2988728565 2988733325 405
228 iso_pu_bacteria 3007803356 3007806344 405
229 iso_pu_bacteria 8019775933 8019776987 405
230 iso_pu_bacteria 8052494512 8052498652 405
231 iso_pu_bacteria 8054929484 8054933921 405
232 iso_pu_bacteria 8056115690 8056119965 405
233 iso_pu_bacteria 8056120720 8056122110 405
234 iso_pu_bacteria 8056172158 8056175741 405
235 3300005289 Ga0065704_10092281 Ga0065704_100922812 406
236 3300005983 Ga0081540_1028192 Ga0081540_10281921 406
237 3300009036 Ga0105244_10005320 Ga0105244_100053202 406
238 3300009036 Ga0105244_10013814 Ga0105244_100138144 406
239 3300013307 Ga0157372_10000598 Ga0157372_1000059829 406
240 3300025711 Ga0207696_1000010 Ga0207696_1000010138 406
241 3300025728 Ga0207655_1000197 Ga0207655_100019736 406
242 3300025728 Ga0207655_1021092 Ga0207655_10210922 406
243 3300025735 Ga0207713_1016483 Ga0207713_10164832 406
244 3300025916 Ga0207663_10002301 Ga0207663_1000230110 406
245 3300041407 Ga0439447_004255 Ga0439447_004255_699_2000 406
246 3300041411 Ga0439466_0000609 Ga0439466_0000609_6818_8119 406
247 3300042124 Ga0450922_001606 Ga0450922_001606_893_2194 406
248 3300048920 Ga0496117_0001160 Ga0496117_0001160_32783_34069 406
249 3300048921 Ga0496118_0001084 Ga0496118_0001084_34228_35514 406
250 3300048922 Ga0496119_0000612 Ga0496119_0000612_25521_26807 406
251 3300048922 Ga0496119_0035309 Ga0496119_0035309_28_1314 406
252 3300048923 Ga0496120_0001054 Ga0496120_0001054_25324_26610 406
253 3300048927 Ga0496124_0015892 Ga0496124_0015892_3054_4340 406
254 3300048928 Ga0496125_0000380 Ga0496125_0000380_37432_38718 406
255 3300049571 Ga0501034_0165361 Ga0501034_0165361_882_2162 406
256 3300050507 nmdc:mga05p37_429763_c1 nmdc:mga05p37_429763_c1_162_1475 406
257 iso_pu_bacteria 2888388044 2888390637 406
258 3300039453 Ga0436362_0484418 Ga0436362_0484418_52_1332 407
259 3300046519 Ga0495632_0000033 Ga0495632_0000033_337_1623 407
260 3300046665 Ga0495661_0033690 Ga0495661_0033690_1746_3032 407
261 3300048929 Ga0496126_0100005 Ga0496126_0100005_707_2008 407
262 iso_pu_bacteria 2513237096 2513658868 407
263 iso_pu_bacteria 2513237137 2513860874 407
264 iso_pu_bacteria 2513237145 2513921132 407
265 iso_pu_bacteria 2517572143 2517888896 407
266 iso_pu_bacteria 2524023228 2524536992 407
267 iso_pu_bacteria 2667528175 2671122502 407
268 iso_pu_bacteria 2728368998 2728755042 407
269 iso_pu_bacteria 2791355197 2793072986 407
270 iso_pu_bacteria 2818991450 2819619486 407
271 iso_pu_bacteria 2885374607 2885377504 407
272 iso_pu_bacteria 2903748898 2903752080 407
273 iso_pu_bacteria 2904690495 2904691146 407
274 iso_pu_bacteria 2904699407 2904708627 407
275 iso_pu_bacteria 2906610324 2906613924 407
276 iso_pu_bacteria 2906635258 2906642276 407
277 iso_pu_bacteria 2906660503 2906667304 407
278 iso_pu_bacteria 2908739725 2908747499 407
279 iso_pu_bacteria 2908756301 2908756540 407
280 iso_pu_bacteria 2922425934 2922434168 407
281 iso_pu_bacteria 2928108538 2928111487 407
282 iso_pu_bacteria 2928135762 2928138289 407
283 iso_pu_bacteria 2928503688 2928504903 407
284 iso_pu_bacteria 2935630451 2935637085 407
285 iso_pu_bacteria 2941507105 2941513648 407
286 iso_pu_bacteria 2941515067 2941521611 407
287 iso_pu_bacteria 2941523033 2941529440 407
288 iso_pu_bacteria 3005474847 3005475122 407
289 iso_pu_bacteria 8006933436 8006936169 407
290 iso_pu_bacteria 8006973647 8006976115 407
291 iso_pu_bacteria 8019555841 8019562490 407
292 iso_pu_bacteria 8019565922 8019572564 407
293 iso_pu_bacteria 8056689827 8056691001 407
294 3300009551 Ga0105238_10181111 Ga0105238_101811111 408
295 3300049571 Ga0501034_0089372 Ga0501034_0089372_386_1666 408
296 iso_pu_bacteria 2507262055 2507505319 408
297 iso_pu_bacteria 2508501042 2508695528 408
298 iso_pu_bacteria 2508501128 2509151882 408
299 iso_pu_bacteria 2511231028 2511394335 408
300 iso_pu_bacteria 2513237095 2513651471 408
301 iso_pu_bacteria 2513237102 2513699904 408
302 iso_pu_bacteria 2513237141 2513888813 408
303 iso_pu_bacteria 2515154112 2515627486 408
304 iso_pu_bacteria 2517093001 2517107152 408
305 iso_pu_bacteria 2524023205 2524440846 408
306 iso_pu_bacteria 2524023210 2524469505 408
307 iso_pu_bacteria 2528768022 2528854063 408
308 iso_pu_bacteria 2744054633 2745081734 408
309 iso_pu_bacteria 2791355196 2793062088 408
310 iso_pu_bacteria 2816332527 2818237694 408
311 iso_pu_bacteria 2824600985 2824604538 408
312 iso_pu_bacteria 2824609381 2824612371 408
313 iso_pu_bacteria 2824617872 2824625690 408
314 iso_pu_bacteria 2824626560 2824631643 408
315 iso_pu_bacteria 2824635225 2824642067 408
316 iso_pu_bacteria 2824644064 2824651449 408
317 iso_pu_bacteria 2824653114 2824659963 408
318 iso_pu_bacteria 2824661429 2824670261 408
319 iso_pu_bacteria 2824714736 2824721285 408
320 iso_pu_bacteria 2824723954 2824731293 408
321 iso_pu_bacteria 2824753945 2824762645 408
322 iso_pu_bacteria 2824763712 2824772715 408
323 iso_pu_bacteria 2841957949 2841965578 408
324 iso_pu_bacteria 2842038055 2842043465 408
325 iso_pu_bacteria 2842045827 2842052545 408
326 iso_pu_bacteria 2844315083 2844315384 408
327 iso_pu_bacteria 2849076700 2849083076 408
328 iso_pu_bacteria 2857509624 2857511968 408
329 iso_pu_bacteria 2874590934 2874594490 408
330 iso_pu_bacteria 2874620515 2874624832 408
331 iso_pu_bacteria 2874628541 2874628743 408
332 iso_pu_bacteria 2874645413 2874649862 408
333 iso_pu_bacteria 2876761206 2876770946 408
334 iso_pu_bacteria 2876771140 2876773982 408
335 iso_pu_bacteria 2876818435 2876821862 408
336 iso_pu_bacteria 2879074833 2879078294 408
337 iso_pu_bacteria 2879099564 2879105978 408
338 iso_pu_bacteria 2879127579 2879130554 408
339 iso_pu_bacteria 2879142872 2879147170 408
340 iso_pu_bacteria 2881364244 2881365277 408
341 iso_pu_bacteria 2881665667 2881668142 408
342 iso_pu_bacteria 2885383462 2885392603 408
343 iso_pu_bacteria 2885409591 2885411619 408
344 iso_pu_bacteria 2888378607 2888379542 408
345 iso_pu_bacteria 2888419890 2888420260 408
346 iso_pu_bacteria 2903727486 2903732243 408
347 iso_pu_bacteria 2903768456 2903771820 408
348 iso_pu_bacteria 2904666416 2904670213 408
349 iso_pu_bacteria 2904711408 2904713230 408
350 iso_pu_bacteria 2906602504 2906604322 408
351 iso_pu_bacteria 2922368715 2922369531 408
352 iso_pu_bacteria 2929615660 2929618647 408
353 iso_pu_bacteria 2929624759 2929628668 408
354 iso_pu_bacteria 2932784394 2932790826 408
355 iso_pu_bacteria 2932794094 2932794269 408
356 iso_pu_bacteria 2932801729 2932808137 408
357 iso_pu_bacteria 2932809354 2932812121 408
358 iso_pu_bacteria 2932818245 2932823111 408
359 iso_pu_bacteria 2932828146 2932833513 408
360 iso_pu_bacteria 2933577622 2933580641 408
361 iso_pu_bacteria 2935616580 2935623069 408
362 iso_pu_bacteria 2935638405 2935644144 408
363 iso_pu_bacteria 2935648319 2935653576 408
364 iso_pu_bacteria 2935656913 2935662325 408
365 iso_pu_bacteria 2935665750 2935672274 408
366 iso_pu_bacteria 2935675223 2935679201 408
367 iso_pu_bacteria 2935684952 2935686447 408
368 iso_pu_bacteria 2935694250 2935700227 408
369 iso_pu_bacteria 2935703347 2935710176 408
370 iso_pu_bacteria 2935713505 2935716135 408
371 iso_pu_bacteria 2935722832 2935723741 408
372 iso_pu_bacteria 2935732158 2935735296 408
373 iso_pu_bacteria 2935741537 2935743913 408
374 iso_pu_bacteria 2935750917 2935752413 408
375 iso_pu_bacteria 2935760218 2935763491 408
376 iso_pu_bacteria 2935769743 2935772995 408
377 iso_pu_bacteria 2935777560 2935782938 408
378 iso_pu_bacteria 2935785616 2935788017 408
379 iso_pu_bacteria 2935793552 2935796407 408
380 iso_pu_bacteria 2935801545 2935808168 408
381 iso_pu_bacteria 2935810662 2935816219 408
382 iso_pu_bacteria 2935827899 2935833612 408
383 iso_pu_bacteria 2935837841 2935844565 408
384 iso_pu_bacteria 2935855204 2935861317 408
385 iso_pu_bacteria 2935864058 2935869436 408
386 iso_pu_bacteria 2935873716 2935879765 408
387 iso_pu_bacteria 2935883170 2935890047 408
388 iso_pu_bacteria 2935975950 2935980659 408
389 iso_pu_bacteria 2935984226 2935985186 408
390 iso_pu_bacteria 2935992306 2935998012 408
391 iso_pu_bacteria 2936002035 2936008722 408
392 iso_pu_bacteria 2936011229 2936016627 408
393 iso_pu_bacteria 2936019824 2936025260 408
394 iso_pu_bacteria 2936028420 2936034102 408
395 iso_pu_bacteria 2936037263 2936041224 408
396 iso_pu_bacteria 2936046547 2936052159 408
397 iso_pu_bacteria 2936055302 2936056358 408
398 iso_pu_bacteria 2940556831 2940558326 408
399 iso_pu_bacteria 2941531003 2941535468 408
400 iso_pu_bacteria 2941538514 2941543250 408
401 iso_pu_bacteria 3005594810 3005595098 408
402 iso_pu_bacteria 3005718088 3005718349 408
403 iso_pu_bacteria 8016511872 8016518138 408
404 iso_pu_bacteria 8016530956 8016539807 408
405 iso_pu_bacteria 8016575299 8016582127 408
406 iso_pu_bacteria 8016595262 8016595659 408
407 iso_pu_bacteria 8016603502 8016606516 408
408 iso_pu_bacteria 8016613128 8016618415 408
409 iso_pu_bacteria 8016622563 8016623057 408
410 iso_pu_bacteria 8016630954 8016635577 408
411 iso_pu_bacteria 8017057580 8017058508 408
412 iso_pu_bacteria 8019530166 8019531084 408
413 iso_pu_bacteria 8019538911 8019540473 408
414 iso_pu_bacteria 8019547302 8019550061 408
415 iso_pu_bacteria 8019576017 8019577185 408
416 iso_pu_bacteria 8019597564 8019606490 408
417 iso_pu_bacteria 8019608314 8019612031 408
418 iso_pu_bacteria 8019629233 8019630085 408
419 iso_pu_bacteria 8019638758 8019640526 408
420 iso_pu_bacteria 8019648815 8019652420 408
421 iso_pu_bacteria 8019659431 8019666920 408
422 iso_pu_bacteria 8019668869 8019676678 408
423 iso_pu_bacteria 8019678201 8019679315 408
424 iso_pu_bacteria 8055742211 8055742497 408
425 iso_pu_bacteria 8056681323 8056686571 408
426 iso_pu_bacteria 8056967851 8056971335 408
427 3300025295 Ga0209564_1000893 Ga0209564_100089315 409
428 3300044656 Ga0466969_0002550 Ga0466969_0002550_3891_5234 409
429 3300044683 Ga0466965_0000619 Ga0466965_0000619_4350_5693 409
430 3300044684 Ga0466966_0037473 Ga0466966_0037473_828_2171 409
431 3300044693 Ga0466961_0164686 Ga0466961_0164686_67_1356 409
432 3300044694 Ga0466963_0003085 Ga0466963_0003085_7268_8611 409
433 3300044719 Ga0466971_0011223 Ga0466971_0011223_1171_2514 409
434 3300044765 Ga0466970_0035983 Ga0466970_0035983_396_1706 409
435 3300044765 Ga0466970_0099823 Ga0466970_0099823_92_1381 409
436 3300045049 Ga0466959_0056406 Ga0466959_0056406_1033_2322 409
437 3300049568 Ga0501031_0135917 Ga0501031_0135917_52_1341 409
438 3300049589 Ga0501073_0082297 Ga0501073_0082297_164_1453 409
439 3300061719 Ga0466962_0009667 Ga0466962_0009667_829_2172 409
440 3300061719 Ga0466962_0014901 Ga0466962_0014901_302_1591 409
441 iso_pu_bacteria 2602042107 2603858564 409
442 iso_pu_bacteria 2893066018 2893067412 409
443 iso_pu_bacteria 2919073203 2919073835 409
444 3300025906 Ga0207699_10031288 Ga0207699_100312882 410
445 iso_pu_bacteria 2889306138 2889306502 410
446 iso_pu_bacteria 2902330777 2902332399 410
447 iso_pu_bacteria 2902405164 2902411436 410
448 3300001989 JGI24739J22299_10015113 JGI24739J22299_100151132 411
449 3300005367 Ga0070667_100019760 Ga0070667_1000197603 411
450 3300005437 Ga0070710_10051362 Ga0070710_100513621 411
451 3300005439 Ga0070711_100011167 Ga0070711_1000111674 411
452 3300005439 Ga0070711_100011297 Ga0070711_1000112972 411
453 3300005563 Ga0068855_100081086 Ga0068855_1000810863 411
454 3300006163 Ga0070715_10007836 Ga0070715_100078362 411
455 3300006175 Ga0070712_100011675 Ga0070712_1000116752 411
456 3300009011 Ga0105251_10001287 Ga0105251_100012875 411
457 3300015262 Ga0182007_10000995 Ga0182007_100009952 411
458 3300025735 Ga0207713_1001504 Ga0207713_10015045 411
459 3300025898 Ga0207692_10025781 Ga0207692_100257811 411
460 3300025904 Ga0207647_10003817 Ga0207647_100038176 411
461 3300025916 Ga0207663_10000968 Ga0207663_100009687 411
462 3300046472 Ga0495580_0009499 Ga0495580_0009499_5784_7091 411
463 3300046524 Ga0495648_0003019 Ga0495648_0003019_11833_13128 411
464 3300047317 Ga0495604_0058048 Ga0495604_0058048_709_2016 411
465 3300047319 Ga0495674_0009111 Ga0495674_0009111_1364_2671 411
466 3300048909 Ga0496106_0000007 Ga0496106_0000007_132288_133634 411
467 3300048920 Ga0496117_0113175 Ga0496117_0113175_26_1333 411
468 3300048921 Ga0496118_0001470 Ga0496118_0001470_3102_4409 411
469 3300048924 Ga0496121_0008105 Ga0496121_0008105_2096_3442 411
470 3300048929 Ga0496126_0013831 Ga0496126_0013831_2888_4183 411
471 3300053153 Ga0500616_0000127 Ga0500616_0000127_111339_112634 411
472 iso_pu_bacteria 2526164713 2527078319 411
473 iso_pu_bacteria 2738541296 2738823478 411
474 iso_pu_bacteria 2738541298 2738835869 411
475 iso_pu_bacteria 2738541306 2738877524 411
476 iso_pu_bacteria 2738543002 2739189230 411
477 iso_pu_bacteria 2738543008 2739224117 411
478 iso_pu_bacteria 2842454564 2842460500 411
479 iso_pu_bacteria 2900634093 2900641582 411
480 iso_pu_bacteria 2904483920 2904489708 411
481 iso_pu_bacteria 2919527303 2919532773 411
482 iso_pu_bacteria 2945934425 2945939916 411
483 iso_pu_bacteria 2990703756 2990707037 411
484 iso_pu_bacteria 641736151 642426707 411
485 iso_pu_bacteria 8055266321 8055270474 411
486 iso_pu_bacteria 8055301274 8055306512 411
487 3300002067 JGI24735J21928_10001300 JGI24735J21928_100013003 412
488 3300003215 JGI25153J46596_10008743 JGI25153J46596_100087432 412
489 3300003354 JGI25160J50197_1001638 JGI25160J50197_10016386 412
490 3300003354 JGI25160J50197_1006563 JGI25160J50197_10065635 412
491 3300005262 Ga0065165_1013353 Ga0065165_10133532 412
492 3300005327 Ga0070658_10021552 Ga0070658_100215523 412
493 3300005327 Ga0070658_10140961 Ga0070658_101409612 412
494 3300005336 Ga0070680_100161931 Ga0070680_1001619312 412
495 3300005338 Ga0068868_100135810 Ga0068868_1001358101 412
496 3300005339 Ga0070660_100001445 Ga0070660_1000014456 412
497 3300005435 Ga0070714_100062995 Ga0070714_1000629952 412
498 3300005439 Ga0070711_100014219 Ga0070711_1000142192 412
499 3300005458 Ga0070681_10096508 Ga0070681_100965082 412
500 3300005471 Ga0070698_100025240 Ga0070698_1000252402 412
501 3300005530 Ga0070679_100070910 Ga0070679_1000709102 412
502 3300005536 Ga0070697_100125926 Ga0070697_1001259262 412
503 3300005548 Ga0070665_100015751 Ga0070665_1000157512 412
504 3300005563 Ga0068855_100009982 Ga0068855_1000099827 412
505 3300005563 Ga0068855_100015639 Ga0068855_1000156398 412
506 3300005983 Ga0081540_1004294 Ga0081540_10042941 412
507 3300006028 Ga0070717_10002236 Ga0070717_100022362 412
508 3300006237 Ga0097621_100046443 Ga0097621_1000464432 412
509 3300006358 Ga0068871_100220908 Ga0068871_1002209082 412
510 3300007265 Ga0099794_10031473 Ga0099794_100314732 412
511 3300009093 Ga0105240_10013962 Ga0105240_1001396211 412
512 3300009093 Ga0105240_10032474 Ga0105240_100324744 412
513 3300009093 Ga0105240_10232109 Ga0105240_102321092 412
514 3300009177 Ga0105248_10184864 Ga0105248_101848641 412
515 3300009545 Ga0105237_10003198 Ga0105237_1000319813 412
516 3300009545 Ga0105237_10017007 Ga0105237_100170073 412
517 3300013100 Ga0157373_10006624 Ga0157373_100066242 412
518 3300013104 Ga0157370_10003240 Ga0157370_1000324011 412
519 3300013105 Ga0157369_10004182 Ga0157369_100041825 412
520 3300013105 Ga0157369_10018879 Ga0157369_100188793 412
521 3300013296 Ga0157374_10000219 Ga0157374_1000021910 412
522 3300013297 Ga0157378_10006645 Ga0157378_100066452 412
523 3300013307 Ga0157372_10002581 Ga0157372_100025819 412
524 3300021358 Ga0213873_10009034 Ga0213873_100090341 412
525 3300021441 Ga0213871_10000755 Ga0213871_100007553 412
526 3300025228 Ga0209672_100175 Ga0209672_10017515 412
527 3300025256 Ga0209759_1019120 Ga0209759_10191202 412
528 3300025295 Ga0209564_1005573 Ga0209564_10055734 412
529 3300025297 Ga0209758_1003514 Ga0209758_10035149 412
530 3300025302 Ga0207426_1000420 Ga0207426_100042040 412
531 3300025302 Ga0207426_1009896 Ga0207426_10098962 412
532 3300025906 Ga0207699_10030227 Ga0207699_100302272 412
533 3300025909 Ga0207705_10086447 Ga0207705_100864472 412
534 3300025913 Ga0207695_10001820 Ga0207695_1000182010 412
535 3300025913 Ga0207695_10058124 Ga0207695_100581242 412
536 3300025914 Ga0207671_10005387 Ga0207671_100053873 412
537 3300025914 Ga0207671_10019380 Ga0207671_100193805 412
538 3300025915 Ga0207693_10047236 Ga0207693_100472362 412
539 3300025919 Ga0207657_10003541 Ga0207657_100035415 412
540 3300025921 Ga0207652_10012393 Ga0207652_100123932 412
541 3300025929 Ga0207664_10077427 Ga0207664_100774272 412
542 3300025945 Ga0207679_10036408 Ga0207679_100364083 412
543 3300025949 Ga0207667_10007034 Ga0207667_100070342 412
544 3300026023 Ga0207677_10105334 Ga0207677_101053342 412
545 3300026041 Ga0207639_10138607 Ga0207639_101386072 412
546 3300026089 Ga0207648_10144107 Ga0207648_101441072 412
547 3300026118 Ga0207675_100176955 Ga0207675_1001769552 412
548 3300026121 Ga0207683_10039608 Ga0207683_100396083 412
549 3300031235 Ga0265330_10006512 Ga0265330_100065122 412
550 3300031247 Ga0265340_10002209 Ga0265340_100022095 412
551 3300031249 Ga0265339_10001277 Ga0265339_100012778 412
552 3300033180 Ga0307510_10002474 Ga0307510_1000247415 412
553 3300035695 Ga0373927_0076765 Ga0373927_0076765_692_1990 412
554 3300037418 Ga0395900_0139516 Ga0395900_0139516_357_1667 412
555 3300037466 Ga0395898_0010898 Ga0395898_0010898_4269_5579 412
556 3300037466 Ga0395898_0023482 Ga0395898_0023482_1666_2964 412
557 3300037466 Ga0395898_0245406 Ga0395898_0245406_368_1666 412
558 3300042005 Ga0439448_0000169 Ga0439448_0000169_3095_4405 412
559 3300044901 Ga0466960_0077862 Ga0466960_0077862_93_1388 412
560 3300046460 Ga0495638_0005996 Ga0495638_0005996_673_1968 412
561 3300046692 Ga0495671_0082549 Ga0495671_0082549_38_1333 412
562 3300048903 Ga0496100_0012929 Ga0496100_0012929_3228_4526 412
563 3300048907 Ga0496104_0080044 Ga0496104_0080044_715_2013 412
564 3300048908 Ga0496105_0106172 Ga0496105_0106172_517_1815 412
565 3300048910 Ga0496107_0005366 Ga0496107_0005366_5083_6381 412
566 3300048912 Ga0496109_0089973 Ga0496109_0089973_59_1357 412
567 3300048915 Ga0496112_0087087 Ga0496112_0087087_1646_2944 412
568 3300048916 Ga0496113_0012420 Ga0496113_0012420_2859_4157 412
569 3300048917 Ga0496114_0102459 Ga0496114_0102459_1092_2387 412
570 3300048918 Ga0496115_0002653 Ga0496115_0002653_3600_4898 412
571 3300048921 Ga0496118_0039401 Ga0496118_0039401_452_1750 412
572 3300048922 Ga0496119_0064703 Ga0496119_0064703_822_2120 412
573 3300048924 Ga0496121_0000893 Ga0496121_0000893_38200_39498 412
574 3300048924 Ga0496121_0123379 Ga0496121_0123379_412_1710 412
575 3300048927 Ga0496124_0042565 Ga0496124_0042565_2239_3534 412
576 3300048929 Ga0496126_0034856 Ga0496126_0034856_2648_3946 412
577 3300050492 nmdc:mga0yw44_8827_c1 nmdc:mga0yw44_8827_c1_1537_2832 412
578 3300053087 Ga0500643_000063 Ga0500643_000063_101345_102640 412
579 3300053091 Ga0500647_0004754 Ga0500647_0004754_1762_3060 412
580 3300053092 Ga0500583_0003937 Ga0500583_0003937_789_2084 412
581 3300053094 Ga0500566_0000150 Ga0500566_0000150_16664_17962 412
582 3300053095 Ga0500640_011476 Ga0500640_011476_545_1843 412
583 3300053104 Ga0500556_0013044 Ga0500556_0013044_713_2008 412
584 3300053116 Ga0500592_008151 Ga0500592_008151_222_1517 412
585 3300053119 Ga0500595_002380 Ga0500595_002380_4693_5991 412
586 3300053153 Ga0500616_0009016 Ga0500616_0009016_1734_3029 412
587 3300053159 Ga0500630_017330 Ga0500630_017330_618_1916 412
588 3300053160 Ga0500633_0041440 Ga0500633_0041440_176_1471 412
589 3300053178 Ga0500637_0063215 Ga0500637_0063215_727_2025 412
590 3300053736 Ga0500599_000158 Ga0500599_000158_86_1381 412
591 iso_pu_bacteria 2513237098 2513675091 412
592 3300005468 Ga0070707_100137078 Ga0070707_1001370781 413
593 3300006178 Ga0075367_10024122 Ga0075367_100241223 413
594 3300006186 Ga0075369_10009131 Ga0075369_100091314 413
595 3300025295 Ga0209564_1012951 Ga0209564_10129513 413
596 3300025910 Ga0207684_10002632 Ga0207684_1000263211 413
597 3300025922 Ga0207646_10042066 Ga0207646_100420662 413
598 3300026067 Ga0207678_10029354 Ga0207678_100293545 413
599 3300028786 Ga0307517_10000024 Ga0307517_10000024123 413
600 3300028794 Ga0307515_10102094 Ga0307515_101020943 413
601 3300037853 Ga0436364_0365508 Ga0436364_0365508_1835_3148 413
602 3300046513 Ga0495616_0008096 Ga0495616_0008096_1422_2726 413
603 3300046616 Ga0495668_0065004 Ga0495668_0065004_614_1918 413
604 3300046691 Ga0495670_0022022 Ga0495670_0022022_271_1575 413
605 3300046692 Ga0495671_0039010 Ga0495671_0039010_954_2258 413
606 3300048919 Ga0496116_0003593 Ga0496116_0003593_2754_4058 413
607 3300048924 Ga0496121_0011589 Ga0496121_0011589_2705_4009 413
608 3300048926 Ga0496123_0035736 Ga0496123_0035736_1947_3251 413
609 3300048927 Ga0496124_0148291 Ga0496124_0148291_483_1787 413
610 3300048928 Ga0496125_0040402 Ga0496125_0040402_251_1555 413
611 3300049459 Ga0495678_021863 Ga0495678_021863_1258_2562 413
612 3300050494 nmdc:mga06z11_9333_c1 nmdc:mga06z11_9333_c1_2143_3447 413
613 3300053086 Ga0500578_0034637 Ga0500578_0034637_1100_2404 413
614 3300053090 Ga0500646_0002286 Ga0500646_0002286_3224_4528 413
615 3300053093 Ga0500651_0017933 Ga0500651_0017933_1857_3161 413
616 3300053094 Ga0500566_0000871 Ga0500566_0000871_8016_9320 413
617 3300053098 Ga0500650_0022885 Ga0500650_0022885_1145_2449 413
618 3300053104 Ga0500556_0000006 Ga0500556_0000006_298192_299496 413
619 3300053119 Ga0500595_025276 Ga0500595_025276_740_2041 413
620 3300053122 Ga0500608_000342 Ga0500608_000342_13833_15137 413
621 3300053125 Ga0500618_010713 Ga0500618_010713_619_1923 413
622 3300053130 Ga0500642_0000004 Ga0500642_0000004_187450_188754 413
623 3300053131 Ga0500652_000776 Ga0500652_000776_2291_3610 413
624 3300053136 Ga0500559_0005538 Ga0500559_0005538_2250_3554 413
625 3300053139 Ga0500568_0042665 Ga0500568_0042665_443_1747 413
626 3300053151 Ga0500604_0004291 Ga0500604_0004291_2292_3596 413
627 3300053153 Ga0500616_0000022 Ga0500616_0000022_292690_293994 413
628 3300053156 Ga0500622_0000837 Ga0500622_0000837_13357_14661 413
629 3300053177 Ga0500636_0009453 Ga0500636_0009453_1111_2415 413
630 iso_pu_bacteria 2545555834 2545676492 413
631 iso_pu_bacteria 641522639 641641323 413
632 3300005327 Ga0070658_10003071 Ga0070658_100030712 414
633 3300005366 Ga0070659_100029202 Ga0070659_1000292023 414
634 3300005563 Ga0068855_100013142 Ga0068855_1000131428 414
635 3300009093 Ga0105240_10189508 Ga0105240_101895082 414
636 3300013104 Ga0157370_10004494 Ga0157370_100044942 414
637 3300013105 Ga0157369_10000320 Ga0157369_100003202 414
638 3300025909 Ga0207705_10000864 Ga0207705_1000086417 414
639 3300025932 Ga0207690_10005558 Ga0207690_100055583 414
640 3300025949 Ga0207667_10001900 Ga0207667_1000190013 414
641 3300044658 Ga0466972_0050982 Ga0466972_0050982_563_1882 414
642 3300044694 Ga0466963_0008953 Ga0466963_0008953_1003_2322 414
643 3300046457 Ga0495590_0014755 Ga0495590_0014755_1442_2743 414
644 3300046459 Ga0495629_0000116 Ga0495629_0000116_16765_18066 414
645 3300046460 Ga0495638_0002571 Ga0495638_0002571_7752_9053 414
646 3300046463 Ga0495653_0001724 Ga0495653_0001724_12129_13430 414
647 3300046471 Ga0495650_0023020 Ga0495650_0023020_58_1359 414
648 3300046472 Ga0495580_0038307 Ga0495580_0038307_1470_2771 414
649 3300046474 Ga0495605_0005618 Ga0495605_0005618_2794_4095 414
650 3300046516 Ga0495628_0117156 Ga0495628_0117156_339_1640 414
651 3300046524 Ga0495648_0041306 Ga0495648_0041306_1172_2473 414
652 3300046529 Ga0495652_0100833 Ga0495652_0100833_977_2278 414
653 3300046680 Ga0495646_0035480 Ga0495646_0035480_225_1526 414
654 3300046690 Ga0495624_0009833 Ga0495624_0009833_4654_5955 414
655 3300046690 Ga0495624_0034395 Ga0495624_0034395_664_1965 414
656 3300047317 Ga0495604_0047316 Ga0495604_0047316_1157_2458 414
657 3300047323 Ga0495683_0018805 Ga0495683_0018805_652_1953 414
658 3300047446 Ga0495679_000026 Ga0495679_000026_178463_179764 414
659 3300048921 Ga0496118_0046245 Ga0496118_0046245_2035_3336 414
660 3300048924 Ga0496121_0008996 Ga0496121_0008996_8764_10065 414
661 3300049575 Ga0501039_0092666 Ga0501039_0092666_305_1624 414
662 3300061719 Ga0466962_0002559 Ga0466962_0002559_1807_3126 414
663 3300001979 JGI24740J21852_10010583 JGI24740J21852_100105832 415
664 3300001989 JGI24739J22299_10011334 JGI24739J22299_100113342 415
665 3300002067 JGI24735J21928_10004466 JGI24735J21928_100044664 415
666 3300002705 JGI25156J39149_1000818 JGI25156J39149_100081813 415
667 3300002705 JGI25156J39149_1003696 JGI25156J39149_10036963 415
668 3300003214 JGI25165J46597_1001442 JGI25165J46597_10014429 415
669 3300003756 Ga0055533_1000091 Ga0055533_100009115 415
670 3300003756 Ga0055533_1001086 Ga0055533_10010864 415
671 3300005455 Ga0070663_100117605 Ga0070663_1001176052 415
672 3300025226 Ga0209674_100074 Ga0209674_10007416 415
673 3300025226 Ga0209674_100102 Ga0209674_10010212 415
674 3300025230 Ga0209563_100409 Ga0209563_10040915 415
675 3300025231 Ga0207427_102427 Ga0207427_1024274 415
676 3300025256 Ga0209759_1000009 Ga0209759_100000916 415
677 3300025256 Ga0209759_1000078 Ga0209759_100007814 415
678 3300025261 Ga0209233_1000144 Ga0209233_100014416 415
679 3300025904 Ga0207647_10022300 Ga0207647_100223003 415
680 3300025904 Ga0207647_10028796 Ga0207647_100287961 415
681 3300031548 Ga0307408_100010843 Ga0307408_1000108433 415
682 3300031731 Ga0307405_10115506 Ga0307405_101155062 415
683 3300031911 Ga0307412_10000041 Ga0307412_10000041154 415
684 3300046454 Ga0495592_0021268 Ga0495592_0021268_248_1549 415
685 3300046457 Ga0495590_0004409 Ga0495590_0004409_3447_4748 415
686 3300046471 Ga0495650_0038365 Ga0495650_0038365_25_1326 415
687 3300046474 Ga0495605_0004386 Ga0495605_0004386_2595_3896 415
688 3300046507 Ga0495606_0039566 Ga0495606_0039566_409_1710 415
689 3300046512 Ga0495610_0002054 Ga0495610_0002054_5675_6976 415
690 3300046516 Ga0495628_0094740 Ga0495628_0094740_256_1557 415
691 3300046526 Ga0495666_0035763 Ga0495666_0035763_758_2059 415
692 3300046559 Ga0495667_0038343 Ga0495667_0038343_655_1956 415
693 3300046690 Ga0495624_0022770 Ga0495624_0022770_1020_2321 415
694 3300046694 Ga0495649_0016179 Ga0495649_0016179_2515_3816 415
695 3300046794 Ga0495589_0017669 Ga0495589_0017669_2127_3428 415
696 3300047315 Ga0495581_0019686 Ga0495581_0019686_108_1409 415
697 3300047323 Ga0495683_0004328 Ga0495683_0004328_759_2060 415
698 3300047443 Ga0495687_032963 Ga0495687_032963_260_1561 415
699 3300048921 Ga0496118_0007125 Ga0496118_0007125_5558_6859 415
700 3300049460 Ga0495682_0059543 Ga0495682_0059543_44_1345 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

109

260

0.94

PF07690

MFS_1

Major Facilitator Superfamily

330

476

0.9

PF07690

MFS_1

Major Facilitator Superfamily

83

374

0.86

PF00083

Sugar_tr

Sugar (and other) transporter

257

475

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8et9-assembly1.cif.gz_A cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium 0.8444 63 413
8et8-assembly1.cif.gz_A cryo-em structure of the organic cation transporter 1 in complex with verapamil 0.8259 75 413
5c65-assembly2.cif.gz_B structure of the human glucose transporter glut3 / slc2a3 0.8203 30 411
6zgs-assembly1.cif.gz_A crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution 0.82 31 408
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.8189 34 410
ID Description Score Start End Superfamily
af_Q54UC8_60_259_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9433 35 231 1.20.1250.20
af_A0A1D8PLY7_67_271_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9352 29 231 1.20.1250.20
af_P53322_81_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9334 34 210 1.20.1250.20
af_O95528_5_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9326 31 210 1.20.1250.20
af_A0A1D8PPX9_28_226_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9323 34 218 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A258J912-F1-model_v4 MFS transporter 0.9717 20 249 GO:0005886
GO:0046943
AF-A0A318JDI3-F1-model_v4 MFS transporter 0.9651 16 212 GO:0005886
GO:0046943
AF-A0A4Q6FBK0-F1-model_v4 deleted 0.9479 21 391
AF-B0T8Y4-F1-model_v4 Major facilitator superfamily MFS_1 0.9471 26 413 GO:0005886
GO:0046943
AF-A0A2V8MHX1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9425 14 230 GO:0005886
GO:0046943

Feature Viewer

pLDDT pTM Quality
86.59 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map