F476128
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 505 | 475 | 426 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237098|2513675091 |
| Length | 477 |
| Sequence | FSHKGRREGRGPYIFLRNHRDKFNFPANRPHAIAPIKKKLAETSNMTTSEPSKAMEVAEIHDTSLLAFYRDMNLQERRTFWACASGWALDGMDFMIYPLVIGTIITLWKVDAGTAGLAGTVTLLSSAIGGWLGGYLADRIGRVRTLQLTILWFSFFSLVCAVAQNFDQLLIARAILGLGFGGEWAAGAVLMGEAIRPQYRGRAVGSVQSGWAVGWGLAVLAQAILFSILPAEIAWRWMFVIGALPALLVFYLRRYVTEPEIAAATREKQQAAGDRPSLWEIFHGPILKTTILASLAATGCQGGYYAITFWVPRFLTTERHLSIVTSTGYLAALIIGSFIGYLVGAWLADRIGRRNLFLTFSLGAIAVVLVYTQVEISNELLWVLGFPLGFFASGYFSGMGAFLTELYPTRLRGSGQGFCYNFGRGIGALFPFLVGALSTTTSLANAIAIFAVAAYAVFFLAAYALPETRGRVLHAEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 7 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 8 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 9 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 26 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 29 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 32 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 33 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 34 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 35 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 36 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 37 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 38 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 39 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 40 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 41 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 42 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 43 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 44 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 45 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 46 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 47 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 48 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 49 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 50 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 51 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 52 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 53 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 54 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 55 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 56 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 57 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 58 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 59 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 60 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 61 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 62 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 63 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 64 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 65 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 66 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 67 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 68 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 69 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 70 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 73 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 80 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 81 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 82 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 83 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 84 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 85 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 86 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 87 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 88 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 89 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 90 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 91 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 92 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 93 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 94 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 95 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 96 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 101 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 102 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 106 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 107 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 108 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 109 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 110 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 111 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 112 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 113 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 114 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 115 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 116 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 117 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 118 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 119 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 120 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 121 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 122 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 123 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 124 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 125 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 126 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 127 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 128 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 129 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 130 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 131 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 132 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 133 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 134 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 135 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 136 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 137 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 138 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 139 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 140 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 141 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 142 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 143 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 144 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 145 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 146 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 147 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 148 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 149 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 150 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 151 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 152 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 153 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 154 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 155 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 156 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 157 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 158 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 159 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 160 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 161 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 162 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 163 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 164 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 165 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 166 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 167 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 168 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 169 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 170 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 171 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 172 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 173 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 174 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 175 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 176 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 177 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 178 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 179 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 180 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 181 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 182 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 183 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 184 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 185 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 186 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 187 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 188 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 189 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 190 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 191 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 193 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 194 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 196 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 206 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 213 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 214 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 215 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 216 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 220 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 221 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 222 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 224 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 225 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 226 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 227 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 228 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 246 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 247 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 248 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 255 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 260 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 294 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 297 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 298 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 299 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 301 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 302 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 303 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 305 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 306 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 307 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 308 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 309 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 310 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 314 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 315 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 316 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 317 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 318 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 319 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 320 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 321 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 322 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 323 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 324 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 325 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 326 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 327 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 328 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 329 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 330 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 331 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 332 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 333 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 334 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 335 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 336 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 337 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 394 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 395 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 396 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 397 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 398 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 399 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 405 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 406 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 413 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 414 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 417 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 432 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 433 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 434 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 435 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 436 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 437 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 440 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 441 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 442 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 444 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 446 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 449 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 450 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 452 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 455 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 456 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 457 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 459 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 460 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 461 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 462 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 463 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 464 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 465 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 466 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 467 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 468 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 469 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 470 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 471 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 472 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 473 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 474 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 475 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 476 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 477 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 478 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 479 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 480 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 481 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 482 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 483 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 484 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 485 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 486 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 487 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 488 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 489 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 490 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 491 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 492 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 493 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 494 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 495 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 496 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 497 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 498 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 499 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 500 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 501 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 502 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 503 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 504 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 505 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.1 |
| Metatranscriptomes | 0.14 |
| Isolates | 31.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13 |
| Nodule | 21.14 |
| Rhizoplane | 5.29 |
| Rhizosphere | 43.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010583 | 3300001979 | Bacteria | 3544 |
| 2 | JGI24739J22299_10011334 | 3300001989 | Bacteria | 3293 |
| 3 | JGI24739J22299_10015113 | 3300001989 | Bacteria | 2806 |
| 4 | JGI24735J21928_10001300 | 3300002067 | Bacteria | 8849 |
| 5 | JGI24735J21928_10004466 | 3300002067 | Bacteria | 4702 |
| 6 | JGI25156J39149_1000818 | 3300002705 | Bacteria | 15851 |
| 7 | JGI25156J39149_1003696 | 3300002705 | Bacteria | 4904 |
| 8 | JGI25151J46595_10000164 | 3300003187 | Bacteria | 85682 |
| 9 | JGI25165J46597_1001442 | 3300003214 | Bacteria | 12650 |
| 10 | JGI25153J46596_10008743 | 3300003215 | Bacteria | 4798 |
| 11 | JGI25160J50197_1001638 | 3300003354 | Bacteria | 10988 |
| 12 | JGI25160J50197_1006481 | 3300003354 | Bacteria | 4730 |
| 13 | JGI25160J50197_1006563 | 3300003354 | Bacteria | 4689 |
| 14 | Ga0055539_1001505 | 3300003752 | Bacteria | 4276 |
| 15 | Ga0055533_1000091 | 3300003756 | Bacteria | 120504 |
| 16 | Ga0055533_1001086 | 3300003756 | Bacteria | 7797 |
| 17 | Ga0065165_1003030 | 3300005262 | Bacteria | 12651 |
| 18 | Ga0065165_1013353 | 3300005262 | Bacteria | 3272 |
| 19 | Ga0065704_10092281 | 3300005289 | Bacteria | 2664 |
| 20 | Ga0070658_10003071 | 3300005327 | Bacteria | 13779 |
| 21 | Ga0070658_10021552 | 3300005327 | Bacteria | 5164 |
| 22 | Ga0070658_10140961 | 3300005327 | Bacteria | 2014 |
| 23 | Ga0070683_100024865 | 3300005329 | Bacteria | 5370 |
| 24 | Ga0070680_100161931 | 3300005336 | Bacteria | 1880 |
| 25 | Ga0070682_100085173 | 3300005337 | Bacteria | 2056 |
| 26 | Ga0068868_100135810 | 3300005338 | Bacteria | 2016 |
| 27 | Ga0070660_100001445 | 3300005339 | Bacteria | 16232 |
| 28 | Ga0070661_100066102 | 3300005344 | Bacteria | 2657 |
| 29 | Ga0070671_100233971 | 3300005355 | Bacteria | 1559 |
| 30 | Ga0070659_100029202 | 3300005366 | Bacteria | 4261 |
| 31 | Ga0070667_100014967 | 3300005367 | Bacteria | 6408 |
| 32 | Ga0070667_100019760 | 3300005367 | Bacteria | 5589 |
| 33 | Ga0070714_100062995 | 3300005435 | Bacteria | 3187 |
| 34 | Ga0070710_10002720 | 3300005437 | Bacteria | 8411 |
| 35 | Ga0070710_10051362 | 3300005437 | Bacteria | 2314 |
| 36 | Ga0070711_100011167 | 3300005439 | Bacteria | 5570 |
| 37 | Ga0070711_100011297 | 3300005439 | Bacteria | 5541 |
| 38 | Ga0070711_100014219 | 3300005439 | Bacteria | 5012 |
| 39 | Ga0070663_100117605 | 3300005455 | Bacteria | 2004 |
| 40 | Ga0070681_10096508 | 3300005458 | Bacteria | 2904 |
| 41 | Ga0070707_100137078 | 3300005468 | Bacteria | 2381 |
| 42 | Ga0070698_100025240 | 3300005471 | Bacteria | 6192 |
| 43 | Ga0070679_100070910 | 3300005530 | Bacteria | 3475 |
| 44 | Ga0070684_100038231 | 3300005535 | Bacteria | 4121 |
| 45 | Ga0070697_100125926 | 3300005536 | Bacteria | 2146 |
| 46 | Ga0070665_100015751 | 3300005548 | Bacteria | 7596 |
| 47 | Ga0068855_100009982 | 3300005563 | Bacteria | 11442 |
| 48 | Ga0068855_100013142 | 3300005563 | Bacteria | 9985 |
| 49 | Ga0068855_100015639 | 3300005563 | Bacteria | 9129 |
| 50 | Ga0068855_100081086 | 3300005563 | Bacteria | 3762 |
| 51 | Ga0068855_100141958 | 3300005563 | Bacteria | 2736 |
| 52 | Ga0068861_100190632 | 3300005719 | Bacteria | 1713 |
| 53 | Ga0081455_10263653 | 3300005937 | Bacteria | 1254 |
| 54 | Ga0081540_1004294 | 3300005983 | Bacteria | 10918 |
| 55 | Ga0081540_1028192 | 3300005983 | Bacteria | 3160 |
| 56 | Ga0070717_10002236 | 3300006028 | Bacteria | 13563 |
| 57 | Ga0070715_10007836 | 3300006163 | Bacteria | 3693 |
| 58 | Ga0070712_100011675 | 3300006175 | Bacteria | 5579 |
| 59 | Ga0075367_10024122 | 3300006178 | Bacteria | 3430 |
| 60 | Ga0075369_10009131 | 3300006186 | Bacteria | 3842 |
| 61 | Ga0075366_10014497 | 3300006195 | Bacteria | 4501 |
| 62 | Ga0075366_10066322 | 3300006195 | Bacteria | 2147 |
| 63 | Ga0097621_100046443 | 3300006237 | Bacteria | 3514 |
| 64 | Ga0068871_100220908 | 3300006358 | Bacteria | 1641 |
| 65 | Ga0099824_1004053 | 3300006942 | Bacteria | 21200 |
| 66 | Ga0099824_1009679 | 3300006942 | Bacteria | 11728 |
| 67 | Ga0099822_1000007 | 3300006943 | Bacteria | 77453 |
| 68 | Ga0099823_1000074 | 3300006944 | Bacteria | 48327 |
| 69 | Ga0099794_10031473 | 3300007265 | Bacteria | 2484 |
| 70 | Ga0105251_10001287 | 3300009011 | Bacteria | 21693 |
| 71 | Ga0105244_10005320 | 3300009036 | Bacteria | 8572 |
| 72 | Ga0105244_10013814 | 3300009036 | Bacteria | 4699 |
| 73 | Ga0105240_10013962 | 3300009093 | Bacteria | 10996 |
| 74 | Ga0105240_10032474 | 3300009093 | Bacteria | 6758 |
| 75 | Ga0105240_10034797 | 3300009093 | Bacteria | 6495 |
| 76 | Ga0105240_10189508 | 3300009093 | Bacteria | 2419 |
| 77 | Ga0105240_10232109 | 3300009093 | Bacteria | 2144 |
| 78 | Ga0105245_10168629 | 3300009098 | Bacteria | 2083 |
| 79 | Ga0105248_10024563 | 3300009177 | Bacteria | 6701 |
| 80 | Ga0105248_10184864 | 3300009177 | Bacteria | 2348 |
| 81 | Ga0105237_10003198 | 3300009545 | Bacteria | 19646 |
| 82 | Ga0105237_10017007 | 3300009545 | Bacteria | 7548 |
| 83 | Ga0105238_10181111 | 3300009551 | Bacteria | 2084 |
| 84 | Ga0157373_10006624 | 3300013100 | Bacteria | 8637 |
| 85 | Ga0157370_10003240 | 3300013104 | Bacteria | 19205 |
| 86 | Ga0157370_10004494 | 3300013104 | Bacteria | 15984 |
| 87 | Ga0157369_10000320 | 3300013105 | Bacteria | 64393 |
| 88 | Ga0157369_10004182 | 3300013105 | Bacteria | 17103 |
| 89 | Ga0157369_10005521 | 3300013105 | Bacteria | 14687 |
| 90 | Ga0157369_10018879 | 3300013105 | Bacteria | 7726 |
| 91 | Ga0157369_10221247 | 3300013105 | Bacteria | 1982 |
| 92 | Ga0157374_10000219 | 3300013296 | Bacteria | 52748 |
| 93 | Ga0157374_10006943 | 3300013296 | Bacteria | 9631 |
| 94 | Ga0157378_10006645 | 3300013297 | Bacteria | 10105 |
| 95 | Ga0163162_10002420 | 3300013306 | Bacteria | 17574 |
| 96 | Ga0163162_10013288 | 3300013306 | Bacteria | 8042 |
| 97 | Ga0157372_10000598 | 3300013307 | Bacteria | 39369 |
| 98 | Ga0157372_10002581 | 3300013307 | Bacteria | 19627 |
| 99 | Ga0157372_10067061 | 3300013307 | Bacteria | 4032 |
| 100 | Ga0163163_10045070 | 3300014325 | Bacteria | 4328 |
| 101 | Ga0157379_10153371 | 3300014968 | Bacteria | 2078 |
| 102 | Ga0157376_10002020 | 3300014969 | Bacteria | 13604 |
| 103 | Ga0182007_10000995 | 3300015262 | Bacteria | 15560 |
| 104 | Ga0213873_10009034 | 3300021358 | Bacteria | 2056 |
| 105 | Ga0213871_10000755 | 3300021441 | Bacteria | 4785 |
| 106 | Ga0209674_100074 | 3300025226 | Bacteria | 223554 |
| 107 | Ga0209674_100102 | 3300025226 | Bacteria | 155582 |
| 108 | Ga0209672_100175 | 3300025228 | Bacteria | 53342 |
| 109 | Ga0209563_100409 | 3300025230 | Bacteria | 15214 |
| 110 | Ga0209563_103896 | 3300025230 | Bacteria | 2966 |
| 111 | Ga0207427_102427 | 3300025231 | Bacteria | 5042 |
| 112 | Ga0209677_100602 | 3300025253 | Bacteria | 19450 |
| 113 | Ga0209677_101634 | 3300025253 | Bacteria | 9449 |
| 114 | Ga0209148_1000282 | 3300025254 | Bacteria | 78016 |
| 115 | Ga0209148_1006766 | 3300025254 | Bacteria | 2446 |
| 116 | Ga0209759_1000009 | 3300025256 | Bacteria | 446623 |
| 117 | Ga0209759_1000078 | 3300025256 | Bacteria | 175373 |
| 118 | Ga0209759_1019120 | 3300025256 | Bacteria | 1634 |
| 119 | Ga0209233_1000144 | 3300025261 | Bacteria | 190024 |
| 120 | Ga0209233_1000493 | 3300025261 | Bacteria | 23838 |
| 121 | Ga0209233_1002848 | 3300025261 | Bacteria | 6200 |
| 122 | Ga0209233_1008675 | 3300025261 | Bacteria | 3128 |
| 123 | Ga0209455_1002484 | 3300025272 | Bacteria | 7086 |
| 124 | Ga0209130_1000522 | 3300025284 | Bacteria | 38769 |
| 125 | Ga0209025_1000061 | 3300025294 | Bacteria | 304827 |
| 126 | Ga0209564_1000893 | 3300025295 | Bacteria | 39189 |
| 127 | Ga0209564_1005573 | 3300025295 | Bacteria | 7111 |
| 128 | Ga0209564_1012951 | 3300025295 | Bacteria | 3586 |
| 129 | Ga0209758_1000730 | 3300025297 | Bacteria | 48039 |
| 130 | Ga0209758_1003514 | 3300025297 | Bacteria | 14143 |
| 131 | Ga0209758_1004217 | 3300025297 | Bacteria | 12175 |
| 132 | Ga0209758_1010070 | 3300025297 | Bacteria | 5729 |
| 133 | Ga0207426_1000420 | 3300025302 | Bacteria | 69895 |
| 134 | Ga0207426_1000641 | 3300025302 | Bacteria | 43707 |
| 135 | Ga0207426_1001303 | 3300025302 | Bacteria | 21427 |
| 136 | Ga0207426_1009896 | 3300025302 | Bacteria | 3737 |
| 137 | Ga0209257_1006584 | 3300025304 | Bacteria | 7406 |
| 138 | Ga0207696_1000010 | 3300025711 | Bacteria | 534681 |
| 139 | Ga0207655_1000197 | 3300025728 | Bacteria | 106282 |
| 140 | Ga0207655_1021092 | 3300025728 | Bacteria | 3320 |
| 141 | Ga0207713_1001504 | 3300025735 | Bacteria | 18424 |
| 142 | Ga0207713_1016483 | 3300025735 | Bacteria | 3748 |
| 143 | Ga0207692_10025781 | 3300025898 | Bacteria | 2751 |
| 144 | Ga0207647_10003817 | 3300025904 | Bacteria | 11266 |
| 145 | Ga0207647_10007864 | 3300025904 | Bacteria | 7669 |
| 146 | Ga0207647_10022300 | 3300025904 | Bacteria | 4208 |
| 147 | Ga0207647_10028796 | 3300025904 | Bacteria | 3603 |
| 148 | Ga0207699_10030227 | 3300025906 | Bacteria | 3029 |
| 149 | Ga0207699_10031288 | 3300025906 | Bacteria | 2986 |
| 150 | Ga0207705_10000864 | 3300025909 | Bacteria | 24824 |
| 151 | Ga0207705_10086447 | 3300025909 | Bacteria | 2292 |
| 152 | Ga0207684_10002632 | 3300025910 | Bacteria | 17956 |
| 153 | Ga0207695_10001820 | 3300025913 | Bacteria | 33567 |
| 154 | Ga0207695_10058124 | 3300025913 | Bacteria | 4015 |
| 155 | Ga0207671_10005387 | 3300025914 | Bacteria | 11813 |
| 156 | Ga0207671_10019380 | 3300025914 | Bacteria | 5202 |
| 157 | Ga0207693_10022371 | 3300025915 | Bacteria | 5024 |
| 158 | Ga0207693_10047236 | 3300025915 | Bacteria | 3382 |
| 159 | Ga0207663_10000968 | 3300025916 | Bacteria | 13119 |
| 160 | Ga0207663_10002301 | 3300025916 | Bacteria | 9151 |
| 161 | Ga0207657_10003541 | 3300025919 | Bacteria | 16685 |
| 162 | Ga0207652_10012393 | 3300025921 | Bacteria | 6889 |
| 163 | Ga0207646_10042066 | 3300025922 | Bacteria | 4106 |
| 164 | Ga0207664_10077427 | 3300025929 | Bacteria | 2694 |
| 165 | Ga0207690_10005558 | 3300025932 | Bacteria | 7443 |
| 166 | Ga0207661_10004345 | 3300025944 | Bacteria | 9925 |
| 167 | Ga0207679_10036408 | 3300025945 | Bacteria | 3490 |
| 168 | Ga0207667_10001900 | 3300025949 | Bacteria | 26214 |
| 169 | Ga0207667_10007034 | 3300025949 | Bacteria | 13594 |
| 170 | Ga0207658_10086804 | 3300025986 | Bacteria | 2414 |
| 171 | Ga0207677_10105334 | 3300026023 | Bacteria | 2087 |
| 172 | Ga0207639_10138607 | 3300026041 | Bacteria | 2024 |
| 173 | Ga0207678_10029354 | 3300026067 | Bacteria | 4799 |
| 174 | Ga0207678_10074721 | 3300026067 | Bacteria | 2904 |
| 175 | Ga0207648_10143015 | 3300026089 | Bacteria | 2109 |
| 176 | Ga0207648_10144107 | 3300026089 | Bacteria | 2101 |
| 177 | Ga0207674_10211016 | 3300026116 | Bacteria | 1891 |
| 178 | Ga0207675_100176955 | 3300026118 | Bacteria | 2041 |
| 179 | Ga0207683_10039608 | 3300026121 | Bacteria | 4112 |
| 180 | Ga0207698_10066465 | 3300026142 | Bacteria | 2838 |
| 181 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 182 | Ga0209389_1000063 | 3300027296 | Bacteria | 102403 |
| 183 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 184 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 185 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 186 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 187 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 188 | Ga0307517_10000024 | 3300028786 | Bacteria | 185597 |
| 189 | Ga0307515_10102094 | 3300028794 | Bacteria | 3454 |
| 190 | Ga0265338_10114999 | 3300028800 | Bacteria | 2158 |
| 191 | Ga0265760_10000882 | 3300031090 | Bacteria | 8669 |
| 192 | Ga0265330_10006512 | 3300031235 | Bacteria | 5774 |
| 193 | Ga0265340_10002209 | 3300031247 | Bacteria | 11138 |
| 194 | Ga0265339_10001277 | 3300031249 | Bacteria | 18834 |
| 195 | Ga0265327_10006119 | 3300031251 | Bacteria | 9743 |
| 196 | Ga0307408_100010843 | 3300031548 | Bacteria | 6013 |
| 197 | Ga0265342_10021291 | 3300031712 | Bacteria | 4144 |
| 198 | Ga0307405_10115506 | 3300031731 | Bacteria | 1826 |
| 199 | Ga0307412_10000041 | 3300031911 | Bacteria | 179188 |
| 200 | Ga0307510_10002474 | 3300033180 | Bacteria | 21007 |
| 201 | Ga0307510_10111077 | 3300033180 | Bacteria | 2483 |
| 202 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 203 | Ga0373927_0022849 | 3300035695 | Bacteria | 4096 |
| 204 | Ga0373927_0076765 | 3300035695 | Bacteria | 2163 |
| 205 | Ga0395900_0002352 | 3300037418 | Bacteria | 20935 |
| 206 | Ga0395900_0005446 | 3300037418 | Bacteria | 13337 |
| 207 | Ga0395900_0139516 | 3300037418 | Bacteria | 2483 |
| 208 | Ga0395900_0349623 | 3300037418 | Bacteria | 1452 |
| 209 | Ga0395898_0010389 | 3300037466 | Bacteria | 9734 |
| 210 | Ga0395898_0010898 | 3300037466 | Bacteria | 9487 |
| 211 | Ga0395898_0023482 | 3300037466 | Bacteria | 6230 |
| 212 | Ga0395898_0153209 | 3300037466 | Bacteria | 2205 |
| 213 | Ga0395898_0202294 | 3300037466 | Bacteria | 1896 |
| 214 | Ga0395898_0245406 | 3300037466 | Bacteria | 1708 |
| 215 | Ga0395905_0005266 | 3300037471 | Bacteria | 13232 |
| 216 | Ga0436364_0243938 | 3300037853 | Bacteria | 6883 |
| 217 | Ga0436364_0311122 | 3300037853 | Bacteria | 1539 |
| 218 | Ga0436364_0365508 | 3300037853 | Bacteria | 3664 |
| 219 | Ga0436364_0819535 | 3300037853 | Bacteria | 9315 |
| 220 | Ga0436364_1377417 | 3300037853 | Bacteria | 4312 |
| 221 | Ga0395901_0115458 | 3300038443 | Bacteria | 2820 |
| 222 | Ga0395901_0259177 | 3300038443 | Bacteria | 1810 |
| 223 | Ga0436361_0406165 | 3300039447 | Bacteria | 1560 |
| 224 | Ga0436361_0418089 | 3300039447 | Bacteria | 2426 |
| 225 | Ga0436363_0863035 | 3300039450 | Bacteria | 4611 |
| 226 | Ga0436362_0484418 | 3300039453 | Bacteria | 1761 |
| 227 | Ga0439447_004255 | 3300041407 | Bacteria | 4961 |
| 228 | Ga0439466_0000609 | 3300041411 | Bacteria | 13447 |
| 229 | Ga0439431_0002711 | 3300041997 | Bacteria | 3894 |
| 230 | Ga0439448_0000169 | 3300042005 | Bacteria | 13105 |
| 231 | Ga0439432_004237 | 3300042006 | Bacteria | 5244 |
| 232 | Ga0450922_001606 | 3300042124 | Bacteria | 2209 |
| 233 | Ga0466969_0002550 | 3300044656 | Bacteria | 9734 |
| 234 | Ga0466969_0006896 | 3300044656 | Bacteria | 6046 |
| 235 | Ga0466972_0000107 | 3300044658 | Bacteria | 71873 |
| 236 | Ga0466972_0050982 | 3300044658 | Bacteria | 1997 |
| 237 | Ga0466965_0000619 | 3300044683 | Bacteria | 12961 |
| 238 | Ga0466965_0010374 | 3300044683 | Bacteria | 4345 |
| 239 | Ga0466965_0067932 | 3300044683 | Bacteria | 1789 |
| 240 | Ga0466966_0000359 | 3300044684 | Bacteria | 29538 |
| 241 | Ga0466966_0037473 | 3300044684 | Bacteria | 3127 |
| 242 | Ga0466961_0000074 | 3300044693 | Bacteria | 61968 |
| 243 | Ga0466961_0164686 | 3300044693 | Bacteria | 1381 |
| 244 | Ga0466963_0003085 | 3300044694 | Bacteria | 9443 |
| 245 | Ga0466963_0008953 | 3300044694 | Bacteria | 6009 |
| 246 | Ga0466963_0008995 | 3300044694 | Bacteria | 5997 |
| 247 | Ga0466963_0042956 | 3300044694 | Bacteria | 2970 |
| 248 | Ga0466963_0059770 | 3300044694 | Bacteria | 2544 |
| 249 | Ga0466971_0011223 | 3300044719 | Bacteria | 3924 |
| 250 | Ga0466971_0077853 | 3300044719 | Bacteria | 1510 |
| 251 | Ga0466970_0035983 | 3300044765 | Bacteria | 2622 |
| 252 | Ga0466970_0099823 | 3300044765 | Bacteria | 1580 |
| 253 | Ga0466957_0009691 | 3300044842 | Bacteria | 5500 |
| 254 | Ga0466957_0049389 | 3300044842 | Bacteria | 2558 |
| 255 | Ga0466957_0073352 | 3300044842 | Bacteria | 2121 |
| 256 | Ga0466960_0077862 | 3300044901 | Bacteria | 1664 |
| 257 | Ga0466959_0008397 | 3300045049 | Bacteria | 7300 |
| 258 | Ga0466959_0056406 | 3300045049 | Bacteria | 2866 |
| 259 | Ga0466958_0052052 | 3300045836 | Bacteria | 2481 |
| 260 | Ga0466967_0005854 | 3300045976 | Bacteria | 8603 |
| 261 | Ga0466967_0012787 | 3300045976 | Bacteria | 6447 |
| 262 | Ga0466967_0034331 | 3300045976 | Bacteria | 4304 |
| 263 | Ga0466967_0048148 | 3300045976 | Bacteria | 3721 |
| 264 | Ga0495592_0021268 | 3300046454 | Bacteria | 4933 |
| 265 | Ga0495603_0069349 | 3300046455 | Bacteria | 2074 |
| 266 | Ga0495590_0004409 | 3300046457 | Bacteria | 5687 |
| 267 | Ga0495590_0014755 | 3300046457 | Bacteria | 2848 |
| 268 | Ga0495629_0000116 | 3300046459 | Bacteria | 72206 |
| 269 | Ga0495638_0002571 | 3300046460 | Bacteria | 14689 |
| 270 | Ga0495638_0004949 | 3300046460 | Bacteria | 10008 |
| 271 | Ga0495638_0005996 | 3300046460 | Bacteria | 8904 |
| 272 | Ga0495651_0067673 | 3300046462 | Bacteria | 2724 |
| 273 | Ga0495653_0001724 | 3300046463 | Bacteria | 17231 |
| 274 | Ga0495650_0023020 | 3300046471 | Bacteria | 2974 |
| 275 | Ga0495650_0038365 | 3300046471 | Bacteria | 2076 |
| 276 | Ga0495580_0009499 | 3300046472 | Bacteria | 7644 |
| 277 | Ga0495580_0038307 | 3300046472 | Bacteria | 3434 |
| 278 | Ga0495605_0004386 | 3300046474 | Bacteria | 8305 |
| 279 | Ga0495605_0005618 | 3300046474 | Bacteria | 7287 |
| 280 | Ga0495605_0010867 | 3300046474 | Bacteria | 5085 |
| 281 | Ga0495639_0036242 | 3300046475 | Bacteria | 2209 |
| 282 | Ga0495585_0016423 | 3300046492 | Bacteria | 4288 |
| 283 | Ga0495606_0039566 | 3300046507 | Bacteria | 3175 |
| 284 | Ga0495608_0017440 | 3300046511 | Bacteria | 4966 |
| 285 | Ga0495610_0002054 | 3300046512 | Bacteria | 17211 |
| 286 | Ga0495616_0008096 | 3300046513 | Bacteria | 6258 |
| 287 | Ga0495618_0052878 | 3300046514 | Bacteria | 2568 |
| 288 | Ga0495628_0094740 | 3300046516 | Bacteria | 2307 |
| 289 | Ga0495628_0117156 | 3300046516 | Bacteria | 2045 |
| 290 | Ga0495631_0026864 | 3300046518 | Bacteria | 2639 |
| 291 | Ga0495632_0000033 | 3300046519 | Bacteria | 164240 |
| 292 | Ga0495643_0000583 | 3300046522 | Bacteria | 44498 |
| 293 | Ga0495644_0017788 | 3300046523 | Bacteria | 2716 |
| 294 | Ga0495648_0003019 | 3300046524 | Bacteria | 15074 |
| 295 | Ga0495648_0005832 | 3300046524 | Bacteria | 10143 |
| 296 | Ga0495648_0041306 | 3300046524 | Bacteria | 2914 |
| 297 | Ga0495648_0083895 | 3300046524 | Bacteria | 1804 |
| 298 | Ga0495666_0035763 | 3300046526 | Bacteria | 2419 |
| 299 | Ga0495652_0047220 | 3300046529 | Bacteria | 3693 |
| 300 | Ga0495652_0100833 | 3300046529 | Bacteria | 2341 |
| 301 | Ga0495654_0089521 | 3300046530 | Bacteria | 1430 |
| 302 | Ga0495640_0016349 | 3300046533 | Bacteria | 5551 |
| 303 | Ga0495645_0023938 | 3300046543 | Bacteria | 4427 |
| 304 | Ga0495622_0025626 | 3300046557 | Bacteria | 2754 |
| 305 | Ga0495667_0038343 | 3300046559 | Bacteria | 3191 |
| 306 | Ga0495668_0065004 | 3300046616 | Bacteria | 2008 |
| 307 | Ga0495634_0018287 | 3300046642 | Bacteria | 4991 |
| 308 | Ga0495635_0025856 | 3300046663 | Bacteria | 4088 |
| 309 | Ga0495661_0033690 | 3300046665 | Bacteria | 3229 |
| 310 | Ga0495657_0032258 | 3300046675 | Bacteria | 3657 |
| 311 | Ga0495599_0111339 | 3300046678 | Bacteria | 1705 |
| 312 | Ga0495646_0035480 | 3300046680 | Bacteria | 3093 |
| 313 | Ga0495613_0025234 | 3300046689 | Bacteria | 4430 |
| 314 | Ga0495624_0008528 | 3300046690 | Bacteria | 7139 |
| 315 | Ga0495624_0009833 | 3300046690 | Bacteria | 6616 |
| 316 | Ga0495624_0022770 | 3300046690 | Bacteria | 4134 |
| 317 | Ga0495624_0034395 | 3300046690 | Bacteria | 3277 |
| 318 | Ga0495670_0022022 | 3300046691 | Bacteria | 3146 |
| 319 | Ga0495671_0039010 | 3300046692 | Bacteria | 2399 |
| 320 | Ga0495671_0082549 | 3300046692 | Bacteria | 1575 |
| 321 | Ga0495649_0016179 | 3300046694 | Bacteria | 4231 |
| 322 | Ga0495589_0001320 | 3300046794 | Bacteria | 14562 |
| 323 | Ga0495589_0017669 | 3300046794 | Bacteria | 3660 |
| 324 | Ga0495600_0041594 | 3300046809 | Bacteria | 2995 |
| 325 | Ga0495581_0019686 | 3300047315 | Bacteria | 3917 |
| 326 | Ga0495604_0047316 | 3300047317 | Bacteria | 3350 |
| 327 | Ga0495604_0058048 | 3300047317 | Bacteria | 2973 |
| 328 | Ga0495674_0009111 | 3300047319 | Bacteria | 9429 |
| 329 | Ga0495676_0006058 | 3300047321 | Bacteria | 11115 |
| 330 | Ga0495683_0004328 | 3300047323 | Bacteria | 8091 |
| 331 | Ga0495683_0018805 | 3300047323 | Bacteria | 3568 |
| 332 | Ga0495683_0038196 | 3300047323 | Bacteria | 2432 |
| 333 | Ga0495687_032963 | 3300047443 | Bacteria | 2357 |
| 334 | Ga0495687_049942 | 3300047443 | Bacteria | 1785 |
| 335 | Ga0495679_000026 | 3300047446 | Bacteria | 196639 |
| 336 | Ga0495686_0000045 | 3300047472 | Bacteria | 284761 |
| 337 | Ga0495686_0064664 | 3300047472 | Bacteria | 2264 |
| 338 | Ga0495602_0145876 | 3300048088 | Bacteria | 1867 |
| 339 | Ga0496100_0012929 | 3300048903 | Bacteria | 4799 |
| 340 | Ga0496100_0017443 | 3300048903 | Bacteria | 4238 |
| 341 | Ga0496101_0040860 | 3300048904 | Bacteria | 3304 |
| 342 | Ga0496102_0008119 | 3300048905 | Bacteria | 8984 |
| 343 | Ga0496102_0025701 | 3300048905 | Bacteria | 5244 |
| 344 | Ga0496102_0081897 | 3300048905 | Bacteria | 2976 |
| 345 | Ga0496103_0004614 | 3300048906 | Bacteria | 8339 |
| 346 | Ga0496104_0002854 | 3300048907 | Bacteria | 14892 |
| 347 | Ga0496104_0007199 | 3300048907 | Bacteria | 9809 |
| 348 | Ga0496104_0072815 | 3300048907 | Bacteria | 3268 |
| 349 | Ga0496104_0080044 | 3300048907 | Bacteria | 3114 |
| 350 | Ga0496105_0005297 | 3300048908 | Bacteria | 9775 |
| 351 | Ga0496105_0051611 | 3300048908 | Bacteria | 3397 |
| 352 | Ga0496105_0106172 | 3300048908 | Bacteria | 2318 |
| 353 | Ga0496106_0000007 | 3300048909 | Bacteria | 248548 |
| 354 | Ga0496106_0014006 | 3300048909 | Bacteria | 5929 |
| 355 | Ga0496106_0081585 | 3300048909 | Bacteria | 2485 |
| 356 | Ga0496107_0005366 | 3300048910 | Bacteria | 8769 |
| 357 | Ga0496108_0009412 | 3300048911 | Bacteria | 7910 |
| 358 | Ga0496108_0037116 | 3300048911 | Bacteria | 4057 |
| 359 | Ga0496109_0005367 | 3300048912 | Bacteria | 10715 |
| 360 | Ga0496109_0089973 | 3300048912 | Bacteria | 2838 |
| 361 | Ga0496111_0017923 | 3300048914 | Bacteria | 4897 |
| 362 | Ga0496112_0001903 | 3300048915 | Bacteria | 16465 |
| 363 | Ga0496112_0087087 | 3300048915 | Bacteria | 3090 |
| 364 | Ga0496112_0157801 | 3300048915 | Bacteria | 2235 |
| 365 | Ga0496113_0006944 | 3300048916 | Bacteria | 7234 |
| 366 | Ga0496113_0012420 | 3300048916 | Bacteria | 5723 |
| 367 | Ga0496113_0024672 | 3300048916 | Bacteria | 4277 |
| 368 | Ga0496114_0102459 | 3300048917 | Bacteria | 2445 |
| 369 | Ga0496115_0002653 | 3300048918 | Bacteria | 12842 |
| 370 | Ga0496115_0020741 | 3300048918 | Bacteria | 5070 |
| 371 | Ga0496115_0132198 | 3300048918 | Bacteria | 2057 |
| 372 | Ga0496115_0176176 | 3300048918 | Bacteria | 1768 |
| 373 | Ga0496116_0003593 | 3300048919 | Bacteria | 15253 |
| 374 | Ga0496117_0001160 | 3300048920 | Bacteria | 39593 |
| 375 | Ga0496117_0113175 | 3300048920 | Bacteria | 1686 |
| 376 | Ga0496118_0001084 | 3300048921 | Bacteria | 42357 |
| 377 | Ga0496118_0001470 | 3300048921 | Bacteria | 35289 |
| 378 | Ga0496118_0007125 | 3300048921 | Bacteria | 11992 |
| 379 | Ga0496118_0019768 | 3300048921 | Bacteria | 6006 |
| 380 | Ga0496118_0028036 | 3300048921 | Bacteria | 4753 |
| 381 | Ga0496118_0039401 | 3300048921 | Bacteria | 3771 |
| 382 | Ga0496118_0041430 | 3300048921 | Bacteria | 3646 |
| 383 | Ga0496118_0046245 | 3300048921 | Bacteria | 3388 |
| 384 | Ga0496119_0000612 | 3300048922 | Bacteria | 48284 |
| 385 | Ga0496119_0035309 | 3300048922 | Bacteria | 3278 |
| 386 | Ga0496119_0036985 | 3300048922 | Bacteria | 3178 |
| 387 | Ga0496119_0064703 | 3300048922 | Bacteria | 2170 |
| 388 | Ga0496119_0102793 | 3300048922 | Bacteria | 1601 |
| 389 | Ga0496120_0001054 | 3300048923 | Bacteria | 36515 |
| 390 | Ga0496120_0005151 | 3300048923 | Bacteria | 10561 |
| 391 | Ga0496121_0000893 | 3300048924 | Bacteria | 53847 |
| 392 | Ga0496121_0007942 | 3300048924 | Bacteria | 12680 |
| 393 | Ga0496121_0008105 | 3300048924 | Bacteria | 12498 |
| 394 | Ga0496121_0008996 | 3300048924 | Bacteria | 11579 |
| 395 | Ga0496121_0011589 | 3300048924 | Bacteria | 9758 |
| 396 | Ga0496121_0076047 | 3300048924 | Bacteria | 2679 |
| 397 | Ga0496121_0091069 | 3300048924 | Bacteria | 2382 |
| 398 | Ga0496121_0123379 | 3300048924 | Bacteria | 1952 |
| 399 | Ga0496121_0193390 | 3300048924 | Bacteria | 1456 |
| 400 | Ga0496122_0035642 | 3300048925 | Bacteria | 4042 |
| 401 | Ga0496123_0035736 | 3300048926 | Bacteria | 3535 |
| 402 | Ga0496124_0015892 | 3300048927 | Bacteria | 7187 |
| 403 | Ga0496124_0042565 | 3300048927 | Bacteria | 3910 |
| 404 | Ga0496124_0148291 | 3300048927 | Bacteria | 1843 |
| 405 | Ga0496125_0000380 | 3300048928 | Bacteria | 82955 |
| 406 | Ga0496125_0040402 | 3300048928 | Bacteria | 4003 |
| 407 | Ga0496126_0008048 | 3300048929 | Bacteria | 11435 |
| 408 | Ga0496126_0013831 | 3300048929 | Bacteria | 8186 |
| 409 | Ga0496126_0014910 | 3300048929 | Bacteria | 7838 |
| 410 | Ga0496126_0027307 | 3300048929 | Bacteria | 5454 |
| 411 | Ga0496126_0032320 | 3300048929 | Bacteria | 4930 |
| 412 | Ga0496126_0034856 | 3300048929 | Bacteria | 4722 |
| 413 | Ga0496126_0100005 | 3300048929 | Bacteria | 2539 |
| 414 | Ga0496126_0110829 | 3300048929 | Bacteria | 2390 |
| 415 | Ga0495678_021863 | 3300049459 | Bacteria | 2809 |
| 416 | Ga0495682_0059543 | 3300049460 | Bacteria | 1380 |
| 417 | Ga0501031_0135917 | 3300049568 | Bacteria | 1606 |
| 418 | Ga0501034_0000041 | 3300049571 | Bacteria | 229264 |
| 419 | Ga0501034_0089372 | 3300049571 | Bacteria | 3078 |
| 420 | Ga0501034_0165361 | 3300049571 | Bacteria | 2181 |
| 421 | Ga0501039_0092666 | 3300049575 | Bacteria | 2355 |
| 422 | Ga0501073_0082297 | 3300049589 | Bacteria | 2239 |
| 423 | nmdc:mga03n38_15728_c1 | 3300050490 | Bacteria | 2927 |
| 424 | nmdc:mga00v17_49760_c1 | 3300050491 | Bacteria | 2543 |
| 425 | nmdc:mga0yw44_8827_c1 | 3300050492 | Bacteria | 4551 |
| 426 | nmdc:mga06z11_9333_c1 | 3300050494 | Bacteria | 4130 |
| 427 | nmdc:mga07m45_162902_c1 | 3300050496 | Bacteria | 1295 |
| 428 | nmdc:mga05p37_429763_c1 | 3300050507 | Bacteria | 1534 |
| 429 | Ga0495601_0015001 | 3300053077 | Bacteria | 4680 |
| 430 | Ga0495612_0045343 | 3300053078 | Bacteria | 1799 |
| 431 | Ga0500578_0034637 | 3300053086 | Bacteria | 3245 |
| 432 | Ga0500643_000063 | 3300053087 | Bacteria | 122135 |
| 433 | Ga0500646_0002286 | 3300053090 | Bacteria | 4993 |
| 434 | Ga0500647_0004754 | 3300053091 | Bacteria | 5526 |
| 435 | Ga0500583_0003937 | 3300053092 | Bacteria | 4764 |
| 436 | Ga0500651_0001809 | 3300053093 | Bacteria | 10947 |
| 437 | Ga0500651_0017933 | 3300053093 | Bacteria | 4377 |
| 438 | Ga0500651_0025568 | 3300053093 | Bacteria | 3705 |
| 439 | Ga0500566_0000150 | 3300053094 | Bacteria | 35703 |
| 440 | Ga0500566_0000252 | 3300053094 | Bacteria | 28789 |
| 441 | Ga0500566_0000871 | 3300053094 | Bacteria | 17224 |
| 442 | Ga0500640_011476 | 3300053095 | Bacteria | 3612 |
| 443 | Ga0500650_0022885 | 3300053098 | Bacteria | 2769 |
| 444 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 445 | Ga0500556_0013044 | 3300053104 | Bacteria | 2501 |
| 446 | Ga0500569_000996 | 3300053109 | Bacteria | 5115 |
| 447 | Ga0500572_006544 | 3300053111 | Bacteria | 2672 |
| 448 | Ga0500592_008151 | 3300053116 | Bacteria | 1662 |
| 449 | Ga0500595_002380 | 3300053119 | Bacteria | 9400 |
| 450 | Ga0500595_025276 | 3300053119 | Bacteria | 2061 |
| 451 | Ga0500608_000342 | 3300053122 | Bacteria | 18064 |
| 452 | Ga0500618_010713 | 3300053125 | Bacteria | 2451 |
| 453 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 454 | Ga0500642_0000465 | 3300053130 | Bacteria | 12688 |
| 455 | Ga0500652_000776 | 3300053131 | Bacteria | 10749 |
| 456 | Ga0500659_0015158 | 3300053135 | Bacteria | 4205 |
| 457 | Ga0500559_0000244 | 3300053136 | Bacteria | 42994 |
| 458 | Ga0500559_0005538 | 3300053136 | Bacteria | 5798 |
| 459 | Ga0500568_0042665 | 3300053139 | Bacteria | 1816 |
| 460 | Ga0500604_0004291 | 3300053151 | Bacteria | 3784 |
| 461 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 462 | Ga0500616_0000127 | 3300053153 | Bacteria | 134777 |
| 463 | Ga0500616_0009016 | 3300053153 | Bacteria | 6111 |
| 464 | Ga0500622_0000837 | 3300053156 | Bacteria | 26291 |
| 465 | Ga0500630_017330 | 3300053159 | Bacteria | 3551 |
| 466 | Ga0500633_0041440 | 3300053160 | Bacteria | 1549 |
| 467 | Ga0500636_0000197 | 3300053177 | Bacteria | 32448 |
| 468 | Ga0500636_0009453 | 3300053177 | Bacteria | 5666 |
| 469 | Ga0500637_0063215 | 3300053178 | Bacteria | 2122 |
| 470 | Ga0500576_025060 | 3300053725 | Bacteria | 2720 |
| 471 | Ga0500625_011604 | 3300053729 | Bacteria | 4006 |
| 472 | Ga0500599_000158 | 3300053736 | Bacteria | 6164 |
| 473 | Ga0466962_0002559 | 3300061719 | Bacteria | 8636 |
| 474 | Ga0466962_0009667 | 3300061719 | Bacteria | 4624 |
| 475 | Ga0466962_0014901 | 3300061719 | Bacteria | 3747 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10263653 | Ga0081455_102636532 | 336 |
| 2 | 3300031090 | Ga0265760_10000882 | Ga0265760_100008827 | 363 |
| 3 | 3300037853 | Ga0436364_1377417 | Ga0436364_1377417_1151_2509 | 364 |
| 4 | 3300048909 | Ga0496106_0081585 | Ga0496106_0081585_30_1190 | 366 |
| 5 | 3300039447 | Ga0436361_0406165 | Ga0436361_0406165_264_1460 | 369 |
| 6 | 3300048088 | Ga0495602_0145876 | Ga0495602_0145876_23_1240 | 371 |
| 7 | 3300025261 | Ga0209233_1002848 | Ga0209233_10028484 | 381 |
| 8 | 3300039447 | Ga0436361_0418089 | Ga0436361_0418089_1125_2375 | 385 |
| 9 | 3300048905 | Ga0496102_0008119 | Ga0496102_0008119_29_1249 | 386 |
| 10 | 3300048918 | Ga0496115_0176176 | Ga0496115_0176176_15_1232 | 386 |
| 11 | 3300050496 | nmdc:mga07m45_162902_c1 | nmdc:mga07m45_162902_c1_26_1246 | 386 |
| 12 | 3300048918 | Ga0496115_0020741 | Ga0496115_0020741_3507_4820 | 387 |
| 13 | iso_pu_bacteria | 8016557553 | 8016557622 | 387 |
| 14 | 3300048907 | Ga0496104_0007199 | Ga0496104_0007199_1145_2530 | 388 |
| 15 | 3300048908 | Ga0496105_0051611 | Ga0496105_0051611_1815_3200 | 388 |
| 16 | 3300048911 | Ga0496108_0009412 | Ga0496108_0009412_6456_7841 | 388 |
| 17 | 3300048912 | Ga0496109_0005367 | Ga0496109_0005367_7285_8670 | 388 |
| 18 | 3300048914 | Ga0496111_0017923 | Ga0496111_0017923_2008_3393 | 388 |
| 19 | 3300048915 | Ga0496112_0001903 | Ga0496112_0001903_9391_10776 | 388 |
| 20 | 3300048916 | Ga0496113_0024672 | Ga0496113_0024672_1078_2463 | 388 |
| 21 | 3300025254 | Ga0209148_1006766 | Ga0209148_10067662 | 389 |
| 22 | 3300025272 | Ga0209455_1002484 | Ga0209455_10024844 | 389 |
| 23 | 3300047323 | Ga0495683_0038196 | Ga0495683_0038196_939_2333 | 389 |
| 24 | 3300048929 | Ga0496126_0027307 | Ga0496126_0027307_3977_5248 | 390 |
| 25 | 3300026089 | Ga0207648_10143015 | Ga0207648_101430152 | 391 |
| 26 | 3300028800 | Ga0265338_10114999 | Ga0265338_101149992 | 391 |
| 27 | 3300031251 | Ga0265327_10006119 | Ga0265327_100061193 | 391 |
| 28 | 3300037853 | Ga0436364_0311122 | Ga0436364_0311122_209_1492 | 391 |
| 29 | 3300037853 | Ga0436364_0819535 | Ga0436364_0819535_2530_3819 | 392 |
| 30 | 3300053111 | Ga0500572_006544 | Ga0500572_006544_811_2109 | 392 |
| 31 | 3300053136 | Ga0500559_0000244 | Ga0500559_0000244_21625_22923 | 392 |
| 32 | 3300053725 | Ga0500576_025060 | Ga0500576_025060_767_2065 | 392 |
| 33 | iso_pu_bacteria | 8016539877 | 8016544112 | 392 |
| 34 | 3300046524 | Ga0495648_0005832 | Ga0495648_0005832_4107_5348 | 393 |
| 35 | 3300048929 | Ga0496126_0008048 | Ga0496126_0008048_3499_4740 | 393 |
| 36 | 3300006944 | Ga0099823_1000074 | Ga0099823_100007446 | 394 |
| 37 | 3300027296 | Ga0209389_1000063 | Ga0209389_10000632 | 394 |
| 38 | 3300041997 | Ga0439431_0002711 | Ga0439431_0002711_1097_2362 | 394 |
| 39 | 3300042006 | Ga0439432_004237 | Ga0439432_004237_1127_2452 | 394 |
| 40 | 3300049571 | Ga0501034_0000041 | Ga0501034_0000041_20379_21704 | 394 |
| 41 | 3300053135 | Ga0500659_0015158 | Ga0500659_0015158_1085_2410 | 394 |
| 42 | 3300025254 | Ga0209148_1000282 | Ga0209148_100028269 | 395 |
| 43 | 3300048929 | Ga0496126_0110829 | Ga0496126_0110829_177_1469 | 395 |
| 44 | 3300003752 | Ga0055539_1001505 | Ga0055539_10015052 | 397 |
| 45 | 3300025230 | Ga0209563_103896 | Ga0209563_1038962 | 397 |
| 46 | 3300025253 | Ga0209677_101634 | Ga0209677_1016346 | 397 |
| 47 | 3300025261 | Ga0209233_1008675 | Ga0209233_10086752 | 397 |
| 48 | 3300031712 | Ga0265342_10021291 | Ga0265342_100212912 | 397 |
| 49 | 3300033180 | Ga0307510_10111077 | Ga0307510_101110772 | 397 |
| 50 | 3300037418 | Ga0395900_0349623 | Ga0395900_0349623_119_1411 | 397 |
| 51 | 3300044694 | Ga0466963_0042956 | Ga0466963_0042956_1107_2393 | 397 |
| 52 | 3300044694 | Ga0466963_0059770 | Ga0466963_0059770_345_1631 | 397 |
| 53 | 3300044842 | Ga0466957_0049389 | Ga0466957_0049389_745_2043 | 397 |
| 54 | 3300045976 | Ga0466967_0012787 | Ga0466967_0012787_1483_2769 | 397 |
| 55 | 3300045976 | Ga0466967_0048148 | Ga0466967_0048148_1045_2337 | 397 |
| 56 | 3300046462 | Ga0495651_0067673 | Ga0495651_0067673_1042_2337 | 397 |
| 57 | 3300046475 | Ga0495639_0036242 | Ga0495639_0036242_701_1996 | 397 |
| 58 | 3300046511 | Ga0495608_0017440 | Ga0495608_0017440_2640_3935 | 397 |
| 59 | 3300046514 | Ga0495618_0052878 | Ga0495618_0052878_75_1370 | 397 |
| 60 | 3300046524 | Ga0495648_0083895 | Ga0495648_0083895_444_1739 | 397 |
| 61 | 3300046529 | Ga0495652_0047220 | Ga0495652_0047220_2221_3516 | 397 |
| 62 | 3300046533 | Ga0495640_0016349 | Ga0495640_0016349_3837_5132 | 397 |
| 63 | 3300046557 | Ga0495622_0025626 | Ga0495622_0025626_752_2047 | 397 |
| 64 | 3300046642 | Ga0495634_0018287 | Ga0495634_0018287_3447_4742 | 397 |
| 65 | 3300046663 | Ga0495635_0025856 | Ga0495635_0025856_1051_2346 | 397 |
| 66 | 3300046675 | Ga0495657_0032258 | Ga0495657_0032258_1350_2645 | 397 |
| 67 | 3300046689 | Ga0495613_0025234 | Ga0495613_0025234_2103_3398 | 397 |
| 68 | 3300046690 | Ga0495624_0008528 | Ga0495624_0008528_5813_7108 | 397 |
| 69 | 3300046809 | Ga0495600_0041594 | Ga0495600_0041594_1509_2804 | 397 |
| 70 | 3300047321 | Ga0495676_0006058 | Ga0495676_0006058_9651_10946 | 397 |
| 71 | 3300048907 | Ga0496104_0002854 | Ga0496104_0002854_10231_11526 | 397 |
| 72 | 3300048908 | Ga0496105_0005297 | Ga0496105_0005297_4913_6208 | 397 |
| 73 | 3300048916 | Ga0496113_0006944 | Ga0496113_0006944_5181_6476 | 397 |
| 74 | 3300048923 | Ga0496120_0005151 | Ga0496120_0005151_5700_6995 | 397 |
| 75 | 3300048924 | Ga0496121_0193390 | Ga0496121_0193390_129_1424 | 397 |
| 76 | 3300048929 | Ga0496126_0032320 | Ga0496126_0032320_436_1728 | 397 |
| 77 | 3300053094 | Ga0500566_0000252 | Ga0500566_0000252_6894_8189 | 397 |
| 78 | iso_pu_bacteria | 2844533157 | 2844538014 | 397 |
| 79 | 3300005329 | Ga0070683_100024865 | Ga0070683_1000248653 | 398 |
| 80 | 3300005535 | Ga0070684_100038231 | Ga0070684_1000382312 | 398 |
| 81 | 3300025253 | Ga0209677_100602 | Ga0209677_1006021 | 398 |
| 82 | 3300025261 | Ga0209233_1000493 | Ga0209233_100049320 | 398 |
| 83 | 3300025944 | Ga0207661_10004345 | Ga0207661_100043454 | 398 |
| 84 | 3300045976 | Ga0466967_0034331 | Ga0466967_0034331_2041_3330 | 398 |
| 85 | 3300048921 | Ga0496118_0041430 | Ga0496118_0041430_2188_3486 | 398 |
| 86 | 3300048922 | Ga0496119_0036985 | Ga0496119_0036985_258_1556 | 398 |
| 87 | 3300003187 | JGI25151J46595_10000164 | JGI25151J46595_1000016471 | 399 |
| 88 | 3300003354 | JGI25160J50197_1006481 | JGI25160J50197_10064815 | 399 |
| 89 | 3300006195 | Ga0075366_10066322 | Ga0075366_100663221 | 399 |
| 90 | 3300025284 | Ga0209130_1000522 | Ga0209130_100052233 | 399 |
| 91 | 3300025294 | Ga0209025_1000061 | Ga0209025_100006178 | 399 |
| 92 | 3300025297 | Ga0209758_1000730 | Ga0209758_100073013 | 399 |
| 93 | 3300025302 | Ga0207426_1000641 | Ga0207426_100064133 | 399 |
| 94 | 3300037471 | Ga0395905_0005266 | Ga0395905_0005266_3399_4694 | 399 |
| 95 | 3300038443 | Ga0395901_0259177 | Ga0395901_0259177_372_1667 | 399 |
| 96 | 3300046522 | Ga0495643_0000583 | Ga0495643_0000583_39060_40385 | 399 |
| 97 | 3300025297 | Ga0209758_1010070 | Ga0209758_10100703 | 400 |
| 98 | 3300048924 | Ga0496121_0091069 | Ga0496121_0091069_230_1528 | 400 |
| 99 | iso_pu_bacteria | 2821443989 | 2821444564 | 400 |
| 100 | iso_pu_bacteria | 8055066027 | 8055069810 | 400 |
| 101 | 3300005262 | Ga0065165_1003030 | Ga0065165_10030304 | 401 |
| 102 | 3300005563 | Ga0068855_100141958 | Ga0068855_1001419582 | 401 |
| 103 | 3300006195 | Ga0075366_10014497 | Ga0075366_100144974 | 401 |
| 104 | 3300009093 | Ga0105240_10034797 | Ga0105240_100347974 | 401 |
| 105 | 3300009098 | Ga0105245_10168629 | Ga0105245_101686292 | 401 |
| 106 | 3300013105 | Ga0157369_10005521 | Ga0157369_100055219 | 401 |
| 107 | 3300013105 | Ga0157369_10221247 | Ga0157369_102212472 | 401 |
| 108 | 3300013307 | Ga0157372_10067061 | Ga0157372_100670612 | 401 |
| 109 | 3300025302 | Ga0207426_1001303 | Ga0207426_10013032 | 401 |
| 110 | 3300025304 | Ga0209257_1006584 | Ga0209257_10065844 | 401 |
| 111 | 3300025904 | Ga0207647_10007864 | Ga0207647_100078646 | 401 |
| 112 | 3300026142 | Ga0207698_10066465 | Ga0207698_100664652 | 401 |
| 113 | 3300037418 | Ga0395900_0005446 | Ga0395900_0005446_11922_13220 | 401 |
| 114 | 3300037466 | Ga0395898_0153209 | Ga0395898_0153209_586_1884 | 401 |
| 115 | 3300037853 | Ga0436364_0243938 | Ga0436364_0243938_2644_3942 | 401 |
| 116 | 3300038443 | Ga0395901_0115458 | Ga0395901_0115458_1298_2596 | 401 |
| 117 | 3300044694 | Ga0466963_0008995 | Ga0466963_0008995_3412_4707 | 401 |
| 118 | 3300044719 | Ga0466971_0077853 | Ga0466971_0077853_75_1370 | 401 |
| 119 | 3300044842 | Ga0466957_0009691 | Ga0466957_0009691_3721_5016 | 401 |
| 120 | 3300045976 | Ga0466967_0005854 | Ga0466967_0005854_3330_4625 | 401 |
| 121 | 3300046543 | Ga0495645_0023938 | Ga0495645_0023938_561_1859 | 401 |
| 122 | 3300046678 | Ga0495599_0111339 | Ga0495599_0111339_273_1571 | 401 |
| 123 | 3300047443 | Ga0495687_049942 | Ga0495687_049942_421_1716 | 401 |
| 124 | 3300048904 | Ga0496101_0040860 | Ga0496101_0040860_1271_2566 | 401 |
| 125 | 3300048905 | Ga0496102_0081897 | Ga0496102_0081897_1440_2735 | 401 |
| 126 | 3300048906 | Ga0496103_0004614 | Ga0496103_0004614_5063_6358 | 401 |
| 127 | 3300048911 | Ga0496108_0037116 | Ga0496108_0037116_1996_3291 | 401 |
| 128 | 3300048915 | Ga0496112_0157801 | Ga0496112_0157801_255_1550 | 401 |
| 129 | 3300048922 | Ga0496119_0102793 | Ga0496119_0102793_33_1328 | 401 |
| 130 | 3300048924 | Ga0496121_0076047 | Ga0496121_0076047_687_1988 | 401 |
| 131 | 3300050490 | nmdc:mga03n38_15728_c1 | nmdc:mga03n38_15728_c1_134_1429 | 401 |
| 132 | 3300050491 | nmdc:mga00v17_49760_c1 | nmdc:mga00v17_49760_c1_1165_2466 | 401 |
| 133 | 3300053077 | Ga0495601_0015001 | Ga0495601_0015001_3040_4338 | 401 |
| 134 | 3300053078 | Ga0495612_0045343 | Ga0495612_0045343_29_1327 | 401 |
| 135 | 3300006942 | Ga0099824_1009679 | Ga0099824_10096793 | 402 |
| 136 | 3300025297 | Ga0209758_1004217 | Ga0209758_10042178 | 402 |
| 137 | 3300025915 | Ga0207693_10022371 | Ga0207693_100223713 | 402 |
| 138 | 3300027296 | Ga0209389_1000033 | Ga0209389_100003373 | 402 |
| 139 | 3300027357 | Ga0209589_1000040 | Ga0209589_100004073 | 402 |
| 140 | 3300027361 | Ga0209489_100045 | Ga0209489_10004585 | 402 |
| 141 | 3300035695 | Ga0373927_0022849 | Ga0373927_0022849_1554_2822 | 402 |
| 142 | 3300044656 | Ga0466969_0006896 | Ga0466969_0006896_3512_4807 | 402 |
| 143 | 3300044658 | Ga0466972_0000107 | Ga0466972_0000107_22416_23711 | 402 |
| 144 | 3300044683 | Ga0466965_0010374 | Ga0466965_0010374_1761_3056 | 402 |
| 145 | 3300044683 | Ga0466965_0067932 | Ga0466965_0067932_62_1357 | 402 |
| 146 | 3300044684 | Ga0466966_0000359 | Ga0466966_0000359_17498_18793 | 402 |
| 147 | 3300044693 | Ga0466961_0000074 | Ga0466961_0000074_41239_42534 | 402 |
| 148 | 3300044842 | Ga0466957_0073352 | Ga0466957_0073352_304_1602 | 402 |
| 149 | 3300045049 | Ga0466959_0008397 | Ga0466959_0008397_5190_6485 | 402 |
| 150 | 3300045836 | Ga0466958_0052052 | Ga0466958_0052052_76_1371 | 402 |
| 151 | 3300046455 | Ga0495603_0069349 | Ga0495603_0069349_271_1539 | 402 |
| 152 | 3300048918 | Ga0496115_0132198 | Ga0496115_0132198_276_1544 | 402 |
| 153 | 3300048925 | Ga0496122_0035642 | Ga0496122_0035642_1295_2653 | 402 |
| 154 | 3300053093 | Ga0500651_0001809 | Ga0500651_0001809_4531_5832 | 402 |
| 155 | 3300005337 | Ga0070682_100085173 | Ga0070682_1000851732 | 403 |
| 156 | 3300005344 | Ga0070661_100066102 | Ga0070661_1000661021 | 403 |
| 157 | 3300013296 | Ga0157374_10006943 | Ga0157374_100069432 | 403 |
| 158 | 3300013306 | Ga0163162_10013288 | Ga0163162_100132886 | 403 |
| 159 | 3300014325 | Ga0163163_10045070 | Ga0163163_100450704 | 403 |
| 160 | 3300014968 | Ga0157379_10153371 | Ga0157379_101533712 | 403 |
| 161 | 3300014969 | Ga0157376_10002020 | Ga0157376_100020208 | 403 |
| 162 | 3300026067 | Ga0207678_10074721 | Ga0207678_100747212 | 403 |
| 163 | 3300026116 | Ga0207674_10211016 | Ga0207674_102110162 | 403 |
| 164 | 3300033442 | Ga0315911_1000008 | Ga0315911_1000008254 | 403 |
| 165 | 3300037418 | Ga0395900_0002352 | Ga0395900_0002352_3594_4889 | 403 |
| 166 | 3300037466 | Ga0395898_0010389 | Ga0395898_0010389_4679_5974 | 403 |
| 167 | 3300039450 | Ga0436363_0863035 | Ga0436363_0863035_2114_3412 | 403 |
| 168 | 3300048909 | Ga0496106_0014006 | Ga0496106_0014006_3968_5239 | 403 |
| 169 | 3300048929 | Ga0496126_0014910 | Ga0496126_0014910_4978_6363 | 403 |
| 170 | 3300053093 | Ga0500651_0025568 | Ga0500651_0025568_1555_2850 | 403 |
| 171 | 3300053109 | Ga0500569_000996 | Ga0500569_000996_2993_4288 | 403 |
| 172 | 3300053130 | Ga0500642_0000465 | Ga0500642_0000465_6746_8041 | 403 |
| 173 | 3300053177 | Ga0500636_0000197 | Ga0500636_0000197_2392_3687 | 403 |
| 174 | 3300053729 | Ga0500625_011604 | Ga0500625_011604_1617_2912 | 403 |
| 175 | 3300005355 | Ga0070671_100233971 | Ga0070671_1002339711 | 404 |
| 176 | 3300005367 | Ga0070667_100014967 | Ga0070667_1000149671 | 404 |
| 177 | 3300009177 | Ga0105248_10024563 | Ga0105248_100245633 | 404 |
| 178 | 3300013306 | Ga0163162_10002420 | Ga0163162_100024207 | 404 |
| 179 | 3300025986 | Ga0207658_10086804 | Ga0207658_100868042 | 404 |
| 180 | 3300046460 | Ga0495638_0004949 | Ga0495638_0004949_7243_8529 | 404 |
| 181 | 3300046474 | Ga0495605_0010867 | Ga0495605_0010867_39_1325 | 404 |
| 182 | 3300046492 | Ga0495585_0016423 | Ga0495585_0016423_471_1757 | 404 |
| 183 | 3300046518 | Ga0495631_0026864 | Ga0495631_0026864_1272_2558 | 404 |
| 184 | 3300046523 | Ga0495644_0017788 | Ga0495644_0017788_1239_2525 | 404 |
| 185 | 3300046530 | Ga0495654_0089521 | Ga0495654_0089521_65_1351 | 404 |
| 186 | 3300046794 | Ga0495589_0001320 | Ga0495589_0001320_5774_7060 | 404 |
| 187 | 3300047472 | Ga0495686_0000045 | Ga0495686_0000045_129484_130770 | 404 |
| 188 | 3300048903 | Ga0496100_0017443 | Ga0496100_0017443_1288_2574 | 404 |
| 189 | 3300048905 | Ga0496102_0025701 | Ga0496102_0025701_968_2254 | 404 |
| 190 | 3300048907 | Ga0496104_0072815 | Ga0496104_0072815_654_1940 | 404 |
| 191 | 3300048921 | Ga0496118_0019768 | Ga0496118_0019768_2682_3968 | 404 |
| 192 | iso_pu_bacteria | 2511231004 | 2511254475 | 404 |
| 193 | iso_pu_bacteria | 2511231016 | 2511329188 | 404 |
| 194 | iso_pu_bacteria | 2511231022 | 2511360634 | 404 |
| 195 | iso_pu_bacteria | 2554235231 | 2555249169 | 404 |
| 196 | iso_pu_bacteria | 8056155041 | 8056159321 | 404 |
| 197 | 3300005437 | Ga0070710_10002720 | Ga0070710_100027202 | 405 |
| 198 | 3300005719 | Ga0068861_100190632 | Ga0068861_1001906322 | 405 |
| 199 | 3300006942 | Ga0099824_1004053 | Ga0099824_10040532 | 405 |
| 200 | 3300006943 | Ga0099822_1000007 | Ga0099822_100000756 | 405 |
| 201 | 3300027357 | Ga0209589_1000021 | Ga0209589_100002164 | 405 |
| 202 | 3300027361 | Ga0209489_100028 | Ga0209489_10002864 | 405 |
| 203 | 3300027363 | Ga0209700_100037 | Ga0209700_10003764 | 405 |
| 204 | 3300037466 | Ga0395898_0202294 | Ga0395898_0202294_376_1671 | 405 |
| 205 | 3300047472 | Ga0495686_0064664 | Ga0495686_0064664_945_2225 | 405 |
| 206 | 3300048921 | Ga0496118_0028036 | Ga0496118_0028036_2410_3711 | 405 |
| 207 | 3300048924 | Ga0496121_0007942 | Ga0496121_0007942_5956_7257 | 405 |
| 208 | iso_pu_bacteria | 2511231007 | 2511269708 | 405 |
| 209 | iso_pu_bacteria | 2511231024 | 2511374803 | 405 |
| 210 | iso_pu_bacteria | 2623620446 | 2624493759 | 405 |
| 211 | iso_pu_bacteria | 2643221633 | 2644187574 | 405 |
| 212 | iso_pu_bacteria | 2773857670 | 2774121358 | 405 |
| 213 | iso_pu_bacteria | 2784132072 | 2784317299 | 405 |
| 214 | iso_pu_bacteria | 2806310737 | 2807409663 | 405 |
| 215 | iso_pu_bacteria | 2806310745 | 2807457964 | 405 |
| 216 | iso_pu_bacteria | 2808606361 | 2808858234 | 405 |
| 217 | iso_pu_bacteria | 2808606376 | 2808924143 | 405 |
| 218 | iso_pu_bacteria | 2808606378 | 2808938377 | 405 |
| 219 | iso_pu_bacteria | 2808606380 | 2808946084 | 405 |
| 220 | iso_pu_bacteria | 2808606383 | 2808966719 | 405 |
| 221 | iso_pu_bacteria | 2808606389 | 2809001549 | 405 |
| 222 | iso_pu_bacteria | 2912963787 | 2912965134 | 405 |
| 223 | iso_pu_bacteria | 2919155634 | 2919160052 | 405 |
| 224 | iso_pu_bacteria | 2919697872 | 2919700332 | 405 |
| 225 | iso_pu_bacteria | 2935959822 | 2935962683 | 405 |
| 226 | iso_pu_bacteria | 2939651529 | 2939653494 | 405 |
| 227 | iso_pu_bacteria | 2988728565 | 2988733325 | 405 |
| 228 | iso_pu_bacteria | 3007803356 | 3007806344 | 405 |
| 229 | iso_pu_bacteria | 8019775933 | 8019776987 | 405 |
| 230 | iso_pu_bacteria | 8052494512 | 8052498652 | 405 |
| 231 | iso_pu_bacteria | 8054929484 | 8054933921 | 405 |
| 232 | iso_pu_bacteria | 8056115690 | 8056119965 | 405 |
| 233 | iso_pu_bacteria | 8056120720 | 8056122110 | 405 |
| 234 | iso_pu_bacteria | 8056172158 | 8056175741 | 405 |
| 235 | 3300005289 | Ga0065704_10092281 | Ga0065704_100922812 | 406 |
| 236 | 3300005983 | Ga0081540_1028192 | Ga0081540_10281921 | 406 |
| 237 | 3300009036 | Ga0105244_10005320 | Ga0105244_100053202 | 406 |
| 238 | 3300009036 | Ga0105244_10013814 | Ga0105244_100138144 | 406 |
| 239 | 3300013307 | Ga0157372_10000598 | Ga0157372_1000059829 | 406 |
| 240 | 3300025711 | Ga0207696_1000010 | Ga0207696_1000010138 | 406 |
| 241 | 3300025728 | Ga0207655_1000197 | Ga0207655_100019736 | 406 |
| 242 | 3300025728 | Ga0207655_1021092 | Ga0207655_10210922 | 406 |
| 243 | 3300025735 | Ga0207713_1016483 | Ga0207713_10164832 | 406 |
| 244 | 3300025916 | Ga0207663_10002301 | Ga0207663_1000230110 | 406 |
| 245 | 3300041407 | Ga0439447_004255 | Ga0439447_004255_699_2000 | 406 |
| 246 | 3300041411 | Ga0439466_0000609 | Ga0439466_0000609_6818_8119 | 406 |
| 247 | 3300042124 | Ga0450922_001606 | Ga0450922_001606_893_2194 | 406 |
| 248 | 3300048920 | Ga0496117_0001160 | Ga0496117_0001160_32783_34069 | 406 |
| 249 | 3300048921 | Ga0496118_0001084 | Ga0496118_0001084_34228_35514 | 406 |
| 250 | 3300048922 | Ga0496119_0000612 | Ga0496119_0000612_25521_26807 | 406 |
| 251 | 3300048922 | Ga0496119_0035309 | Ga0496119_0035309_28_1314 | 406 |
| 252 | 3300048923 | Ga0496120_0001054 | Ga0496120_0001054_25324_26610 | 406 |
| 253 | 3300048927 | Ga0496124_0015892 | Ga0496124_0015892_3054_4340 | 406 |
| 254 | 3300048928 | Ga0496125_0000380 | Ga0496125_0000380_37432_38718 | 406 |
| 255 | 3300049571 | Ga0501034_0165361 | Ga0501034_0165361_882_2162 | 406 |
| 256 | 3300050507 | nmdc:mga05p37_429763_c1 | nmdc:mga05p37_429763_c1_162_1475 | 406 |
| 257 | iso_pu_bacteria | 2888388044 | 2888390637 | 406 |
| 258 | 3300039453 | Ga0436362_0484418 | Ga0436362_0484418_52_1332 | 407 |
| 259 | 3300046519 | Ga0495632_0000033 | Ga0495632_0000033_337_1623 | 407 |
| 260 | 3300046665 | Ga0495661_0033690 | Ga0495661_0033690_1746_3032 | 407 |
| 261 | 3300048929 | Ga0496126_0100005 | Ga0496126_0100005_707_2008 | 407 |
| 262 | iso_pu_bacteria | 2513237096 | 2513658868 | 407 |
| 263 | iso_pu_bacteria | 2513237137 | 2513860874 | 407 |
| 264 | iso_pu_bacteria | 2513237145 | 2513921132 | 407 |
| 265 | iso_pu_bacteria | 2517572143 | 2517888896 | 407 |
| 266 | iso_pu_bacteria | 2524023228 | 2524536992 | 407 |
| 267 | iso_pu_bacteria | 2667528175 | 2671122502 | 407 |
| 268 | iso_pu_bacteria | 2728368998 | 2728755042 | 407 |
| 269 | iso_pu_bacteria | 2791355197 | 2793072986 | 407 |
| 270 | iso_pu_bacteria | 2818991450 | 2819619486 | 407 |
| 271 | iso_pu_bacteria | 2885374607 | 2885377504 | 407 |
| 272 | iso_pu_bacteria | 2903748898 | 2903752080 | 407 |
| 273 | iso_pu_bacteria | 2904690495 | 2904691146 | 407 |
| 274 | iso_pu_bacteria | 2904699407 | 2904708627 | 407 |
| 275 | iso_pu_bacteria | 2906610324 | 2906613924 | 407 |
| 276 | iso_pu_bacteria | 2906635258 | 2906642276 | 407 |
| 277 | iso_pu_bacteria | 2906660503 | 2906667304 | 407 |
| 278 | iso_pu_bacteria | 2908739725 | 2908747499 | 407 |
| 279 | iso_pu_bacteria | 2908756301 | 2908756540 | 407 |
| 280 | iso_pu_bacteria | 2922425934 | 2922434168 | 407 |
| 281 | iso_pu_bacteria | 2928108538 | 2928111487 | 407 |
| 282 | iso_pu_bacteria | 2928135762 | 2928138289 | 407 |
| 283 | iso_pu_bacteria | 2928503688 | 2928504903 | 407 |
| 284 | iso_pu_bacteria | 2935630451 | 2935637085 | 407 |
| 285 | iso_pu_bacteria | 2941507105 | 2941513648 | 407 |
| 286 | iso_pu_bacteria | 2941515067 | 2941521611 | 407 |
| 287 | iso_pu_bacteria | 2941523033 | 2941529440 | 407 |
| 288 | iso_pu_bacteria | 3005474847 | 3005475122 | 407 |
| 289 | iso_pu_bacteria | 8006933436 | 8006936169 | 407 |
| 290 | iso_pu_bacteria | 8006973647 | 8006976115 | 407 |
| 291 | iso_pu_bacteria | 8019555841 | 8019562490 | 407 |
| 292 | iso_pu_bacteria | 8019565922 | 8019572564 | 407 |
| 293 | iso_pu_bacteria | 8056689827 | 8056691001 | 407 |
| 294 | 3300009551 | Ga0105238_10181111 | Ga0105238_101811111 | 408 |
| 295 | 3300049571 | Ga0501034_0089372 | Ga0501034_0089372_386_1666 | 408 |
| 296 | iso_pu_bacteria | 2507262055 | 2507505319 | 408 |
| 297 | iso_pu_bacteria | 2508501042 | 2508695528 | 408 |
| 298 | iso_pu_bacteria | 2508501128 | 2509151882 | 408 |
| 299 | iso_pu_bacteria | 2511231028 | 2511394335 | 408 |
| 300 | iso_pu_bacteria | 2513237095 | 2513651471 | 408 |
| 301 | iso_pu_bacteria | 2513237102 | 2513699904 | 408 |
| 302 | iso_pu_bacteria | 2513237141 | 2513888813 | 408 |
| 303 | iso_pu_bacteria | 2515154112 | 2515627486 | 408 |
| 304 | iso_pu_bacteria | 2517093001 | 2517107152 | 408 |
| 305 | iso_pu_bacteria | 2524023205 | 2524440846 | 408 |
| 306 | iso_pu_bacteria | 2524023210 | 2524469505 | 408 |
| 307 | iso_pu_bacteria | 2528768022 | 2528854063 | 408 |
| 308 | iso_pu_bacteria | 2744054633 | 2745081734 | 408 |
| 309 | iso_pu_bacteria | 2791355196 | 2793062088 | 408 |
| 310 | iso_pu_bacteria | 2816332527 | 2818237694 | 408 |
| 311 | iso_pu_bacteria | 2824600985 | 2824604538 | 408 |
| 312 | iso_pu_bacteria | 2824609381 | 2824612371 | 408 |
| 313 | iso_pu_bacteria | 2824617872 | 2824625690 | 408 |
| 314 | iso_pu_bacteria | 2824626560 | 2824631643 | 408 |
| 315 | iso_pu_bacteria | 2824635225 | 2824642067 | 408 |
| 316 | iso_pu_bacteria | 2824644064 | 2824651449 | 408 |
| 317 | iso_pu_bacteria | 2824653114 | 2824659963 | 408 |
| 318 | iso_pu_bacteria | 2824661429 | 2824670261 | 408 |
| 319 | iso_pu_bacteria | 2824714736 | 2824721285 | 408 |
| 320 | iso_pu_bacteria | 2824723954 | 2824731293 | 408 |
| 321 | iso_pu_bacteria | 2824753945 | 2824762645 | 408 |
| 322 | iso_pu_bacteria | 2824763712 | 2824772715 | 408 |
| 323 | iso_pu_bacteria | 2841957949 | 2841965578 | 408 |
| 324 | iso_pu_bacteria | 2842038055 | 2842043465 | 408 |
| 325 | iso_pu_bacteria | 2842045827 | 2842052545 | 408 |
| 326 | iso_pu_bacteria | 2844315083 | 2844315384 | 408 |
| 327 | iso_pu_bacteria | 2849076700 | 2849083076 | 408 |
| 328 | iso_pu_bacteria | 2857509624 | 2857511968 | 408 |
| 329 | iso_pu_bacteria | 2874590934 | 2874594490 | 408 |
| 330 | iso_pu_bacteria | 2874620515 | 2874624832 | 408 |
| 331 | iso_pu_bacteria | 2874628541 | 2874628743 | 408 |
| 332 | iso_pu_bacteria | 2874645413 | 2874649862 | 408 |
| 333 | iso_pu_bacteria | 2876761206 | 2876770946 | 408 |
| 334 | iso_pu_bacteria | 2876771140 | 2876773982 | 408 |
| 335 | iso_pu_bacteria | 2876818435 | 2876821862 | 408 |
| 336 | iso_pu_bacteria | 2879074833 | 2879078294 | 408 |
| 337 | iso_pu_bacteria | 2879099564 | 2879105978 | 408 |
| 338 | iso_pu_bacteria | 2879127579 | 2879130554 | 408 |
| 339 | iso_pu_bacteria | 2879142872 | 2879147170 | 408 |
| 340 | iso_pu_bacteria | 2881364244 | 2881365277 | 408 |
| 341 | iso_pu_bacteria | 2881665667 | 2881668142 | 408 |
| 342 | iso_pu_bacteria | 2885383462 | 2885392603 | 408 |
| 343 | iso_pu_bacteria | 2885409591 | 2885411619 | 408 |
| 344 | iso_pu_bacteria | 2888378607 | 2888379542 | 408 |
| 345 | iso_pu_bacteria | 2888419890 | 2888420260 | 408 |
| 346 | iso_pu_bacteria | 2903727486 | 2903732243 | 408 |
| 347 | iso_pu_bacteria | 2903768456 | 2903771820 | 408 |
| 348 | iso_pu_bacteria | 2904666416 | 2904670213 | 408 |
| 349 | iso_pu_bacteria | 2904711408 | 2904713230 | 408 |
| 350 | iso_pu_bacteria | 2906602504 | 2906604322 | 408 |
| 351 | iso_pu_bacteria | 2922368715 | 2922369531 | 408 |
| 352 | iso_pu_bacteria | 2929615660 | 2929618647 | 408 |
| 353 | iso_pu_bacteria | 2929624759 | 2929628668 | 408 |
| 354 | iso_pu_bacteria | 2932784394 | 2932790826 | 408 |
| 355 | iso_pu_bacteria | 2932794094 | 2932794269 | 408 |
| 356 | iso_pu_bacteria | 2932801729 | 2932808137 | 408 |
| 357 | iso_pu_bacteria | 2932809354 | 2932812121 | 408 |
| 358 | iso_pu_bacteria | 2932818245 | 2932823111 | 408 |
| 359 | iso_pu_bacteria | 2932828146 | 2932833513 | 408 |
| 360 | iso_pu_bacteria | 2933577622 | 2933580641 | 408 |
| 361 | iso_pu_bacteria | 2935616580 | 2935623069 | 408 |
| 362 | iso_pu_bacteria | 2935638405 | 2935644144 | 408 |
| 363 | iso_pu_bacteria | 2935648319 | 2935653576 | 408 |
| 364 | iso_pu_bacteria | 2935656913 | 2935662325 | 408 |
| 365 | iso_pu_bacteria | 2935665750 | 2935672274 | 408 |
| 366 | iso_pu_bacteria | 2935675223 | 2935679201 | 408 |
| 367 | iso_pu_bacteria | 2935684952 | 2935686447 | 408 |
| 368 | iso_pu_bacteria | 2935694250 | 2935700227 | 408 |
| 369 | iso_pu_bacteria | 2935703347 | 2935710176 | 408 |
| 370 | iso_pu_bacteria | 2935713505 | 2935716135 | 408 |
| 371 | iso_pu_bacteria | 2935722832 | 2935723741 | 408 |
| 372 | iso_pu_bacteria | 2935732158 | 2935735296 | 408 |
| 373 | iso_pu_bacteria | 2935741537 | 2935743913 | 408 |
| 374 | iso_pu_bacteria | 2935750917 | 2935752413 | 408 |
| 375 | iso_pu_bacteria | 2935760218 | 2935763491 | 408 |
| 376 | iso_pu_bacteria | 2935769743 | 2935772995 | 408 |
| 377 | iso_pu_bacteria | 2935777560 | 2935782938 | 408 |
| 378 | iso_pu_bacteria | 2935785616 | 2935788017 | 408 |
| 379 | iso_pu_bacteria | 2935793552 | 2935796407 | 408 |
| 380 | iso_pu_bacteria | 2935801545 | 2935808168 | 408 |
| 381 | iso_pu_bacteria | 2935810662 | 2935816219 | 408 |
| 382 | iso_pu_bacteria | 2935827899 | 2935833612 | 408 |
| 383 | iso_pu_bacteria | 2935837841 | 2935844565 | 408 |
| 384 | iso_pu_bacteria | 2935855204 | 2935861317 | 408 |
| 385 | iso_pu_bacteria | 2935864058 | 2935869436 | 408 |
| 386 | iso_pu_bacteria | 2935873716 | 2935879765 | 408 |
| 387 | iso_pu_bacteria | 2935883170 | 2935890047 | 408 |
| 388 | iso_pu_bacteria | 2935975950 | 2935980659 | 408 |
| 389 | iso_pu_bacteria | 2935984226 | 2935985186 | 408 |
| 390 | iso_pu_bacteria | 2935992306 | 2935998012 | 408 |
| 391 | iso_pu_bacteria | 2936002035 | 2936008722 | 408 |
| 392 | iso_pu_bacteria | 2936011229 | 2936016627 | 408 |
| 393 | iso_pu_bacteria | 2936019824 | 2936025260 | 408 |
| 394 | iso_pu_bacteria | 2936028420 | 2936034102 | 408 |
| 395 | iso_pu_bacteria | 2936037263 | 2936041224 | 408 |
| 396 | iso_pu_bacteria | 2936046547 | 2936052159 | 408 |
| 397 | iso_pu_bacteria | 2936055302 | 2936056358 | 408 |
| 398 | iso_pu_bacteria | 2940556831 | 2940558326 | 408 |
| 399 | iso_pu_bacteria | 2941531003 | 2941535468 | 408 |
| 400 | iso_pu_bacteria | 2941538514 | 2941543250 | 408 |
| 401 | iso_pu_bacteria | 3005594810 | 3005595098 | 408 |
| 402 | iso_pu_bacteria | 3005718088 | 3005718349 | 408 |
| 403 | iso_pu_bacteria | 8016511872 | 8016518138 | 408 |
| 404 | iso_pu_bacteria | 8016530956 | 8016539807 | 408 |
| 405 | iso_pu_bacteria | 8016575299 | 8016582127 | 408 |
| 406 | iso_pu_bacteria | 8016595262 | 8016595659 | 408 |
| 407 | iso_pu_bacteria | 8016603502 | 8016606516 | 408 |
| 408 | iso_pu_bacteria | 8016613128 | 8016618415 | 408 |
| 409 | iso_pu_bacteria | 8016622563 | 8016623057 | 408 |
| 410 | iso_pu_bacteria | 8016630954 | 8016635577 | 408 |
| 411 | iso_pu_bacteria | 8017057580 | 8017058508 | 408 |
| 412 | iso_pu_bacteria | 8019530166 | 8019531084 | 408 |
| 413 | iso_pu_bacteria | 8019538911 | 8019540473 | 408 |
| 414 | iso_pu_bacteria | 8019547302 | 8019550061 | 408 |
| 415 | iso_pu_bacteria | 8019576017 | 8019577185 | 408 |
| 416 | iso_pu_bacteria | 8019597564 | 8019606490 | 408 |
| 417 | iso_pu_bacteria | 8019608314 | 8019612031 | 408 |
| 418 | iso_pu_bacteria | 8019629233 | 8019630085 | 408 |
| 419 | iso_pu_bacteria | 8019638758 | 8019640526 | 408 |
| 420 | iso_pu_bacteria | 8019648815 | 8019652420 | 408 |
| 421 | iso_pu_bacteria | 8019659431 | 8019666920 | 408 |
| 422 | iso_pu_bacteria | 8019668869 | 8019676678 | 408 |
| 423 | iso_pu_bacteria | 8019678201 | 8019679315 | 408 |
| 424 | iso_pu_bacteria | 8055742211 | 8055742497 | 408 |
| 425 | iso_pu_bacteria | 8056681323 | 8056686571 | 408 |
| 426 | iso_pu_bacteria | 8056967851 | 8056971335 | 408 |
| 427 | 3300025295 | Ga0209564_1000893 | Ga0209564_100089315 | 409 |
| 428 | 3300044656 | Ga0466969_0002550 | Ga0466969_0002550_3891_5234 | 409 |
| 429 | 3300044683 | Ga0466965_0000619 | Ga0466965_0000619_4350_5693 | 409 |
| 430 | 3300044684 | Ga0466966_0037473 | Ga0466966_0037473_828_2171 | 409 |
| 431 | 3300044693 | Ga0466961_0164686 | Ga0466961_0164686_67_1356 | 409 |
| 432 | 3300044694 | Ga0466963_0003085 | Ga0466963_0003085_7268_8611 | 409 |
| 433 | 3300044719 | Ga0466971_0011223 | Ga0466971_0011223_1171_2514 | 409 |
| 434 | 3300044765 | Ga0466970_0035983 | Ga0466970_0035983_396_1706 | 409 |
| 435 | 3300044765 | Ga0466970_0099823 | Ga0466970_0099823_92_1381 | 409 |
| 436 | 3300045049 | Ga0466959_0056406 | Ga0466959_0056406_1033_2322 | 409 |
| 437 | 3300049568 | Ga0501031_0135917 | Ga0501031_0135917_52_1341 | 409 |
| 438 | 3300049589 | Ga0501073_0082297 | Ga0501073_0082297_164_1453 | 409 |
| 439 | 3300061719 | Ga0466962_0009667 | Ga0466962_0009667_829_2172 | 409 |
| 440 | 3300061719 | Ga0466962_0014901 | Ga0466962_0014901_302_1591 | 409 |
| 441 | iso_pu_bacteria | 2602042107 | 2603858564 | 409 |
| 442 | iso_pu_bacteria | 2893066018 | 2893067412 | 409 |
| 443 | iso_pu_bacteria | 2919073203 | 2919073835 | 409 |
| 444 | 3300025906 | Ga0207699_10031288 | Ga0207699_100312882 | 410 |
| 445 | iso_pu_bacteria | 2889306138 | 2889306502 | 410 |
| 446 | iso_pu_bacteria | 2902330777 | 2902332399 | 410 |
| 447 | iso_pu_bacteria | 2902405164 | 2902411436 | 410 |
| 448 | 3300001989 | JGI24739J22299_10015113 | JGI24739J22299_100151132 | 411 |
| 449 | 3300005367 | Ga0070667_100019760 | Ga0070667_1000197603 | 411 |
| 450 | 3300005437 | Ga0070710_10051362 | Ga0070710_100513621 | 411 |
| 451 | 3300005439 | Ga0070711_100011167 | Ga0070711_1000111674 | 411 |
| 452 | 3300005439 | Ga0070711_100011297 | Ga0070711_1000112972 | 411 |
| 453 | 3300005563 | Ga0068855_100081086 | Ga0068855_1000810863 | 411 |
| 454 | 3300006163 | Ga0070715_10007836 | Ga0070715_100078362 | 411 |
| 455 | 3300006175 | Ga0070712_100011675 | Ga0070712_1000116752 | 411 |
| 456 | 3300009011 | Ga0105251_10001287 | Ga0105251_100012875 | 411 |
| 457 | 3300015262 | Ga0182007_10000995 | Ga0182007_100009952 | 411 |
| 458 | 3300025735 | Ga0207713_1001504 | Ga0207713_10015045 | 411 |
| 459 | 3300025898 | Ga0207692_10025781 | Ga0207692_100257811 | 411 |
| 460 | 3300025904 | Ga0207647_10003817 | Ga0207647_100038176 | 411 |
| 461 | 3300025916 | Ga0207663_10000968 | Ga0207663_100009687 | 411 |
| 462 | 3300046472 | Ga0495580_0009499 | Ga0495580_0009499_5784_7091 | 411 |
| 463 | 3300046524 | Ga0495648_0003019 | Ga0495648_0003019_11833_13128 | 411 |
| 464 | 3300047317 | Ga0495604_0058048 | Ga0495604_0058048_709_2016 | 411 |
| 465 | 3300047319 | Ga0495674_0009111 | Ga0495674_0009111_1364_2671 | 411 |
| 466 | 3300048909 | Ga0496106_0000007 | Ga0496106_0000007_132288_133634 | 411 |
| 467 | 3300048920 | Ga0496117_0113175 | Ga0496117_0113175_26_1333 | 411 |
| 468 | 3300048921 | Ga0496118_0001470 | Ga0496118_0001470_3102_4409 | 411 |
| 469 | 3300048924 | Ga0496121_0008105 | Ga0496121_0008105_2096_3442 | 411 |
| 470 | 3300048929 | Ga0496126_0013831 | Ga0496126_0013831_2888_4183 | 411 |
| 471 | 3300053153 | Ga0500616_0000127 | Ga0500616_0000127_111339_112634 | 411 |
| 472 | iso_pu_bacteria | 2526164713 | 2527078319 | 411 |
| 473 | iso_pu_bacteria | 2738541296 | 2738823478 | 411 |
| 474 | iso_pu_bacteria | 2738541298 | 2738835869 | 411 |
| 475 | iso_pu_bacteria | 2738541306 | 2738877524 | 411 |
| 476 | iso_pu_bacteria | 2738543002 | 2739189230 | 411 |
| 477 | iso_pu_bacteria | 2738543008 | 2739224117 | 411 |
| 478 | iso_pu_bacteria | 2842454564 | 2842460500 | 411 |
| 479 | iso_pu_bacteria | 2900634093 | 2900641582 | 411 |
| 480 | iso_pu_bacteria | 2904483920 | 2904489708 | 411 |
| 481 | iso_pu_bacteria | 2919527303 | 2919532773 | 411 |
| 482 | iso_pu_bacteria | 2945934425 | 2945939916 | 411 |
| 483 | iso_pu_bacteria | 2990703756 | 2990707037 | 411 |
| 484 | iso_pu_bacteria | 641736151 | 642426707 | 411 |
| 485 | iso_pu_bacteria | 8055266321 | 8055270474 | 411 |
| 486 | iso_pu_bacteria | 8055301274 | 8055306512 | 411 |
| 487 | 3300002067 | JGI24735J21928_10001300 | JGI24735J21928_100013003 | 412 |
| 488 | 3300003215 | JGI25153J46596_10008743 | JGI25153J46596_100087432 | 412 |
| 489 | 3300003354 | JGI25160J50197_1001638 | JGI25160J50197_10016386 | 412 |
| 490 | 3300003354 | JGI25160J50197_1006563 | JGI25160J50197_10065635 | 412 |
| 491 | 3300005262 | Ga0065165_1013353 | Ga0065165_10133532 | 412 |
| 492 | 3300005327 | Ga0070658_10021552 | Ga0070658_100215523 | 412 |
| 493 | 3300005327 | Ga0070658_10140961 | Ga0070658_101409612 | 412 |
| 494 | 3300005336 | Ga0070680_100161931 | Ga0070680_1001619312 | 412 |
| 495 | 3300005338 | Ga0068868_100135810 | Ga0068868_1001358101 | 412 |
| 496 | 3300005339 | Ga0070660_100001445 | Ga0070660_1000014456 | 412 |
| 497 | 3300005435 | Ga0070714_100062995 | Ga0070714_1000629952 | 412 |
| 498 | 3300005439 | Ga0070711_100014219 | Ga0070711_1000142192 | 412 |
| 499 | 3300005458 | Ga0070681_10096508 | Ga0070681_100965082 | 412 |
| 500 | 3300005471 | Ga0070698_100025240 | Ga0070698_1000252402 | 412 |
| 501 | 3300005530 | Ga0070679_100070910 | Ga0070679_1000709102 | 412 |
| 502 | 3300005536 | Ga0070697_100125926 | Ga0070697_1001259262 | 412 |
| 503 | 3300005548 | Ga0070665_100015751 | Ga0070665_1000157512 | 412 |
| 504 | 3300005563 | Ga0068855_100009982 | Ga0068855_1000099827 | 412 |
| 505 | 3300005563 | Ga0068855_100015639 | Ga0068855_1000156398 | 412 |
| 506 | 3300005983 | Ga0081540_1004294 | Ga0081540_10042941 | 412 |
| 507 | 3300006028 | Ga0070717_10002236 | Ga0070717_100022362 | 412 |
| 508 | 3300006237 | Ga0097621_100046443 | Ga0097621_1000464432 | 412 |
| 509 | 3300006358 | Ga0068871_100220908 | Ga0068871_1002209082 | 412 |
| 510 | 3300007265 | Ga0099794_10031473 | Ga0099794_100314732 | 412 |
| 511 | 3300009093 | Ga0105240_10013962 | Ga0105240_1001396211 | 412 |
| 512 | 3300009093 | Ga0105240_10032474 | Ga0105240_100324744 | 412 |
| 513 | 3300009093 | Ga0105240_10232109 | Ga0105240_102321092 | 412 |
| 514 | 3300009177 | Ga0105248_10184864 | Ga0105248_101848641 | 412 |
| 515 | 3300009545 | Ga0105237_10003198 | Ga0105237_1000319813 | 412 |
| 516 | 3300009545 | Ga0105237_10017007 | Ga0105237_100170073 | 412 |
| 517 | 3300013100 | Ga0157373_10006624 | Ga0157373_100066242 | 412 |
| 518 | 3300013104 | Ga0157370_10003240 | Ga0157370_1000324011 | 412 |
| 519 | 3300013105 | Ga0157369_10004182 | Ga0157369_100041825 | 412 |
| 520 | 3300013105 | Ga0157369_10018879 | Ga0157369_100188793 | 412 |
| 521 | 3300013296 | Ga0157374_10000219 | Ga0157374_1000021910 | 412 |
| 522 | 3300013297 | Ga0157378_10006645 | Ga0157378_100066452 | 412 |
| 523 | 3300013307 | Ga0157372_10002581 | Ga0157372_100025819 | 412 |
| 524 | 3300021358 | Ga0213873_10009034 | Ga0213873_100090341 | 412 |
| 525 | 3300021441 | Ga0213871_10000755 | Ga0213871_100007553 | 412 |
| 526 | 3300025228 | Ga0209672_100175 | Ga0209672_10017515 | 412 |
| 527 | 3300025256 | Ga0209759_1019120 | Ga0209759_10191202 | 412 |
| 528 | 3300025295 | Ga0209564_1005573 | Ga0209564_10055734 | 412 |
| 529 | 3300025297 | Ga0209758_1003514 | Ga0209758_10035149 | 412 |
| 530 | 3300025302 | Ga0207426_1000420 | Ga0207426_100042040 | 412 |
| 531 | 3300025302 | Ga0207426_1009896 | Ga0207426_10098962 | 412 |
| 532 | 3300025906 | Ga0207699_10030227 | Ga0207699_100302272 | 412 |
| 533 | 3300025909 | Ga0207705_10086447 | Ga0207705_100864472 | 412 |
| 534 | 3300025913 | Ga0207695_10001820 | Ga0207695_1000182010 | 412 |
| 535 | 3300025913 | Ga0207695_10058124 | Ga0207695_100581242 | 412 |
| 536 | 3300025914 | Ga0207671_10005387 | Ga0207671_100053873 | 412 |
| 537 | 3300025914 | Ga0207671_10019380 | Ga0207671_100193805 | 412 |
| 538 | 3300025915 | Ga0207693_10047236 | Ga0207693_100472362 | 412 |
| 539 | 3300025919 | Ga0207657_10003541 | Ga0207657_100035415 | 412 |
| 540 | 3300025921 | Ga0207652_10012393 | Ga0207652_100123932 | 412 |
| 541 | 3300025929 | Ga0207664_10077427 | Ga0207664_100774272 | 412 |
| 542 | 3300025945 | Ga0207679_10036408 | Ga0207679_100364083 | 412 |
| 543 | 3300025949 | Ga0207667_10007034 | Ga0207667_100070342 | 412 |
| 544 | 3300026023 | Ga0207677_10105334 | Ga0207677_101053342 | 412 |
| 545 | 3300026041 | Ga0207639_10138607 | Ga0207639_101386072 | 412 |
| 546 | 3300026089 | Ga0207648_10144107 | Ga0207648_101441072 | 412 |
| 547 | 3300026118 | Ga0207675_100176955 | Ga0207675_1001769552 | 412 |
| 548 | 3300026121 | Ga0207683_10039608 | Ga0207683_100396083 | 412 |
| 549 | 3300031235 | Ga0265330_10006512 | Ga0265330_100065122 | 412 |
| 550 | 3300031247 | Ga0265340_10002209 | Ga0265340_100022095 | 412 |
| 551 | 3300031249 | Ga0265339_10001277 | Ga0265339_100012778 | 412 |
| 552 | 3300033180 | Ga0307510_10002474 | Ga0307510_1000247415 | 412 |
| 553 | 3300035695 | Ga0373927_0076765 | Ga0373927_0076765_692_1990 | 412 |
| 554 | 3300037418 | Ga0395900_0139516 | Ga0395900_0139516_357_1667 | 412 |
| 555 | 3300037466 | Ga0395898_0010898 | Ga0395898_0010898_4269_5579 | 412 |
| 556 | 3300037466 | Ga0395898_0023482 | Ga0395898_0023482_1666_2964 | 412 |
| 557 | 3300037466 | Ga0395898_0245406 | Ga0395898_0245406_368_1666 | 412 |
| 558 | 3300042005 | Ga0439448_0000169 | Ga0439448_0000169_3095_4405 | 412 |
| 559 | 3300044901 | Ga0466960_0077862 | Ga0466960_0077862_93_1388 | 412 |
| 560 | 3300046460 | Ga0495638_0005996 | Ga0495638_0005996_673_1968 | 412 |
| 561 | 3300046692 | Ga0495671_0082549 | Ga0495671_0082549_38_1333 | 412 |
| 562 | 3300048903 | Ga0496100_0012929 | Ga0496100_0012929_3228_4526 | 412 |
| 563 | 3300048907 | Ga0496104_0080044 | Ga0496104_0080044_715_2013 | 412 |
| 564 | 3300048908 | Ga0496105_0106172 | Ga0496105_0106172_517_1815 | 412 |
| 565 | 3300048910 | Ga0496107_0005366 | Ga0496107_0005366_5083_6381 | 412 |
| 566 | 3300048912 | Ga0496109_0089973 | Ga0496109_0089973_59_1357 | 412 |
| 567 | 3300048915 | Ga0496112_0087087 | Ga0496112_0087087_1646_2944 | 412 |
| 568 | 3300048916 | Ga0496113_0012420 | Ga0496113_0012420_2859_4157 | 412 |
| 569 | 3300048917 | Ga0496114_0102459 | Ga0496114_0102459_1092_2387 | 412 |
| 570 | 3300048918 | Ga0496115_0002653 | Ga0496115_0002653_3600_4898 | 412 |
| 571 | 3300048921 | Ga0496118_0039401 | Ga0496118_0039401_452_1750 | 412 |
| 572 | 3300048922 | Ga0496119_0064703 | Ga0496119_0064703_822_2120 | 412 |
| 573 | 3300048924 | Ga0496121_0000893 | Ga0496121_0000893_38200_39498 | 412 |
| 574 | 3300048924 | Ga0496121_0123379 | Ga0496121_0123379_412_1710 | 412 |
| 575 | 3300048927 | Ga0496124_0042565 | Ga0496124_0042565_2239_3534 | 412 |
| 576 | 3300048929 | Ga0496126_0034856 | Ga0496126_0034856_2648_3946 | 412 |
| 577 | 3300050492 | nmdc:mga0yw44_8827_c1 | nmdc:mga0yw44_8827_c1_1537_2832 | 412 |
| 578 | 3300053087 | Ga0500643_000063 | Ga0500643_000063_101345_102640 | 412 |
| 579 | 3300053091 | Ga0500647_0004754 | Ga0500647_0004754_1762_3060 | 412 |
| 580 | 3300053092 | Ga0500583_0003937 | Ga0500583_0003937_789_2084 | 412 |
| 581 | 3300053094 | Ga0500566_0000150 | Ga0500566_0000150_16664_17962 | 412 |
| 582 | 3300053095 | Ga0500640_011476 | Ga0500640_011476_545_1843 | 412 |
| 583 | 3300053104 | Ga0500556_0013044 | Ga0500556_0013044_713_2008 | 412 |
| 584 | 3300053116 | Ga0500592_008151 | Ga0500592_008151_222_1517 | 412 |
| 585 | 3300053119 | Ga0500595_002380 | Ga0500595_002380_4693_5991 | 412 |
| 586 | 3300053153 | Ga0500616_0009016 | Ga0500616_0009016_1734_3029 | 412 |
| 587 | 3300053159 | Ga0500630_017330 | Ga0500630_017330_618_1916 | 412 |
| 588 | 3300053160 | Ga0500633_0041440 | Ga0500633_0041440_176_1471 | 412 |
| 589 | 3300053178 | Ga0500637_0063215 | Ga0500637_0063215_727_2025 | 412 |
| 590 | 3300053736 | Ga0500599_000158 | Ga0500599_000158_86_1381 | 412 |
| 591 | iso_pu_bacteria | 2513237098 | 2513675091 | 412 |
| 592 | 3300005468 | Ga0070707_100137078 | Ga0070707_1001370781 | 413 |
| 593 | 3300006178 | Ga0075367_10024122 | Ga0075367_100241223 | 413 |
| 594 | 3300006186 | Ga0075369_10009131 | Ga0075369_100091314 | 413 |
| 595 | 3300025295 | Ga0209564_1012951 | Ga0209564_10129513 | 413 |
| 596 | 3300025910 | Ga0207684_10002632 | Ga0207684_1000263211 | 413 |
| 597 | 3300025922 | Ga0207646_10042066 | Ga0207646_100420662 | 413 |
| 598 | 3300026067 | Ga0207678_10029354 | Ga0207678_100293545 | 413 |
| 599 | 3300028786 | Ga0307517_10000024 | Ga0307517_10000024123 | 413 |
| 600 | 3300028794 | Ga0307515_10102094 | Ga0307515_101020943 | 413 |
| 601 | 3300037853 | Ga0436364_0365508 | Ga0436364_0365508_1835_3148 | 413 |
| 602 | 3300046513 | Ga0495616_0008096 | Ga0495616_0008096_1422_2726 | 413 |
| 603 | 3300046616 | Ga0495668_0065004 | Ga0495668_0065004_614_1918 | 413 |
| 604 | 3300046691 | Ga0495670_0022022 | Ga0495670_0022022_271_1575 | 413 |
| 605 | 3300046692 | Ga0495671_0039010 | Ga0495671_0039010_954_2258 | 413 |
| 606 | 3300048919 | Ga0496116_0003593 | Ga0496116_0003593_2754_4058 | 413 |
| 607 | 3300048924 | Ga0496121_0011589 | Ga0496121_0011589_2705_4009 | 413 |
| 608 | 3300048926 | Ga0496123_0035736 | Ga0496123_0035736_1947_3251 | 413 |
| 609 | 3300048927 | Ga0496124_0148291 | Ga0496124_0148291_483_1787 | 413 |
| 610 | 3300048928 | Ga0496125_0040402 | Ga0496125_0040402_251_1555 | 413 |
| 611 | 3300049459 | Ga0495678_021863 | Ga0495678_021863_1258_2562 | 413 |
| 612 | 3300050494 | nmdc:mga06z11_9333_c1 | nmdc:mga06z11_9333_c1_2143_3447 | 413 |
| 613 | 3300053086 | Ga0500578_0034637 | Ga0500578_0034637_1100_2404 | 413 |
| 614 | 3300053090 | Ga0500646_0002286 | Ga0500646_0002286_3224_4528 | 413 |
| 615 | 3300053093 | Ga0500651_0017933 | Ga0500651_0017933_1857_3161 | 413 |
| 616 | 3300053094 | Ga0500566_0000871 | Ga0500566_0000871_8016_9320 | 413 |
| 617 | 3300053098 | Ga0500650_0022885 | Ga0500650_0022885_1145_2449 | 413 |
| 618 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_298192_299496 | 413 |
| 619 | 3300053119 | Ga0500595_025276 | Ga0500595_025276_740_2041 | 413 |
| 620 | 3300053122 | Ga0500608_000342 | Ga0500608_000342_13833_15137 | 413 |
| 621 | 3300053125 | Ga0500618_010713 | Ga0500618_010713_619_1923 | 413 |
| 622 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_187450_188754 | 413 |
| 623 | 3300053131 | Ga0500652_000776 | Ga0500652_000776_2291_3610 | 413 |
| 624 | 3300053136 | Ga0500559_0005538 | Ga0500559_0005538_2250_3554 | 413 |
| 625 | 3300053139 | Ga0500568_0042665 | Ga0500568_0042665_443_1747 | 413 |
| 626 | 3300053151 | Ga0500604_0004291 | Ga0500604_0004291_2292_3596 | 413 |
| 627 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_292690_293994 | 413 |
| 628 | 3300053156 | Ga0500622_0000837 | Ga0500622_0000837_13357_14661 | 413 |
| 629 | 3300053177 | Ga0500636_0009453 | Ga0500636_0009453_1111_2415 | 413 |
| 630 | iso_pu_bacteria | 2545555834 | 2545676492 | 413 |
| 631 | iso_pu_bacteria | 641522639 | 641641323 | 413 |
| 632 | 3300005327 | Ga0070658_10003071 | Ga0070658_100030712 | 414 |
| 633 | 3300005366 | Ga0070659_100029202 | Ga0070659_1000292023 | 414 |
| 634 | 3300005563 | Ga0068855_100013142 | Ga0068855_1000131428 | 414 |
| 635 | 3300009093 | Ga0105240_10189508 | Ga0105240_101895082 | 414 |
| 636 | 3300013104 | Ga0157370_10004494 | Ga0157370_100044942 | 414 |
| 637 | 3300013105 | Ga0157369_10000320 | Ga0157369_100003202 | 414 |
| 638 | 3300025909 | Ga0207705_10000864 | Ga0207705_1000086417 | 414 |
| 639 | 3300025932 | Ga0207690_10005558 | Ga0207690_100055583 | 414 |
| 640 | 3300025949 | Ga0207667_10001900 | Ga0207667_1000190013 | 414 |
| 641 | 3300044658 | Ga0466972_0050982 | Ga0466972_0050982_563_1882 | 414 |
| 642 | 3300044694 | Ga0466963_0008953 | Ga0466963_0008953_1003_2322 | 414 |
| 643 | 3300046457 | Ga0495590_0014755 | Ga0495590_0014755_1442_2743 | 414 |
| 644 | 3300046459 | Ga0495629_0000116 | Ga0495629_0000116_16765_18066 | 414 |
| 645 | 3300046460 | Ga0495638_0002571 | Ga0495638_0002571_7752_9053 | 414 |
| 646 | 3300046463 | Ga0495653_0001724 | Ga0495653_0001724_12129_13430 | 414 |
| 647 | 3300046471 | Ga0495650_0023020 | Ga0495650_0023020_58_1359 | 414 |
| 648 | 3300046472 | Ga0495580_0038307 | Ga0495580_0038307_1470_2771 | 414 |
| 649 | 3300046474 | Ga0495605_0005618 | Ga0495605_0005618_2794_4095 | 414 |
| 650 | 3300046516 | Ga0495628_0117156 | Ga0495628_0117156_339_1640 | 414 |
| 651 | 3300046524 | Ga0495648_0041306 | Ga0495648_0041306_1172_2473 | 414 |
| 652 | 3300046529 | Ga0495652_0100833 | Ga0495652_0100833_977_2278 | 414 |
| 653 | 3300046680 | Ga0495646_0035480 | Ga0495646_0035480_225_1526 | 414 |
| 654 | 3300046690 | Ga0495624_0009833 | Ga0495624_0009833_4654_5955 | 414 |
| 655 | 3300046690 | Ga0495624_0034395 | Ga0495624_0034395_664_1965 | 414 |
| 656 | 3300047317 | Ga0495604_0047316 | Ga0495604_0047316_1157_2458 | 414 |
| 657 | 3300047323 | Ga0495683_0018805 | Ga0495683_0018805_652_1953 | 414 |
| 658 | 3300047446 | Ga0495679_000026 | Ga0495679_000026_178463_179764 | 414 |
| 659 | 3300048921 | Ga0496118_0046245 | Ga0496118_0046245_2035_3336 | 414 |
| 660 | 3300048924 | Ga0496121_0008996 | Ga0496121_0008996_8764_10065 | 414 |
| 661 | 3300049575 | Ga0501039_0092666 | Ga0501039_0092666_305_1624 | 414 |
| 662 | 3300061719 | Ga0466962_0002559 | Ga0466962_0002559_1807_3126 | 414 |
| 663 | 3300001979 | JGI24740J21852_10010583 | JGI24740J21852_100105832 | 415 |
| 664 | 3300001989 | JGI24739J22299_10011334 | JGI24739J22299_100113342 | 415 |
| 665 | 3300002067 | JGI24735J21928_10004466 | JGI24735J21928_100044664 | 415 |
| 666 | 3300002705 | JGI25156J39149_1000818 | JGI25156J39149_100081813 | 415 |
| 667 | 3300002705 | JGI25156J39149_1003696 | JGI25156J39149_10036963 | 415 |
| 668 | 3300003214 | JGI25165J46597_1001442 | JGI25165J46597_10014429 | 415 |
| 669 | 3300003756 | Ga0055533_1000091 | Ga0055533_100009115 | 415 |
| 670 | 3300003756 | Ga0055533_1001086 | Ga0055533_10010864 | 415 |
| 671 | 3300005455 | Ga0070663_100117605 | Ga0070663_1001176052 | 415 |
| 672 | 3300025226 | Ga0209674_100074 | Ga0209674_10007416 | 415 |
| 673 | 3300025226 | Ga0209674_100102 | Ga0209674_10010212 | 415 |
| 674 | 3300025230 | Ga0209563_100409 | Ga0209563_10040915 | 415 |
| 675 | 3300025231 | Ga0207427_102427 | Ga0207427_1024274 | 415 |
| 676 | 3300025256 | Ga0209759_1000009 | Ga0209759_100000916 | 415 |
| 677 | 3300025256 | Ga0209759_1000078 | Ga0209759_100007814 | 415 |
| 678 | 3300025261 | Ga0209233_1000144 | Ga0209233_100014416 | 415 |
| 679 | 3300025904 | Ga0207647_10022300 | Ga0207647_100223003 | 415 |
| 680 | 3300025904 | Ga0207647_10028796 | Ga0207647_100287961 | 415 |
| 681 | 3300031548 | Ga0307408_100010843 | Ga0307408_1000108433 | 415 |
| 682 | 3300031731 | Ga0307405_10115506 | Ga0307405_101155062 | 415 |
| 683 | 3300031911 | Ga0307412_10000041 | Ga0307412_10000041154 | 415 |
| 684 | 3300046454 | Ga0495592_0021268 | Ga0495592_0021268_248_1549 | 415 |
| 685 | 3300046457 | Ga0495590_0004409 | Ga0495590_0004409_3447_4748 | 415 |
| 686 | 3300046471 | Ga0495650_0038365 | Ga0495650_0038365_25_1326 | 415 |
| 687 | 3300046474 | Ga0495605_0004386 | Ga0495605_0004386_2595_3896 | 415 |
| 688 | 3300046507 | Ga0495606_0039566 | Ga0495606_0039566_409_1710 | 415 |
| 689 | 3300046512 | Ga0495610_0002054 | Ga0495610_0002054_5675_6976 | 415 |
| 690 | 3300046516 | Ga0495628_0094740 | Ga0495628_0094740_256_1557 | 415 |
| 691 | 3300046526 | Ga0495666_0035763 | Ga0495666_0035763_758_2059 | 415 |
| 692 | 3300046559 | Ga0495667_0038343 | Ga0495667_0038343_655_1956 | 415 |
| 693 | 3300046690 | Ga0495624_0022770 | Ga0495624_0022770_1020_2321 | 415 |
| 694 | 3300046694 | Ga0495649_0016179 | Ga0495649_0016179_2515_3816 | 415 |
| 695 | 3300046794 | Ga0495589_0017669 | Ga0495589_0017669_2127_3428 | 415 |
| 696 | 3300047315 | Ga0495581_0019686 | Ga0495581_0019686_108_1409 | 415 |
| 697 | 3300047323 | Ga0495683_0004328 | Ga0495683_0004328_759_2060 | 415 |
| 698 | 3300047443 | Ga0495687_032963 | Ga0495687_032963_260_1561 | 415 |
| 699 | 3300048921 | Ga0496118_0007125 | Ga0496118_0007125_5558_6859 | 415 |
| 700 | 3300049460 | Ga0495682_0059543 | Ga0495682_0059543_44_1345 | 415 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8et9-assembly1.cif.gz_A | cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium | 0.8444 | 63 | 413 |
| 8et8-assembly1.cif.gz_A | cryo-em structure of the organic cation transporter 1 in complex with verapamil | 0.8259 | 75 | 413 |
| 5c65-assembly2.cif.gz_B | structure of the human glucose transporter glut3 / slc2a3 | 0.8203 | 30 | 411 |
| 6zgs-assembly1.cif.gz_A | crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution | 0.82 | 31 | 408 |
| 6m20-assembly3.cif.gz_C | crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose | 0.8189 | 34 | 410 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54UC8_60_259_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9433 | 35 | 231 | 1.20.1250.20 |
| af_A0A1D8PLY7_67_271_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9352 | 29 | 231 | 1.20.1250.20 |
| af_P53322_81_280_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9334 | 34 | 210 | 1.20.1250.20 |
| af_O95528_5_195_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9326 | 31 | 210 | 1.20.1250.20 |
| af_A0A1D8PPX9_28_226_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9323 | 34 | 218 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258J912-F1-model_v4 | MFS transporter | 0.9717 | 20 | 249 |
GO:0005886
GO:0046943 |
| AF-A0A318JDI3-F1-model_v4 | MFS transporter | 0.9651 | 16 | 212 |
GO:0005886
GO:0046943 |
| AF-A0A4Q6FBK0-F1-model_v4 | deleted | 0.9479 | 21 | 391 |
|
| AF-B0T8Y4-F1-model_v4 | Major facilitator superfamily MFS_1 | 0.9471 | 26 | 413 |
GO:0005886
GO:0046943 |
| AF-A0A2V8MHX1-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9425 | 14 | 230 |
GO:0005886
GO:0046943 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar