F476143

General Info

Members Datasets Scaffolds Average Seq Length
701 345 698 324

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100004983|Ga0070713_1000049837
Length 358
Sequence VVSAAVCRYPSSPIVILAVMRQVVITRHGPPEVLQAGEAPDPVPRAGEVRIAVRAAGVNFADIMARLGLYPDAPPLPAVVGYEVAGVVDAVSSSDVPFRPGDRVFAFTRFGGYASLAVAPATFVFRTPQELSDVEAAAIPVNYLTAFVALETLAHVSAGETVLVHGAGGGVGIAATQLAKQRGATVIGTASAMKLDAIRSLGVDHPVDHQRDVPGEIRRLTKGRGVDVVLDPIGGRSARISYELLAPLGRLVLYGASTLASGERRNLWRVVRTLIEMPAFRPLSLMNRNRGVFGLNLGHLWSETGRLRSAVETLLSGFVAGQLRPVIAKTFPLDKAADAHRYIQSRANIGKVILTIDS

Samples

Sample ID Description Type Environment
1 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
2 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
3 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
162 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
176 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
293 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
312 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
313 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
342 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 3.71
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J14986_100123 3300001432 Unclassified 3555
2 JGI24748J21848_1000035 3300002074 Bacteria 73922
3 JGI24744J21845_10019466 3300002077 Bacteria 1342
4 JGI24034J26672_10000039 3300002239 Bacteria 73907
5 Ga0065712_10016444 3300005290 Bacteria 1702
6 Ga0065715_10021386 3300005293 Archaea 2154
7 Ga0065715_10107788 3300005293 Bacteria 2753
8 Ga0065707_10167853 3300005295 Bacteria 1508
9 Ga0070658_10070236 3300005327 Bacteria 2867
10 Ga0070658_10083661 3300005327 Bacteria 2623
11 Ga0070658_10346652 3300005327 Bacteria 1271
12 Ga0070676_10108670 3300005328 Bacteria 1724
13 Ga0070683_100009004 3300005329 Bacteria 8514
14 Ga0070683_100126998 3300005329 Bacteria 2411
15 Ga0070690_100088022 3300005330 Bacteria 2041
16 Ga0070670_100012891 3300005331 Bacteria 7157
17 Ga0070670_100022802 3300005331 Bacteria 5387
18 Ga0070670_100079114 3300005331 Bacteria 2825
19 Ga0070670_100319054 3300005331 Bacteria 1361
20 Ga0070670_100371536 3300005331 Bacteria 1259
21 Ga0070666_10018735 3300005335 Bacteria 4457
22 Ga0070680_100021880 3300005336 Bacteria 5086
23 Ga0070680_100076564 3300005336 Bacteria 2754
24 Ga0068868_100157930 3300005338 Bacteria 1871
25 Ga0070660_100069564 3300005339 Bacteria 2745
26 Ga0070687_100092226 3300005343 Bacteria 1678
27 Ga0070661_100130632 3300005344 Bacteria 1886
28 Ga0070669_100000692 3300005353 Bacteria 24734
29 Ga0070673_100009749 3300005364 Bacteria 6465
30 Ga0070673_100109953 3300005364 Bacteria 2284
31 Ga0070673_100450857 3300005364 Bacteria 1157
32 Ga0070688_100246475 3300005365 Unclassified 1270
33 Ga0070659_100100460 3300005366 Bacteria 2328
34 Ga0070659_100188630 3300005366 Bacteria 1694
35 Ga0070703_10000179 3300005406 Bacteria 30956
36 Ga0070703_10011176 3300005406 Bacteria 2535
37 Ga0070714_100066741 3300005435 Bacteria 3101
38 Ga0070713_100004983 3300005436 Bacteria 9017
39 Ga0070711_100001613 3300005439 Bacteria 12447
40 Ga0070711_100113992 3300005439 Bacteria 1988
41 Ga0070705_100050886 3300005440 Bacteria 2412
42 Ga0070705_100092769 3300005440 Unclassified 1886
43 Ga0070705_100113329 3300005440 Bacteria 1737
44 Ga0070700_100000645 3300005441 Bacteria 17252
45 Ga0070694_100024140 3300005444 Unclassified 3922
46 Ga0070708_100174480 3300005445 Bacteria 2008
47 Ga0070708_100234531 3300005445 Unclassified 1722
48 Ga0070708_100409759 3300005445 Unclassified 1278
49 Ga0070663_100073764 3300005455 Bacteria 2490
50 Ga0070678_100036127 3300005456 Bacteria 3456
51 Ga0070678_100062395 3300005456 Bacteria 2752
52 Ga0070662_100120176 3300005457 Bacteria 2013
53 Ga0070662_100229603 3300005457 Bacteria 1484
54 Ga0068867_100171589 3300005459 Bacteria 1718
55 Ga0070706_100061376 3300005467 Bacteria 3471
56 Ga0070706_100062204 3300005467 Bacteria 3449
57 Ga0070706_100073573 3300005467 Bacteria 3163
58 Ga0070707_100000108 3300005468 Bacteria 76022
59 Ga0070707_100031363 3300005468 Bacteria 5062
60 Ga0070707_100053514 3300005468 Bacteria 3870
61 Ga0070707_100127268 3300005468 Bacteria 2475
62 Ga0070707_100166555 3300005468 Bacteria 2148
63 Ga0070698_100000179 3300005471 Bacteria 59634
64 Ga0070698_100059606 3300005471 Bacteria 3854
65 Ga0070698_100123779 3300005471 Bacteria 2544
66 Ga0070698_100234608 3300005471 Bacteria 1768
67 Ga0070699_100000701 3300005518 Bacteria 31013
68 Ga0070699_100002650 3300005518 Bacteria 15986
69 Ga0070699_100035557 3300005518 Bacteria 4306
70 Ga0070699_100064415 3300005518 Bacteria 3179
71 Ga0070699_100149408 3300005518 Bacteria 2066
72 Ga0070699_100192635 3300005518 Bacteria 1811
73 Ga0070679_100205496 3300005530 Bacteria 1934
74 Ga0070684_100000994 3300005535 Bacteria 20216
75 Ga0070697_100005855 3300005536 Bacteria 9485
76 Ga0070697_100009508 3300005536 Bacteria 7598
77 Ga0070697_100025048 3300005536 Bacteria 4756
78 Ga0070697_100049853 3300005536 Bacteria 3398
79 Ga0070697_100053847 3300005536 Bacteria 3270
80 Ga0070697_100130301 3300005536 Bacteria 2109
81 Ga0070686_100001728 3300005544 Bacteria 12204
82 Ga0070686_100006775 3300005544 Bacteria 6379
83 Ga0070695_100079061 3300005545 Bacteria 2170
84 Ga0070696_100004465 3300005546 Bacteria 9339
85 Ga0070696_100008307 3300005546 Bacteria 6947
86 Ga0070704_100007453 3300005549 Bacteria 6517
87 Ga0070704_100032316 3300005549 Bacteria 3529
88 Ga0070704_100247730 3300005549 Bacteria 1461
89 Ga0070704_100277939 3300005549 Unclassified 1386
90 Ga0070664_100001242 3300005564 Bacteria 20375
91 Ga0068857_100028746 3300005577 Bacteria 4906
92 Ga0068857_100088454 3300005577 Bacteria 2771
93 Ga0068857_100271381 3300005577 Bacteria 1559
94 Ga0068854_100039869 3300005578 Bacteria 3310
95 Ga0068854_100104616 3300005578 Bacteria 2127
96 Ga0068854_100129411 3300005578 Bacteria 1926
97 Ga0068856_100123819 3300005614 Bacteria 2588
98 Ga0068856_100140285 3300005614 Bacteria 2424
99 Ga0068852_100052721 3300005616 Bacteria 3497
100 Ga0068859_100309459 3300005617 Unclassified 1673
101 Ga0068859_100413302 3300005617 Bacteria 1445
102 Ga0068859_100490538 3300005617 Bacteria 1324
103 Ga0068866_10008102 3300005718 Bacteria 4416
104 Ga0068861_100019169 3300005719 Bacteria 4886
105 Ga0068861_100027459 3300005719 Bacteria 4145
106 Ga0068870_10020276 3300005840 Bacteria 3235
107 Ga0068858_100000053 3300005842 Bacteria 119869
108 Ga0068858_100018636 3300005842 Bacteria 6499
109 Ga0068858_100114093 3300005842 Bacteria 2524
110 Ga0068860_100270015 3300005843 Bacteria 1660
111 Ga0068862_100003050 3300005844 Bacteria 14593
112 Ga0081538_10109519 3300005981 Unclassified 1360
113 Ga0070717_10021528 3300006028 Bacteria 5082
114 Ga0070717_10065030 3300006028 Bacteria 3031
115 Ga0075365_10057675 3300006038 Bacteria 2584
116 Ga0075365_10087648 3300006038 Bacteria 2117
117 Ga0075365_10136705 3300006038 Bacteria 1699
118 Ga0075368_10026605 3300006042 Bacteria 2226
119 Ga0075364_10051972 3300006051 Bacteria 2677
120 Ga0075364_10080680 3300006051 Bacteria 2151
121 Ga0075364_10162599 3300006051 Bacteria 1507
122 Ga0075364_10186746 3300006051 Bacteria 1404
123 Ga0070715_10000023 3300006163 Bacteria 117771
124 Ga0070716_100000003 3300006173 Bacteria 312721
125 Ga0070716_100170906 3300006173 Bacteria 1418
126 Ga0075362_10028192 3300006177 Bacteria 2410
127 Ga0075367_10024190 3300006178 Bacteria 3425
128 Ga0075367_10048695 3300006178 Bacteria 2497
129 Ga0097621_100000627 3300006237 Bacteria 24879
130 Ga0097621_100219544 3300006237 Unclassified 1656
131 Ga0075370_10003272 3300006353 Bacteria 7682
132 Ga0068871_100002742 3300006358 Bacteria 12029
133 Ga0075428_100004191 3300006844 Bacteria 15875
134 Ga0075428_100030614 3300006844 Bacteria 5951
135 Ga0075428_100032575 3300006844 Bacteria 5757
136 Ga0075428_100061064 3300006844 Bacteria 4127
137 Ga0075428_100326759 3300006844 Bacteria 1648
138 Ga0075428_100349812 3300006844 Bacteria 1586
139 Ga0075428_100416467 3300006844 Bacteria 1440
140 Ga0075428_100456145 3300006844 Bacteria 1369
141 Ga0075430_100004048 3300006846 Bacteria 12372
142 Ga0075430_100014030 3300006846 Bacteria 6831
143 Ga0075430_100120550 3300006846 Bacteria 2187
144 Ga0075430_100147128 3300006846 Bacteria 1962
145 Ga0075431_100002803 3300006847 Bacteria 16885
146 Ga0075431_100276290 3300006847 Bacteria 1701
147 Ga0075431_100442968 3300006847 Unclassified 1295
148 Ga0075433_10048060 3300006852 Bacteria 3710
149 Ga0075433_10075895 3300006852 Bacteria 2959
150 Ga0075434_100005682 3300006871 Bacteria 11381
151 Ga0075434_100123851 3300006871 Bacteria 2602
152 Ga0075434_100133581 3300006871 Bacteria 2501
153 Ga0075429_100001043 3300006880 Bacteria 22157
154 Ga0075429_100003470 3300006880 Bacteria 13447
155 Ga0075429_100352036 3300006880 Unclassified 1289
156 Ga0075436_100000002 3300006914 Bacteria 475522
157 Ga0075436_100023507 3300006914 Bacteria 4233
158 Ga0097620_100002186 3300006931 Bacteria 19854
159 Ga0097620_100309429 3300006931 Unclassified 1673
160 Ga0097620_100413316 3300006931 Bacteria 1445
161 Ga0097620_100490545 3300006931 Bacteria 1324
162 Ga0075435_100000776 3300007076 Bacteria 19804
163 Ga0075435_100011606 3300007076 Bacteria 6492
164 Ga0075435_100218404 3300007076 Bacteria 1618
165 Ga0099794_10018137 3300007265 Bacteria 3150
166 Ga0099794_10143517 3300007265 Unclassified 1210
167 Ga0105240_10197488 3300009093 Bacteria 2360
168 Ga0105240_10204113 3300009093 Bacteria 2315
169 Ga0105240_10219951 3300009093 Bacteria 2213
170 Ga0111539_10000118 3300009094 Bacteria 88106
171 Ga0111539_10000587 3300009094 Bacteria 46880
172 Ga0111539_10001564 3300009094 Bacteria 30474
173 Ga0111539_10024253 3300009094 Bacteria 7448
174 Ga0111539_10370253 3300009094 Bacteria 1668
175 Ga0111539_10425324 3300009094 Bacteria 1547
176 Ga0111539_10443895 3300009094 Unclassified 1511
177 Ga0111539_10448275 3300009094 Unclassified 1503
178 Ga0105247_10000052 3300009101 Bacteria 141465
179 Ga0114129_10000324 3300009147 Bacteria 56067
180 Ga0114129_10004439 3300009147 Bacteria 19796
181 Ga0114129_10012726 3300009147 Bacteria 11977
182 Ga0114129_10017723 3300009147 Bacteria 10141
183 Ga0114129_10027164 3300009147 Bacteria 8102
184 Ga0114129_10045764 3300009147 Bacteria 6150
185 Ga0114129_10063845 3300009147 Bacteria 5140
186 Ga0114129_10118576 3300009147 Unclassified 3645
187 Ga0114129_10144348 3300009147 Bacteria 3261
188 Ga0114129_10154143 3300009147 Bacteria 3143
189 Ga0114129_10378306 3300009147 Bacteria 1870
190 Ga0114129_10509987 3300009147 Unclassified 1569
191 Ga0105243_10000050 3300009148 Bacteria 142670
192 Ga0105243_10000214 3300009148 Bacteria 67405
193 Ga0105243_10254408 3300009148 Unclassified 1570
194 Ga0105243_10341515 3300009148 Bacteria 1372
195 Ga0105241_10113329 3300009174 Bacteria 2174
196 Ga0105242_10000654 3300009176 Bacteria 27117
197 Ga0105242_10000811 3300009176 Bacteria 24253
198 Ga0105242_10304341 3300009176 Bacteria 1456
199 Ga0105248_10034775 3300009177 Bacteria 5638
200 Ga0105248_10040098 3300009177 Bacteria 5249
201 Ga0105248_10226585 3300009177 Bacteria 2104
202 Ga0105238_10000043 3300009551 Bacteria 154120
203 Ga0105238_10071935 3300009551 Bacteria 3455
204 Ga0105249_10001518 3300009553 Bacteria 20365
205 Ga0105249_10097360 3300009553 Bacteria 2762
206 Ga0105249_10196750 3300009553 Unclassified 1970
207 Ga0105239_10016176 3300010375 Bacteria 8254
208 Ga0105246_10343557 3300011119 Bacteria 1220
209 Ga0157378_10000026 3300013297 Bacteria 128499
210 Ga0157378_10005697 3300013297 Bacteria 10900
211 Ga0157378_10008203 3300013297 Bacteria 9107
212 Ga0157378_10025930 3300013297 Bacteria 5165
213 Ga0157378_10047230 3300013297 Bacteria 3827
214 Ga0163162_10017085 3300013306 Bacteria 7099
215 Ga0157372_10165574 3300013307 Bacteria 2556
216 Ga0157372_10196052 3300013307 Bacteria 2339
217 Ga0157375_10005428 3300013308 Bacteria 11083
218 Ga0157380_10194069 3300014326 Unclassified 1795
219 Ga0157380_10205966 3300014326 Bacteria 1749
220 Ga0157380_10230286 3300014326 Bacteria 1664
221 Ga0157380_10378357 3300014326 Bacteria 1335
222 Ga0157376_10083927 3300014969 Unclassified 2742
223 Ga0157376_10091538 3300014969 Bacteria 2635
224 Ga0163161_10215579 3300017792 Bacteria 1484
225 Ga0206356_10120415 3300020070 Bacteria 1165
226 Ga0206353_11316981 3300020082 Bacteria 2205
227 Ga0206353_11357636 3300020082 Bacteria 1740
228 Ga0207672_1000462 3300025223 Bacteria 5137
229 Ga0207697_10000602 3300025315 Bacteria 20487
230 Ga0207653_10000011 3300025885 Bacteria 160949
231 Ga0207642_10005460 3300025899 Bacteria 4153
232 Ga0207710_10000004 3300025900 Bacteria 846540
233 Ga0207680_10018805 3300025903 Bacteria 3682
234 Ga0207685_10000002 3300025905 Bacteria 438088
235 Ga0207645_10095993 3300025907 Bacteria 1909
236 Ga0207643_10131412 3300025908 Bacteria 1490
237 Ga0207705_10282570 3300025909 Bacteria 1271
238 Ga0207684_10002580 3300025910 Bacteria 18159
239 Ga0207684_10159495 3300025910 Bacteria 1942
240 Ga0207695_10143191 3300025913 Bacteria 2337
241 Ga0207695_10316554 3300025913 Bacteria 1450
242 Ga0207663_10000403 3300025916 Bacteria 18706
243 Ga0207660_10126289 3300025917 Bacteria 1943
244 Ga0207662_10052666 3300025918 Unclassified 2422
245 Ga0207662_10183241 3300025918 Bacteria 1348
246 Ga0207646_10000495 3300025922 Bacteria 52781
247 Ga0207646_10005163 3300025922 Bacteria 13826
248 Ga0207646_10020313 3300025922 Bacteria 6155
249 Ga0207646_10415780 3300025922 Bacteria 1214
250 Ga0207681_10038314 3300025923 Bacteria 3175
251 Ga0207681_10225163 3300025923 Bacteria 1453
252 Ga0207694_10000065 3300025924 Bacteria 131061
253 Ga0207650_10066216 3300025925 Bacteria 2709
254 Ga0207659_10196387 3300025926 Bacteria 1608
255 Ga0207700_10062515 3300025928 Bacteria 2829
256 Ga0207700_10121834 3300025928 Bacteria 2116
257 Ga0207644_10000267 3300025931 Bacteria 35078
258 Ga0207644_10058736 3300025931 Bacteria 2781
259 Ga0207690_10036795 3300025932 Bacteria 3172
260 Ga0207690_10167795 3300025932 Bacteria 1642
261 Ga0207706_10207539 3300025933 Bacteria 1718
262 Ga0207706_10228975 3300025933 Bacteria 1627
263 Ga0207686_10000028 3300025934 Bacteria 163090
264 Ga0207686_10003568 3300025934 Bacteria 8348
265 Ga0207686_10008626 3300025934 Bacteria 5503
266 Ga0207709_10000082 3300025935 Bacteria 163123
267 Ga0207709_10000590 3300025935 Bacteria 30350
268 Ga0207665_10000009 3300025939 Bacteria 162252
269 Ga0207665_10051457 3300025939 Bacteria 2772
270 Ga0207691_10115378 3300025940 Bacteria 2385
271 Ga0207691_10133895 3300025940 Bacteria 2187
272 Ga0207711_10012912 3300025941 Bacteria 6937
273 Ga0207689_10006436 3300025942 Bacteria 10385
274 Ga0207689_10239174 3300025942 Unclassified 1501
275 Ga0207661_10043650 3300025944 Bacteria 3539
276 Ga0207661_10164942 3300025944 Bacteria 1924
277 Ga0207679_10190278 3300025945 Bacteria 1705
278 Ga0207667_10033136 3300025949 Bacteria 5558
279 Ga0207712_10076502 3300025961 Bacteria 2423
280 Ga0207640_10100394 3300025981 Bacteria 2027
281 Ga0207677_10245667 3300026023 Bacteria 1450
282 Ga0207677_10341884 3300026023 Bacteria 1251
283 Ga0207703_10000093 3300026035 Bacteria 104313
284 Ga0207703_10215209 3300026035 Bacteria 1715
285 Ga0207639_10091690 3300026041 Bacteria 2433
286 Ga0207708_10001454 3300026075 Bacteria 17754
287 Ga0207708_10137887 3300026075 Bacteria 1912
288 Ga0207708_10391927 3300026075 Bacteria 1147
289 Ga0207648_10232549 3300026089 Bacteria 1640
290 Ga0207674_10039188 3300026116 Bacteria 4914
291 Ga0207674_10110330 3300026116 Bacteria 2726
292 Ga0207675_100002639 3300026118 Bacteria 17699
293 Ga0207675_100029698 3300026118 Bacteria 5091
294 Ga0207675_100043408 3300026118 Bacteria 4199
295 Ga0207675_100189401 3300026118 Bacteria 1973
296 Ga0207675_100326816 3300026118 Bacteria 1498
297 Ga0209588_1007099 3300027671 Bacteria 3284
298 Ga0209588_1037184 3300027671 Bacteria 1567
299 Ga0207428_10000967 3300027907 Bacteria 31825
300 Ga0207428_10006746 3300027907 Bacteria 10531
301 Ga0207428_10057404 3300027907 Bacteria 3090
302 Ga0268266_10225895 3300028379 Unclassified 1723
303 Ga0268265_10136485 3300028380 Unclassified 2047
304 Ga0268264_10257973 3300028381 Bacteria 1623
305 Ga0268264_10331668 3300028381 Bacteria 1442
306 Ga0265334_10013622 3300028573 Bacteria 3403
307 Ga0265318_10028408 3300028577 Bacteria 2188
308 Ga0265322_10006453 3300028654 Bacteria 3455
309 Ga0265338_10005122 3300028800 Bacteria 17268
310 Ga0265338_10054424 3300028800 Bacteria 3568
311 Ga0265338_10068514 3300028800 Bacteria 3056
312 Ga0265329_10006749 3300031242 Bacteria 4519
313 Ga0265331_10070827 3300031250 Unclassified 1632
314 Ga0265327_10012028 3300031251 Bacteria 5884
315 Ga0265316_10005017 3300031344 Bacteria 12994
316 Ga0307408_100015965 3300031548 Bacteria 5007
317 Ga0307408_100238458 3300031548 Bacteria 1493
318 Ga0265313_10014646 3300031595 Bacteria 4621
319 Ga0316575_10002415 3300031665 Bacteria 6264
320 Ga0316575_10027206 3300031665 Bacteria 2225
321 Ga0316575_10027668 3300031665 Bacteria 2206
322 Ga0316579_10014160 3300031691 Bacteria 3442
323 Ga0265314_10003428 3300031711 Bacteria 15321
324 Ga0316576_10036274 3300031727 Bacteria 3524
325 Ga0316576_10352325 3300031727 Unclassified 1095
326 Ga0316578_10052553 3300031728 Bacteria 2387
327 Ga0316578_10123670 3300031728 Unclassified 1556
328 Ga0307405_10010189 3300031731 Bacteria 4857
329 Ga0307405_10113022 3300031731 Bacteria 1843
330 Ga0316577_10000156 3300031733 Bacteria 21231
331 Ga0316577_10061688 3300031733 Bacteria 2093
332 Ga0307410_10012276 3300031852 Bacteria 4946
333 Ga0307406_10149598 3300031901 Archaea 1664
334 Ga0307406_10240036 3300031901 Bacteria 1359
335 Ga0307406_10381575 3300031901 Bacteria 1111
336 Ga0307407_10056688 3300031903 Bacteria 2270
337 Ga0307416_100044253 3300032002 Bacteria 3494
338 Ga0307416_100099938 3300032002 Bacteria 2521
339 Ga0307416_100157291 3300032002 Unclassified 2094
340 Ga0307416_100198601 3300032002 Unclassified 1900
341 Ga0307416_100735449 3300032002 Bacteria 1078
342 Ga0307414_10290194 3300032004 Bacteria 1379
343 Ga0307411_10021439 3300032005 Bacteria 3781
344 Ga0307411_10078704 3300032005 Bacteria 2261
345 Ga0307411_10223684 3300032005 Bacteria 1462
346 Ga0307415_100140245 3300032126 Bacteria 1845
347 Ga0307415_100348365 3300032126 Bacteria 1246
348 Ga0316583_10063119 3300032133 Bacteria 1297
349 Ga0316580_10012217 3300032139 Bacteria 2615
350 Ga0373930_0000244 3300034816 Bacteria 6913
351 Ga0373950_0001349 3300034818 Bacteria 3179
352 Ga0373958_0009078 3300034819 Bacteria 1629
353 Ga0373959_0000891 3300034820 Bacteria 5042
354 Ga0373938_0000568 3300034957 Bacteria 5970
355 Ga0373929_0002332 3300035085 Bacteria 3488
356 Ga0373940_0000663 3300035088 Bacteria 5505
357 Ga0373944_0002673 3300035089 Bacteria 4542
358 Ga0373944_0059936 3300035089 Unclassified 1219
359 Ga0373949_0001449 3300035090 Bacteria 6782
360 Ga0373951_0000775 3300035091 Bacteria 8729
361 Ga0373952_0000131 3300035092 Bacteria 10723
362 Ga0373923_0023827 3300035111 Bacteria 2412
363 Ga0373932_0001952 3300035112 Bacteria 5459
364 Ga0373936_0102803 3300035113 Bacteria 1207
365 Ga0373941_0000019 3300035115 Bacteria 27005
366 Ga0373945_0020912 3300035116 Bacteria 2244
367 Ga0373953_0059554 3300035117 Unclassified 1559
368 Ga0373954_0004504 3300035118 Bacteria 5990
369 Ga0373954_0033192 3300035118 Unclassified 2388
370 Ga0373956_0012733 3300035119 Bacteria 3492
371 Ga0373960_0000344 3300035121 Bacteria 8964
372 Ga0373943_0000048 3300035170 Bacteria 41033
373 Ga0373955_0017989 3300035172 Bacteria 3506
374 Ga0373942_0000503 3300035207 Bacteria 11030
375 Ga0373961_0001690 3300035241 Bacteria 6162
376 Ga0373962_0000153 3300035242 Bacteria 14342
377 Ga0316574_0003944 3300035398 Bacteria 7721
378 Ga0316574_0010860 3300035398 Bacteria 5160
379 Ga0373924_0005801 3300035410 Bacteria 4393
380 Ga0373924_0050144 3300035410 Bacteria 1729
381 Ga0373931_0004901 3300035691 Bacteria 6153
382 Ga0373931_0210689 3300035691 Unclassified 1165
383 Ga0373935_0025095 3300035692 Bacteria 3673
384 Ga0373927_0263543 3300035695 Bacteria 1133
385 Ga0373947_0000658 3300035725 Bacteria 20469
386 Ga0373947_0004307 3300035725 Bacteria 8361
387 Ga0373947_0049295 3300035725 Bacteria 2528
388 Ga0373937_0002273 3300036401 Bacteria 16039
389 Ga0373937_0002585 3300036401 Bacteria 15054
390 Ga0373937_0048276 3300036401 Bacteria 3896
391 Ga0373937_0287666 3300036401 Unclassified 1553
392 Ga0373937_0346308 3300036401 Unclassified 1407
393 Ga0316582_0006844 3300036647 Bacteria 6026
394 Ga0316584_0001379 3300036712 Bacteria 14472
395 Ga0316584_0065904 3300036712 Bacteria 2713
396 Ga0373925_0011642 3300037068 Bacteria 6362
397 Ga0373925_0207331 3300037068 Bacteria 1560
398 Ga0395899_0126231 3300037312 Bacteria 1830
399 Ga0395898_0223370 3300037466 Bacteria 1796
400 Ga0395898_0324264 3300037466 Bacteria 1469
401 Ga0395905_0118230 3300037471 Bacteria 2491
402 Ga0316581_0043047 3300037588 Bacteria 1378
403 Ga0395901_0017241 3300038443 Bacteria 7370
404 Ga0395901_0027704 3300038443 Bacteria 5825
405 Ga0436365_0917382 3300039437 Bacteria 1483
406 Ga0436360_0084461 3300039438 Bacteria 2177
407 Ga0439461_0023094 3300041410 Bacteria 1250
408 Ga0439449_0032473 3300042007 Bacteria 1946
409 Ga0439446_0001453 3300042156 Bacteria 5407
410 Ga0439434_0048884 3300042435 Bacteria 1309
411 Ga0439435_0000202 3300042436 Bacteria 8376
412 Ga0439460_0019865 3300042461 Bacteria 1823
413 Ga0451577_0005551 3300042876 Bacteria 12851
414 Ga0439440_0010671 3300042993 Bacteria 1925
415 Ga0466963_0003999 3300044694 Bacteria 8527
416 Ga0466963_0014151 3300044694 Bacteria 4915
417 Ga0453684_0119478 3300044712 Bacteria 3185
418 Ga0453684_0144569 3300044712 Bacteria 2835
419 Ga0466957_0148788 3300044842 Bacteria 1513
420 Ga0466957_0152261 3300044842 Bacteria 1496
421 Ga0466960_0000033 3300044901 Bacteria 46153
422 Ga0466959_0217918 3300045049 Bacteria 1324
423 Ga0451576_0040232 3300045051 Bacteria 4949
424 Ga0451576_0373219 3300045051 Bacteria 1495
425 Ga0466958_0022930 3300045836 Bacteria 3660
426 Ga0466958_0194223 3300045836 Bacteria 1291
427 Ga0466967_0067919 3300045976 Bacteria 3181
428 Ga0466967_0156395 3300045976 Bacteria 2136
429 Ga0466967_0273605 3300045976 Bacteria 1619
430 Ga0466967_0438244 3300045976 Bacteria 1276
431 Ga0495592_0032013 3300046454 Unclassified 3972
432 Ga0495592_0055736 3300046454 Bacteria 2923
433 Ga0495592_0131019 3300046454 Bacteria 1754
434 Ga0495603_0130769 3300046455 Bacteria 1462
435 Ga0495629_0000159 3300046459 Bacteria 59616
436 Ga0495629_0016241 3300046459 Bacteria 5344
437 Ga0495629_0099492 3300046459 Bacteria 2029
438 Ga0495629_0179867 3300046459 Bacteria 1466
439 Ga0495641_0003425 3300046461 Bacteria 11883
440 Ga0495651_0007517 3300046462 Bacteria 8336
441 Ga0495651_0041923 3300046462 Bacteria 3555
442 Ga0495651_0073811 3300046462 Bacteria 2589
443 Ga0495653_0005657 3300046463 Bacteria 10203
444 Ga0495653_0025252 3300046463 Bacteria 4779
445 Ga0495653_0041699 3300046463 Bacteria 3581
446 Ga0495653_0044397 3300046463 Bacteria 3449
447 Ga0495653_0055532 3300046463 Bacteria 3022
448 Ga0495650_0000398 3300046471 Bacteria 72672
449 Ga0495580_0092053 3300046472 Bacteria 2110
450 Ga0495582_0000183 3300046473 Bacteria 34098
451 Ga0495582_0062304 3300046473 Bacteria 2061
452 Ga0495662_0000220 3300046476 Bacteria 23891
453 Ga0495662_0023171 3300046476 Bacteria 2999
454 Ga0495664_0049594 3300046477 Bacteria 2492
455 Ga0495608_0075495 3300046511 Unclassified 2197
456 Ga0495608_0083084 3300046511 Bacteria 2079
457 Ga0495608_0094669 3300046511 Bacteria 1930
458 Ga0495608_0105871 3300046511 Bacteria 1811
459 Ga0495608_0113079 3300046511 Bacteria 1744
460 Ga0495618_0000512 3300046514 Bacteria 27479
461 Ga0495618_0080991 3300046514 Bacteria 2072
462 Ga0495628_0130551 3300046516 Bacteria 1922
463 Ga0495630_0002760 3300046517 Bacteria 12184
464 Ga0495630_0020164 3300046517 Bacteria 4912
465 Ga0495630_0023403 3300046517 Bacteria 4567
466 Ga0495630_0065501 3300046517 Bacteria 2730
467 Ga0495643_0001409 3300046522 Bacteria 22295
468 Ga0495666_0041605 3300046526 Bacteria 2225
469 Ga0495652_0029681 3300046529 Bacteria 4802
470 Ga0495652_0145126 3300046529 Bacteria 1861
471 Ga0495665_0001453 3300046531 Bacteria 12705
472 Ga0495640_0017528 3300046533 Bacteria 5336
473 Ga0495640_0076220 3300046533 Bacteria 2238
474 Ga0495587_0008243 3300046536 Bacteria 6708
475 Ga0495587_0044110 3300046536 Bacteria 2653
476 Ga0495621_0045659 3300046539 Unclassified 1552
477 Ga0495645_0000023 3300046543 Bacteria 130982
478 Ga0495667_0002831 3300046559 Bacteria 11595
479 Ga0495667_0032855 3300046559 Unclassified 3474
480 Ga0495667_0033511 3300046559 Bacteria 3437
481 Ga0495667_0096059 3300046559 Unclassified 1918
482 Ga0495634_0006252 3300046642 Bacteria 9068
483 Ga0495634_0022820 3300046642 Bacteria 4407
484 Ga0495634_0051646 3300046642 Bacteria 2758
485 Ga0495635_0179944 3300046663 Bacteria 1437
486 Ga0495657_0020336 3300046675 Bacteria 4772
487 Ga0495657_0075452 3300046675 Bacteria 2192
488 Ga0495599_0093614 3300046678 Unclassified 1874
489 Ga0495599_0103068 3300046678 Bacteria 1778
490 Ga0495599_0159430 3300046678 Bacteria 1395
491 Ga0495646_0017390 3300046680 Bacteria 4562
492 Ga0495646_0275497 3300046680 Bacteria 895
493 Ga0495647_0009083 3300046681 Bacteria 3357
494 Ga0495658_0003812 3300046683 Bacteria 7469
495 Ga0495658_0047548 3300046683 Unclassified 2417
496 Ga0495669_0004600 3300046684 Bacteria 5715
497 Ga0495669_0050117 3300046684 Unclassified 1872
498 Ga0495613_0000392 3300046689 Bacteria 37506
499 Ga0495613_0018344 3300046689 Bacteria 5218
500 Ga0495613_0028865 3300046689 Bacteria 4126
501 Ga0495613_0375863 3300046689 Bacteria 972
502 Ga0495600_0028202 3300046809 Unclassified 3632
503 Ga0495600_0060912 3300046809 Bacteria 2465
504 Ga0495600_0063598 3300046809 Bacteria 2411
505 Ga0495604_0052840 3300047317 Bacteria 3144
506 Ga0495604_0072524 3300047317 Bacteria 2601
507 Ga0495604_0096779 3300047317 Bacteria 2177
508 Ga0495636_0034908 3300047318 Unclassified 2071
509 Ga0495674_0003066 3300047319 Bacteria 16232
510 Ga0495674_0043579 3300047319 Bacteria 3994
511 Ga0495674_0053375 3300047319 Bacteria 3553
512 Ga0495674_0063360 3300047319 Unclassified 3216
513 Ga0495676_0059563 3300047321 Bacteria 2997
514 Ga0495680_0006148 3300047322 Bacteria 11204
515 Ga0495680_0009837 3300047322 Bacteria 8573
516 Ga0495680_0044306 3300047322 Bacteria 3518
517 Ga0495680_0159215 3300047322 Bacteria 1640
518 Ga0495675_0202903 3300047444 Bacteria 1206
519 Ga0495684_0000410 3300047471 Bacteria 34999
520 Ga0495684_0019570 3300047471 Bacteria 5215
521 Ga0495684_0032992 3300047471 Bacteria 3976
522 Ga0495684_0067193 3300047471 Bacteria 2726
523 Ga0495684_0096860 3300047471 Bacteria 2232
524 Ga0495593_0010950 3300047673 Bacteria 5223
525 Ga0495602_0276813 3300048088 Unclassified 1238
526 Ga0495615_0019285 3300048090 Bacteria 1513
527 Ga0496100_0027848 3300048903 Bacteria 3479
528 Ga0496101_0062509 3300048904 Bacteria 2707
529 Ga0496102_0052493 3300048905 Bacteria 3715
530 Ga0496102_0059347 3300048905 Bacteria 3498
531 Ga0496102_0110291 3300048905 Bacteria 2565
532 Ga0496102_0594859 3300048905 Unclassified 1029
533 Ga0496104_0004198 3300048907 Bacteria 12511
534 Ga0496104_0133081 3300048907 Bacteria 2389
535 Ga0496104_0136263 3300048907 Bacteria 2359
536 Ga0496104_0303130 3300048907 Bacteria 1510
537 Ga0496105_0094219 3300048908 Bacteria 2473
538 Ga0496106_0018159 3300048909 Bacteria 5202
539 Ga0496106_0023345 3300048909 Bacteria 4595
540 Ga0496106_0251193 3300048909 Unclassified 1414
541 Ga0496108_0041466 3300048911 Bacteria 3843
542 Ga0496109_0110290 3300048912 Bacteria 2558
543 Ga0496110_0009220 3300048913 Bacteria 7975
544 Ga0496110_0114563 3300048913 Bacteria 2426
545 Ga0496110_0429811 3300048913 Bacteria 1204
546 Ga0496111_0167890 3300048914 Bacteria 1630
547 Ga0496112_0030559 3300048915 Bacteria 5214
548 Ga0496112_0443717 3300048915 Bacteria 1236
549 Ga0496114_0048228 3300048917 Bacteria 3543
550 Ga0496114_0062221 3300048917 Bacteria 3124
551 Ga0496114_0238574 3300048917 Bacteria 1598
552 Ga0496115_0029245 3300048918 Bacteria 4326
553 Ga0501291_003832 3300049514 Bacteria 1890
554 Ga0501296_007593 3300049519 Bacteria 1246
555 Ga0501031_0141420 3300049568 Bacteria 1573
556 Ga0501034_0021166 3300049571 Bacteria 6634
557 Ga0501034_0039374 3300049571 Bacteria 4788
558 Ga0501036_0120761 3300049572 Bacteria 2213
559 Ga0501038_0168642 3300049574 Bacteria 1774
560 Ga0501039_0114135 3300049575 Bacteria 2113
561 Ga0501039_0164363 3300049575 Bacteria 1745
562 Ga0501040_0034852 3300049576 Bacteria 3411
563 Ga0501040_0053093 3300049576 Bacteria 2775
564 Ga0501040_0087021 3300049576 Bacteria 2169
565 Ga0501041_0033405 3300049577 Bacteria 3113
566 Ga0501041_0071403 3300049577 Bacteria 2132
567 Ga0501042_0282717 3300049578 Bacteria 1198
568 Ga0501047_0063760 3300049581 Bacteria 3555
569 Ga0501047_0139105 3300049581 Bacteria 2307
570 Ga0501067_0262083 3300049583 Unclassified 962
571 Ga0501071_0028941 3300049587 Bacteria 3907
572 Ga0501071_0052509 3300049587 Bacteria 2939
573 Ga0501071_0161435 3300049587 Bacteria 1675
574 Ga0501072_0001717 3300049588 Bacteria 16315
575 Ga0501072_0016271 3300049588 Bacteria 5706
576 Ga0501072_0041825 3300049588 Bacteria 3599
577 Ga0501072_0051165 3300049588 Bacteria 3253
578 Ga0501073_0054938 3300049589 Bacteria 2787
579 Ga0501074_0016795 3300049590 Bacteria 5311
580 Ga0501074_0147928 3300049590 Bacteria 1680
581 Ga0501074_0163934 3300049590 Unclassified 1587
582 Ga0501075_0017282 3300049591 Bacteria 5209
583 Ga0501075_0031480 3300049591 Bacteria 3938
584 Ga0501075_0034517 3300049591 Bacteria 3767
585 Ga0501075_0042478 3300049591 Bacteria 3409
586 Ga0501075_0072097 3300049591 Bacteria 2611
587 Ga0501076_0014709 3300049592 Bacteria 5900
588 Ga0501076_0018815 3300049592 Bacteria 5271
589 Ga0501076_0039280 3300049592 Bacteria 3716
590 Ga0501076_0103367 3300049592 Bacteria 2298
591 Ga0501077_0052780 3300049593 Bacteria 2581
592 Ga0501228_001032 3300049666 Bacteria 1940
593 Ga0501225_0038236 3300049705 Bacteria 1322
594 Ga0501225_0090986 3300049705 Bacteria 884
595 Ga0501245_009500 3300049708 Bacteria 1397
596 Ga0501079_0052886 3300049741 Bacteria 3133
597 Ga0501079_0076827 3300049741 Bacteria 2583
598 Ga0501079_0161132 3300049741 Bacteria 1749
599 Ga0501080_0032031 3300049742 Bacteria 4901
600 Ga0501080_0100483 3300049742 Bacteria 2683
601 Ga0501080_0148377 3300049742 Bacteria 2168
602 Ga0501080_0491768 3300049742 Bacteria 1097
603 Ga0501081_0067909 3300049743 Bacteria 2481
604 Ga0501081_0122108 3300049743 Bacteria 1856
605 Ga0501081_0160513 3300049743 Bacteria 1620
606 Ga0501081_0179712 3300049743 Bacteria 1530
607 Ga0501081_0321440 3300049743 Bacteria 1137
608 Ga0501083_0003233 3300049744 Bacteria 11364
609 Ga0501045_0011704 3300049824 Bacteria 6163
610 Ga0501045_0025027 3300049824 Bacteria 4288
611 Ga0501045_0047365 3300049824 Bacteria 3131
612 Ga0501045_0144509 3300049824 Bacteria 1769
613 Ga0501212_001937 3300049851 Bacteria 2423
614 nmdc:mga03683_11191_c1 3300050489 Bacteria 3240
615 nmdc:mga00v17_20572_c1 3300050491 Bacteria 3783
616 nmdc:mga0yw44_240855_c1 3300050492 Unclassified 1202
617 nmdc:mga0yw44_47991_c1 3300050492 Bacteria 2573
618 nmdc:mga0k408_60061_c1 3300050493 Bacteria 2209
619 nmdc:mga0k408_7107_c1 3300050493 Bacteria 4983
620 nmdc:mga04h51_27638_c1 3300050495 Unclassified 1764
621 nmdc:mga07m45_26886_c1 3300050496 Bacteria 3165
622 nmdc:mga05p37_171351_c1 3300050507 Bacteria 2647
623 nmdc:mga05p37_18589_c1 3300050507 Bacteria 8400
624 nmdc:mga05p37_257403_c1 3300050507 Unclassified 2091
625 nmdc:mga05p37_287962_c1 3300050507 Bacteria 1956
626 nmdc:mga05p37_3009_c1 3300050507 Bacteria 19557
627 nmdc:mga05p37_36688_c1 3300050507 Bacteria 6011
628 nmdc:mga05p37_67193_c1 3300050507 Bacteria 4410
629 nmdc:mga05p37_89322_c1 3300050507 Bacteria 3797
630 nmdc:mga09592_16509_c1 3300050508 Bacteria 6040
631 nmdc:mga09592_4546_c1 3300050508 Bacteria 11224
632 nmdc:mga09592_51940_c2 3300050508 Bacteria 2880
633 nmdc:mga0qj67_108582_c1 3300050509 Bacteria 2239
634 nmdc:mga0qj67_139625_c1 3300050509 Bacteria 1964
635 nmdc:mga0qj67_226406_c1 3300050509 Bacteria 1518
636 nmdc:mga0qj67_3398_c1 3300050509 Bacteria 11483
637 nmdc:mga06r32_211931_c1 3300050510 Unclassified 1925
638 nmdc:mga06r32_234606_c1 3300050510 Bacteria 1822
639 nmdc:mga06r32_4718_c1 3300050510 Bacteria 12256
640 nmdc:mga06r32_71529_c1 3300050510 Bacteria 3357
641 nmdc:mga08y16_118832_c1 3300050511 Bacteria 2751
642 nmdc:mga08y16_131_c1 3300050511 Bacteria 64623
643 nmdc:mga08y16_22528_c1 3300050511 Bacteria 6651
644 nmdc:mga08y16_329880_c1 3300050511 Unclassified 1570
645 nmdc:mga08y16_513988_c1 3300050511 Bacteria 1215
646 nmdc:mga08y16_58929_c1 3300050511 Bacteria 4012
647 nmdc:mga08y16_71797_c1 3300050511 Bacteria 3607
648 nmdc:mga08y16_88974_c1 3300050511 Bacteria 3218
649 nmdc:mga0n895_15302_c1 3300050512 Bacteria 6989
650 nmdc:mga0n895_2022_c1 3300050512 Bacteria 15597
651 nmdc:mga0n895_256769_c1 3300050512 Bacteria 1774
652 nmdc:mga0n895_303186_c1 3300050512 Bacteria 1619
653 nmdc:mga0n895_392444_c1 3300050512 Bacteria 1404
654 nmdc:mga0n895_472454_c1 3300050512 Bacteria 1265
655 nmdc:mga0n895_90460_c1 3300050512 Bacteria 3062
656 nmdc:mga0n895_95388_c1 3300050512 Bacteria 2979
657 nmdc:mga0rr50_162124_c1 3300050513 Unclassified 1815
658 nmdc:mga0rr50_194490_c1 3300050513 Bacteria 1664
659 nmdc:mga0rr50_21272_c1 3300050513 Bacteria 4424
660 nmdc:mga0rr50_370238_c1 3300050513 Bacteria 1207
661 nmdc:mga0rr50_783_c1 3300050513 Bacteria 17103
662 nmdc:mga0rr50_9454_c1 3300050513 Bacteria 6130
663 nmdc:mga08x19_127533_c1 3300050514 Bacteria 1710
664 nmdc:mga08x19_18246_c1 3300050514 Bacteria 4300
665 nmdc:mga08x19_61987_c1 3300050514 Bacteria 2424
666 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
667 nmdc:mga0a205_113883_c1 3300050515 Bacteria 2603
668 nmdc:mga0a205_15170_c1 3300050515 Bacteria 7197
669 nmdc:mga0a205_32599_c1 3300050515 Bacteria 4995
670 nmdc:mga0a205_382905_c1 3300050515 Bacteria 1272
671 nmdc:mga0a205_52960_c1 3300050515 Bacteria 3917
672 Ga0495601_0001652 3300053077 Bacteria 12310
673 Ga0495601_0006540 3300053077 Bacteria 6817
674 Ga0495601_0047880 3300053077 Bacteria 2692
675 Ga0495601_0074925 3300053077 Bacteria 2166
676 Ga0495601_0082190 3300053077 Bacteria 2068
677 Ga0495612_0000673 3300053078 Bacteria 13811
678 Ga0495595_0009202 3300053084 Bacteria 4079
679 Ga0495595_0037774 3300053084 Bacteria 2197
680 Ga0495619_0025632 3300053085 Bacteria 3788
681 Ga0495619_0034069 3300053085 Bacteria 3309
682 Ga0495619_0043174 3300053085 Bacteria 2955
683 Ga0495619_0069762 3300053085 Bacteria 2350
684 Ga0495619_0082013 3300053085 Bacteria 2173
685 Ga0495619_0182191 3300053085 Unclassified 1453
686 Ga0500628_000685 3300053129 Bacteria 6093
687 Ga0501084_0019389 3300054114 Bacteria 5666
688 Ga0501084_0084855 3300054114 Bacteria 2659
689 Ga0501084_0097686 3300054114 Bacteria 2466
690 Ga0501084_0221279 3300054114 Bacteria 1597
691 Ga0590075_000007 3300059424 Bacteria 63273
692 Ga0590075_010254 3300059424 Bacteria 2254
693 Ga0590077_000017 3300059426 Bacteria 38492
694 Ga0501082_0328214 3300060353 Bacteria 1333
695 Ga0501082_0338538 3300060353 Bacteria 1311
696 Ga0466962_0011030 3300061719 Bacteria 4351
697 Ga0530510_0006387 3300061734 Bacteria 8206
698 Ga0530510_0032255 3300061734 Bacteria 3768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046680 Ga0495646_0275497 Ga0495646_0275497_141_878 233
2 3300036401 Ga0373937_0048276 Ga0373937_0048276_3131_3868 239
3 3300046477 Ga0495664_0049594 Ga0495664_0049594_19_774 239
4 3300046675 Ga0495657_0020336 Ga0495657_0020336_18_755 239
5 3300046678 Ga0495599_0093614 Ga0495599_0093614_1103_1840 239
6 3300053084 Ga0495595_0037774 Ga0495595_0037774_18_755 239
7 3300048088 Ga0495602_0276813 Ga0495602_0276813_461_1216 245
8 3300048904 Ga0496101_0062509 Ga0496101_0062509_910_1740 270
9 3300049705 Ga0501225_0090986 Ga0501225_0090986_60_872 270
10 3300035691 Ga0373931_0210689 Ga0373931_0210689_40_855 271
11 3300046675 Ga0495657_0075452 Ga0495657_0075452_419_1279 280
12 3300005331 Ga0070670_100371536 Ga0070670_1003715362 286
13 3300025908 Ga0207643_10131412 Ga0207643_101314122 286
14 3300006038 Ga0075365_10136705 Ga0075365_101367051 287
15 3300006051 Ga0075364_10186746 Ga0075364_101867462 287
16 3300009094 Ga0111539_10370253 Ga0111539_103702532 287
17 3300011119 Ga0105246_10343557 Ga0105246_103435572 287
18 3300025945 Ga0207679_10190278 Ga0207679_101902782 287
19 3300046454 Ga0495592_0131019 Ga0495592_0131019_143_1042 287
20 3300046473 Ga0495582_0062304 Ga0495582_0062304_1138_2037 287
21 3300046511 Ga0495608_0083084 Ga0495608_0083084_995_1894 287
22 3300046517 Ga0495630_0020164 Ga0495630_0020164_2972_3871 287
23 3300046529 Ga0495652_0029681 Ga0495652_0029681_3434_4333 287
24 3300046533 Ga0495640_0076220 Ga0495640_0076220_866_1765 287
25 3300046559 Ga0495667_0002831 Ga0495667_0002831_4049_4948 287
26 3300046642 Ga0495634_0006252 Ga0495634_0006252_7826_8725 287
27 3300046689 Ga0495613_0028865 Ga0495613_0028865_1011_1910 287
28 3300047317 Ga0495604_0052840 Ga0495604_0052840_983_1882 287
29 3300047319 Ga0495674_0003066 Ga0495674_0003066_6663_7562 287
30 3300047471 Ga0495684_0032992 Ga0495684_0032992_1500_2399 287
31 3300053077 Ga0495601_0082190 Ga0495601_0082190_1100_1999 287
32 3300045049 Ga0466959_0217918 Ga0466959_0217918_387_1271 288
33 3300045836 Ga0466958_0022930 Ga0466958_0022930_2256_3140 288
34 3300039437 Ga0436365_0917382 Ga0436365_0917382_334_1221 289
35 3300044842 Ga0466957_0152261 Ga0466957_0152261_182_1069 289
36 3300045976 Ga0466967_0067919 Ga0466967_0067919_1303_2190 289
37 3300061719 Ga0466962_0011030 Ga0466962_0011030_1875_2762 289
38 3300005577 Ga0068857_100271381 Ga0068857_1002713812 291
39 3300006844 Ga0075428_100326759 Ga0075428_1003267592 291
40 3300026116 Ga0207674_10110330 Ga0207674_101103303 291
41 3300053085 Ga0495619_0182191 Ga0495619_0182191_10_885 291
42 3300005327 Ga0070658_10346652 Ga0070658_103466522 292
43 3300005336 Ga0070680_100021880 Ga0070680_1000218802 292
44 3300005530 Ga0070679_100205496 Ga0070679_1002054963 292
45 3300013307 Ga0157372_10196052 Ga0157372_101960523 292
46 3300020082 Ga0206353_11316981 Ga0206353_113169813 292
47 3300020082 Ga0206353_11357636 Ga0206353_113576362 292
48 3300025909 Ga0207705_10282570 Ga0207705_102825702 292
49 3300025917 Ga0207660_10126289 Ga0207660_101262892 292
50 3300028573 Ga0265334_10013622 Ga0265334_100136223 292
51 3300028577 Ga0265318_10028408 Ga0265318_100284082 292
52 3300028654 Ga0265322_10006453 Ga0265322_100064533 292
53 3300028800 Ga0265338_10054424 Ga0265338_100544243 292
54 3300031242 Ga0265329_10006749 Ga0265329_100067494 292
55 3300031250 Ga0265331_10070827 Ga0265331_100708272 292
56 3300031251 Ga0265327_10012028 Ga0265327_100120287 292
57 3300031344 Ga0265316_10005017 Ga0265316_100050173 292
58 3300031595 Ga0265313_10014646 Ga0265313_100146462 292
59 3300031711 Ga0265314_10003428 Ga0265314_1000342816 292
60 3300035172 Ga0373955_0017989 Ga0373955_0017989_1935_2834 292
61 3300037466 Ga0395898_0223370 Ga0395898_0223370_162_1058 292
62 3300044694 Ga0466963_0003999 Ga0466963_0003999_4356_5252 292
63 3300046454 Ga0495592_0055736 Ga0495592_0055736_147_1046 292
64 3300046459 Ga0495629_0016241 Ga0495629_0016241_70_966 292
65 3300046462 Ga0495651_0007517 Ga0495651_0007517_5584_6483 292
66 3300046463 Ga0495653_0044397 Ga0495653_0044397_1081_1980 292
67 3300046516 Ga0495628_0130551 Ga0495628_0130551_913_1812 292
68 3300046517 Ga0495630_0023403 Ga0495630_0023403_194_1093 292
69 3300046536 Ga0495587_0008243 Ga0495587_0008243_2706_3605 292
70 3300046559 Ga0495667_0096059 Ga0495667_0096059_908_1807 292
71 3300046680 Ga0495646_0017390 Ga0495646_0017390_95_994 292
72 3300047317 Ga0495604_0072524 Ga0495604_0072524_1585_2484 292
73 3300047322 Ga0495680_0044306 Ga0495680_0044306_1724_2623 292
74 3300048905 Ga0496102_0594859 Ga0496102_0594859_94_990 292
75 3300048907 Ga0496104_0133081 Ga0496104_0133081_823_1719 292
76 3300048908 Ga0496105_0094219 Ga0496105_0094219_458_1354 292
77 3300048909 Ga0496106_0251193 Ga0496106_0251193_371_1267 292
78 3300048918 Ga0496115_0029245 Ga0496115_0029245_1623_2519 292
79 3300005364 Ga0070673_100450857 Ga0070673_1004508571 293
80 3300014969 Ga0157376_10091538 Ga0157376_100915383 293
81 3300025928 Ga0207700_10121834 Ga0207700_101218342 293
82 3300035089 Ga0373944_0002673 Ga0373944_0002673_843_1742 293
83 3300035113 Ga0373936_0102803 Ga0373936_0102803_200_1099 293
84 3300035116 Ga0373945_0020912 Ga0373945_0020912_624_1523 293
85 3300035170 Ga0373943_0000048 Ga0373943_0000048_2163_3062 293
86 3300035725 Ga0373947_0000658 Ga0373947_0000658_15299_16198 293
87 3300037068 Ga0373925_0011642 Ga0373925_0011642_2843_3742 293
88 3300046459 Ga0495629_0000159 Ga0495629_0000159_31381_32280 293
89 3300046459 Ga0495629_0099492 Ga0495629_0099492_269_1168 293
90 3300046461 Ga0495641_0003425 Ga0495641_0003425_9621_10520 293
91 3300046462 Ga0495651_0041923 Ga0495651_0041923_2297_3196 293
92 3300046463 Ga0495653_0025252 Ga0495653_0025252_41_940 293
93 3300046463 Ga0495653_0055532 Ga0495653_0055532_671_1570 293
94 3300046473 Ga0495582_0000183 Ga0495582_0000183_30896_31795 293
95 3300046476 Ga0495662_0000220 Ga0495662_0000220_7955_8854 293
96 3300046476 Ga0495662_0023171 Ga0495662_0023171_728_1627 293
97 3300046511 Ga0495608_0105871 Ga0495608_0105871_414_1313 293
98 3300046511 Ga0495608_0113079 Ga0495608_0113079_668_1567 293
99 3300046514 Ga0495618_0080991 Ga0495618_0080991_465_1364 293
100 3300046517 Ga0495630_0065501 Ga0495630_0065501_499_1398 293
101 3300046526 Ga0495666_0041605 Ga0495666_0041605_608_1507 293
102 3300046529 Ga0495652_0145126 Ga0495652_0145126_799_1698 293
103 3300046531 Ga0495665_0001453 Ga0495665_0001453_11465_12364 293
104 3300046533 Ga0495640_0017528 Ga0495640_0017528_3709_4608 293
105 3300046536 Ga0495587_0044110 Ga0495587_0044110_1479_2378 293
106 3300046559 Ga0495667_0033511 Ga0495667_0033511_2415_3314 293
107 3300046642 Ga0495634_0022820 Ga0495634_0022820_2048_2947 293
108 3300046642 Ga0495634_0051646 Ga0495634_0051646_550_1449 293
109 3300046678 Ga0495599_0103068 Ga0495599_0103068_351_1250 293
110 3300046683 Ga0495658_0003812 Ga0495658_0003812_2142_3041 293
111 3300046689 Ga0495613_0018344 Ga0495613_0018344_4306_5205 293
112 3300046689 Ga0495613_0375863 Ga0495613_0375863_28_927 293
113 3300046809 Ga0495600_0063598 Ga0495600_0063598_777_1676 293
114 3300047317 Ga0495604_0096779 Ga0495604_0096779_131_1030 293
115 3300047319 Ga0495674_0043579 Ga0495674_0043579_2733_3632 293
116 3300047319 Ga0495674_0053375 Ga0495674_0053375_1193_2092 293
117 3300047321 Ga0495676_0059563 Ga0495676_0059563_682_1581 293
118 3300047322 Ga0495680_0006148 Ga0495680_0006148_2001_2900 293
119 3300047322 Ga0495680_0009837 Ga0495680_0009837_6267_7166 293
120 3300047444 Ga0495675_0202903 Ga0495675_0202903_89_988 293
121 3300047471 Ga0495684_0019570 Ga0495684_0019570_3773_4672 293
122 3300047471 Ga0495684_0096860 Ga0495684_0096860_492_1391 293
123 3300047673 Ga0495593_0010950 Ga0495593_0010950_4063_4962 293
124 3300048903 Ga0496100_0027848 Ga0496100_0027848_1975_2874 293
125 3300048907 Ga0496104_0136263 Ga0496104_0136263_612_1511 293
126 3300048914 Ga0496111_0167890 Ga0496111_0167890_573_1472 293
127 3300048915 Ga0496112_0443717 Ga0496112_0443717_266_1165 293
128 3300048917 Ga0496114_0062221 Ga0496114_0062221_278_1177 293
129 3300053077 Ga0495601_0047880 Ga0495601_0047880_750_1649 293
130 3300053084 Ga0495595_0009202 Ga0495595_0009202_1463_2362 293
131 3300053085 Ga0495619_0025632 Ga0495619_0025632_1417_2316 293
132 3300053085 Ga0495619_0034069 Ga0495619_0034069_1347_2246 293
133 3300005435 Ga0070714_100066741 Ga0070714_1000667412 294
134 3300045976 Ga0466967_0438244 Ga0466967_0438244_152_1054 294
135 3300005327 Ga0070658_10083661 Ga0070658_100836612 297
136 3300028800 Ga0265338_10005122 Ga0265338_100051222 297
137 3300035410 Ga0373924_0050144 Ga0373924_0050144_522_1433 297
138 3300041410 Ga0439461_0023094 Ga0439461_0023094_217_1131 297
139 3300042156 Ga0439446_0001453 Ga0439446_0001453_2659_3573 297
140 3300045976 Ga0466967_0156395 Ga0466967_0156395_186_1097 297
141 3300045976 Ga0466967_0273605 Ga0466967_0273605_609_1520 297
142 3300046462 Ga0495651_0073811 Ga0495651_0073811_493_1404 297
143 3300046463 Ga0495653_0041699 Ga0495653_0041699_1288_2199 297
144 3300046511 Ga0495608_0094669 Ga0495608_0094669_390_1301 297
145 3300046663 Ga0495635_0179944 Ga0495635_0179944_34_945 297
146 3300046809 Ga0495600_0060912 Ga0495600_0060912_82_993 297
147 3300047322 Ga0495680_0159215 Ga0495680_0159215_698_1609 297
148 3300047471 Ga0495684_0067193 Ga0495684_0067193_445_1356 297
149 3300048907 Ga0496104_0303130 Ga0496104_0303130_376_1287 297
150 3300048913 Ga0496110_0429811 Ga0496110_0429811_249_1160 297
151 3300053085 Ga0495619_0043174 Ga0495619_0043174_1879_2790 297
152 3300005327 Ga0070658_10070236 Ga0070658_100702362 298
153 3300037312 Ga0395899_0126231 Ga0395899_0126231_807_1718 298
154 3300037466 Ga0395898_0324264 Ga0395898_0324264_69_980 298
155 3300038443 Ga0395901_0017241 Ga0395901_0017241_2099_3010 298
156 3300044694 Ga0466963_0014151 Ga0466963_0014151_329_1240 298
157 3300045836 Ga0466958_0194223 Ga0466958_0194223_333_1244 298
158 3300049581 Ga0501047_0063760 Ga0501047_0063760_653_1564 298
159 3300049588 Ga0501072_0041825 Ga0501072_0041825_1455_2366 298
160 3300049589 Ga0501073_0054938 Ga0501073_0054938_436_1347 298
161 3300049590 Ga0501074_0016795 Ga0501074_0016795_556_1467 298
162 3300049741 Ga0501079_0052886 Ga0501079_0052886_1415_2326 298
163 3300049742 Ga0501080_0100483 Ga0501080_0100483_1623_2534 298
164 3300049744 Ga0501083_0003233 Ga0501083_0003233_920_1831 298
165 3300054114 Ga0501084_0084855 Ga0501084_0084855_1697_2608 298
166 3300009177 Ga0105248_10040098 Ga0105248_100400983 299
167 3300044842 Ga0466957_0148788 Ga0466957_0148788_27_974 299
168 3300050513 nmdc:mga0rr50_370238_c1 nmdc:mga0rr50_370238_c1_14_913 299
169 3300005364 Ga0070673_100009749 Ga0070673_1000097493 300
170 3300005616 Ga0068852_100052721 Ga0068852_1000527211 303
171 3300009551 Ga0105238_10071935 Ga0105238_100719352 303
172 3300026041 Ga0207639_10091690 Ga0207639_100916902 303
173 3300049583 Ga0501067_0262083 Ga0501067_0262083_29_943 304
174 3300031731 Ga0307405_10010189 Ga0307405_100101894 305
175 3300009147 Ga0114129_10004439 Ga0114129_1000443915 306
176 3300050510 nmdc:mga06r32_211931_c1 nmdc:mga06r32_211931_c1_66_995 306
177 3300031548 Ga0307408_100238458 Ga0307408_1002384582 307
178 3300031731 Ga0307405_10113022 Ga0307405_101130222 307
179 3300031903 Ga0307407_10056688 Ga0307407_100566882 307
180 3300050515 nmdc:mga0a205_15170_c1 nmdc:mga0a205_15170_c1_3742_4758 307
181 3300009147 Ga0114129_10012726 Ga0114129_100127263 308
182 3300026089 Ga0207648_10232549 Ga0207648_102325492 312
183 3300005444 Ga0070694_100024140 Ga0070694_1000241402 313
184 3300026035 Ga0207703_10215209 Ga0207703_102152092 313
185 3300006358 Ga0068871_100002742 Ga0068871_1000027424 314
186 3300046471 Ga0495650_0000398 Ga0495650_0000398_16490_17494 314
187 3300009147 Ga0114129_10378306 Ga0114129_103783062 315
188 3300005366 Ga0070659_100188630 Ga0070659_1001886302 316
189 3300025932 Ga0207690_10036795 Ga0207690_100367952 316
190 3300005440 Ga0070705_100113329 Ga0070705_1001133291 317
191 3300009148 Ga0105243_10341515 Ga0105243_103415152 317
192 3300026075 Ga0207708_10391927 Ga0207708_103919271 317
193 3300025913 Ga0207695_10316554 Ga0207695_103165542 318
194 3300005329 Ga0070683_100009004 Ga0070683_1000090042 319
195 3300006051 Ga0075364_10051972 Ga0075364_100519722 319
196 3300025944 Ga0207661_10043650 Ga0207661_100436502 319
197 3300046543 Ga0495645_0000023 Ga0495645_0000023_104279_105238 319
198 3300046678 Ga0495599_0159430 Ga0495599_0159430_269_1228 319
199 3300050491 nmdc:mga00v17_20572_c1 nmdc:mga00v17_20572_c1_683_1696 319
200 3300005456 Ga0070678_100062395 Ga0070678_1000623951 320
201 3300031733 Ga0316577_10061688 Ga0316577_100616881 320
202 3300048917 Ga0496114_0048228 Ga0496114_0048228_1048_2064 320
203 3300006038 Ga0075365_10057675 Ga0075365_100576751 321
204 3300006042 Ga0075368_10026605 Ga0075368_100266053 321
205 3300006177 Ga0075362_10028192 Ga0075362_100281923 321
206 3300006178 Ga0075367_10048695 Ga0075367_100486951 321
207 3300036401 Ga0373937_0002273 Ga0373937_0002273_14849_15862 321
208 3300037471 Ga0395905_0118230 Ga0395905_0118230_902_1918 321
209 3300038443 Ga0395901_0027704 Ga0395901_0027704_4735_5751 321
210 3300050489 nmdc:mga03683_11191_c1 nmdc:mga03683_11191_c1_2066_3079 321
211 3300050492 nmdc:mga0yw44_47991_c1 nmdc:mga0yw44_47991_c1_1247_2260 321
212 3300050493 nmdc:mga0k408_60061_c1 nmdc:mga0k408_60061_c1_294_1307 321
213 3300050493 nmdc:mga0k408_7107_c1 nmdc:mga0k408_7107_c1_205_1218 321
214 3300053077 Ga0495601_0074925 Ga0495601_0074925_928_1941 321
215 3300002077 JGI24744J21845_10019466 JGI24744J21845_100194661 322
216 3300005293 Ga0065715_10107788 Ga0065715_101077882 322
217 3300005329 Ga0070683_100126998 Ga0070683_1001269983 322
218 3300005331 Ga0070670_100012891 Ga0070670_1000128916 322
219 3300005335 Ga0070666_10018735 Ga0070666_100187355 322
220 3300005338 Ga0068868_100157930 Ga0068868_1001579302 322
221 3300005344 Ga0070661_100130632 Ga0070661_1001306321 322
222 3300005366 Ga0070659_100100460 Ga0070659_1001004602 322
223 3300005455 Ga0070663_100073764 Ga0070663_1000737643 322
224 3300005457 Ga0070662_100120176 Ga0070662_1001201762 322
225 3300005471 Ga0070698_100059606 Ga0070698_1000596061 322
226 3300005578 Ga0068854_100039869 Ga0068854_1000398693 322
227 3300005617 Ga0068859_100490538 Ga0068859_1004905381 322
228 3300006871 Ga0075434_100133581 Ga0075434_1001335814 322
229 3300006931 Ga0097620_100490545 Ga0097620_1004905452 322
230 3300007076 Ga0075435_100011606 Ga0075435_1000116062 322
231 3300025315 Ga0207697_10000602 Ga0207697_100006026 322
232 3300025903 Ga0207680_10018805 Ga0207680_100188052 322
233 3300025913 Ga0207695_10143191 Ga0207695_101431912 322
234 3300025918 Ga0207662_10183241 Ga0207662_101832412 322
235 3300025925 Ga0207650_10066216 Ga0207650_100662162 322
236 3300025932 Ga0207690_10167795 Ga0207690_101677952 322
237 3300025940 Ga0207691_10133895 Ga0207691_101338951 322
238 3300025944 Ga0207661_10164942 Ga0207661_101649421 322
239 3300026023 Ga0207677_10245667 Ga0207677_102456671 322
240 3300032002 Ga0307416_100099938 Ga0307416_1000999381 322
241 3300032002 Ga0307416_100735449 Ga0307416_1007354491 322
242 3300032005 Ga0307411_10021439 Ga0307411_100214392 322
243 3300032126 Ga0307415_100140245 Ga0307415_1001402452 322
244 3300046472 Ga0495580_0092053 Ga0495580_0092053_607_1617 322
245 3300048911 Ga0496108_0041466 Ga0496108_0041466_1474_2499 322
246 3300005468 Ga0070707_100031363 Ga0070707_1000313632 323
247 3300005518 Ga0070699_100035557 Ga0070699_1000355571 323
248 3300005518 Ga0070699_100192635 Ga0070699_1001926352 323
249 3300005536 Ga0070697_100025048 Ga0070697_1000250482 323
250 3300005719 Ga0068861_100019169 Ga0068861_1000191692 323
251 3300006173 Ga0070716_100170906 Ga0070716_1001709062 323
252 3300009147 Ga0114129_10063845 Ga0114129_100638454 323
253 3300014326 Ga0157380_10205966 Ga0157380_102059662 323
254 3300014326 Ga0157380_10230286 Ga0157380_102302862 323
255 3300025922 Ga0207646_10020313 Ga0207646_100203135 323
256 3300026118 Ga0207675_100043408 Ga0207675_1000434082 323
257 3300042436 Ga0439435_0000202 Ga0439435_0000202_5921_6937 323
258 3300050512 nmdc:mga0n895_95388_c1 nmdc:mga0n895_95388_c1_163_1179 323
259 3300050514 nmdc:mga08x19_18246_c1 nmdc:mga08x19_18246_c1_2513_3529 323
260 3300005339 Ga0070660_100069564 Ga0070660_1000695642 324
261 3300005445 Ga0070708_100174480 Ga0070708_1001744803 324
262 3300005456 Ga0070678_100036127 Ga0070678_1000361272 324
263 3300005549 Ga0070704_100007453 Ga0070704_1000074533 324
264 3300006038 Ga0075365_10087648 Ga0075365_100876482 324
265 3300006051 Ga0075364_10162599 Ga0075364_101625991 324
266 3300006178 Ga0075367_10024190 Ga0075367_100241902 324
267 3300006353 Ga0075370_10003272 Ga0075370_100032725 324
268 3300006844 Ga0075428_100004191 Ga0075428_1000041914 324
269 3300006844 Ga0075428_100030614 Ga0075428_1000306145 324
270 3300006844 Ga0075428_100061064 Ga0075428_1000610641 324
271 3300006846 Ga0075430_100004048 Ga0075430_1000040484 324
272 3300006846 Ga0075430_100014030 Ga0075430_1000140303 324
273 3300006846 Ga0075430_100120550 Ga0075430_1001205502 324
274 3300006847 Ga0075431_100002803 Ga0075431_1000028038 324
275 3300006847 Ga0075431_100276290 Ga0075431_1002762902 324
276 3300006847 Ga0075431_100442968 Ga0075431_1004429682 324
277 3300006880 Ga0075429_100001043 Ga0075429_1000010438 324
278 3300006880 Ga0075429_100003470 Ga0075429_1000034706 324
279 3300009094 Ga0111539_10000118 Ga0111539_1000011834 324
280 3300009094 Ga0111539_10425324 Ga0111539_104253241 324
281 3300009147 Ga0114129_10000324 Ga0114129_1000032439 324
282 3300009147 Ga0114129_10027164 Ga0114129_100271648 324
283 3300009147 Ga0114129_10118576 Ga0114129_101185763 324
284 3300025922 Ga0207646_10000495 Ga0207646_1000049540 324
285 3300027907 Ga0207428_10000967 Ga0207428_1000096719 324
286 3300031548 Ga0307408_100015965 Ga0307408_1000159655 324
287 3300031665 Ga0316575_10027668 Ga0316575_100276681 324
288 3300031901 Ga0307406_10149598 Ga0307406_101495982 324
289 3300031901 Ga0307406_10381575 Ga0307406_103815751 324
290 3300032002 Ga0307416_100157291 Ga0307416_1001572911 324
291 3300032002 Ga0307416_100198601 Ga0307416_1001986012 324
292 3300032126 Ga0307415_100348365 Ga0307415_1003483651 324
293 3300035398 Ga0316574_0010860 Ga0316574_0010860_4077_5093 324
294 3300042007 Ga0439449_0032473 Ga0439449_0032473_161_1177 324
295 3300042461 Ga0439460_0019865 Ga0439460_0019865_84_1100 324
296 3300042993 Ga0439440_0010671 Ga0439440_0010671_888_1904 324
297 3300047318 Ga0495636_0034908 Ga0495636_0034908_26_1000 324
298 3300048917 Ga0496114_0238574 Ga0496114_0238574_20_1036 324
299 3300050492 nmdc:mga0yw44_240855_c1 nmdc:mga0yw44_240855_c1_64_1077 324
300 3300050495 nmdc:mga04h51_27638_c1 nmdc:mga04h51_27638_c1_337_1350 324
301 3300050496 nmdc:mga07m45_26886_c1 nmdc:mga07m45_26886_c1_1326_2339 324
302 3300050507 nmdc:mga05p37_3009_c1 nmdc:mga05p37_3009_c1_15648_16664 324
303 3300050507 nmdc:mga05p37_67193_c1 nmdc:mga05p37_67193_c1_3118_4134 324
304 3300050508 nmdc:mga09592_16509_c1 nmdc:mga09592_16509_c1_674_1690 324
305 3300050508 nmdc:mga09592_4546_c1 nmdc:mga09592_4546_c1_2041_3057 324
306 3300050509 nmdc:mga0qj67_108582_c1 nmdc:mga0qj67_108582_c1_292_1308 324
307 3300050509 nmdc:mga0qj67_226406_c1 nmdc:mga0qj67_226406_c1_196_1212 324
308 3300050509 nmdc:mga0qj67_3398_c1 nmdc:mga0qj67_3398_c1_8509_9525 324
309 3300050510 nmdc:mga06r32_4718_c1 nmdc:mga06r32_4718_c1_5176_6192 324
310 3300050510 nmdc:mga06r32_71529_c1 nmdc:mga06r32_71529_c1_969_1985 324
311 3300050511 nmdc:mga08y16_131_c1 nmdc:mga08y16_131_c1_11108_12124 324
312 3300059424 Ga0590075_010254 Ga0590075_010254_86_1102 324
313 3300005293 Ga0065715_10021386 Ga0065715_100213861 325
314 3300005343 Ga0070687_100092226 Ga0070687_1000922262 325
315 3300005353 Ga0070669_100000692 Ga0070669_10000069219 325
316 3300005365 Ga0070688_100246475 Ga0070688_1002464751 325
317 3300005457 Ga0070662_100229603 Ga0070662_1002296031 325
318 3300005577 Ga0068857_100028746 Ga0068857_1000287462 325
319 3300005617 Ga0068859_100413302 Ga0068859_1004133022 325
320 3300005840 Ga0068870_10020276 Ga0068870_100202762 325
321 3300006844 Ga0075428_100456145 Ga0075428_1004561452 325
322 3300006852 Ga0075433_10075895 Ga0075433_100758952 325
323 3300006871 Ga0075434_100005682 Ga0075434_1000056829 325
324 3300006931 Ga0097620_100413316 Ga0097620_1004133162 325
325 3300009094 Ga0111539_10000587 Ga0111539_100005871 325
326 3300009553 Ga0105249_10001518 Ga0105249_100015182 325
327 3300025923 Ga0207681_10038314 Ga0207681_100383142 325
328 3300025961 Ga0207712_10076502 Ga0207712_100765022 325
329 3300026116 Ga0207674_10039188 Ga0207674_100391885 325
330 3300027907 Ga0207428_10057404 Ga0207428_100574042 325
331 3300034820 Ga0373959_0000891 Ga0373959_0000891_154_1173 325
332 3300044712 Ga0453684_0144569 Ga0453684_0144569_565_1581 325
333 3300049581 Ga0501047_0139105 Ga0501047_0139105_505_1518 325
334 3300049742 Ga0501080_0148377 Ga0501080_0148377_597_1610 325
335 3300050511 nmdc:mga08y16_22528_c1 nmdc:mga08y16_22528_c1_1597_2613 325
336 3300050511 nmdc:mga08y16_71797_c1 nmdc:mga08y16_71797_c1_1430_2446 325
337 3300050512 nmdc:mga0n895_15302_c1 nmdc:mga0n895_15302_c1_1466_2482 325
338 3300050513 nmdc:mga0rr50_21272_c1 nmdc:mga0rr50_21272_c1_1657_2673 325
339 3300050515 nmdc:mga0a205_32599_c1 nmdc:mga0a205_32599_c1_755_1771 325
340 3300050515 nmdc:mga0a205_382905_c1 nmdc:mga0a205_382905_c1_244_1260 325
341 3300006844 Ga0075428_100032575 Ga0075428_1000325751 326
342 3300009147 Ga0114129_10144348 Ga0114129_101443483 326
343 3300049588 Ga0501072_0001717 Ga0501072_0001717_4571_5587 326
344 3300049590 Ga0501074_0163934 Ga0501074_0163934_351_1367 326
345 3300049591 Ga0501075_0031480 Ga0501075_0031480_2090_3106 326
346 3300049592 Ga0501076_0103367 Ga0501076_0103367_50_1066 326
347 3300049741 Ga0501079_0076827 Ga0501079_0076827_80_1096 326
348 3300049743 Ga0501081_0067909 Ga0501081_0067909_741_1757 326
349 3300049743 Ga0501081_0160513 Ga0501081_0160513_33_1049 326
350 3300049824 Ga0501045_0047365 Ga0501045_0047365_471_1487 326
351 3300050507 nmdc:mga05p37_287962_c1 nmdc:mga05p37_287962_c1_33_1049 326
352 3300050511 nmdc:mga08y16_118832_c1 nmdc:mga08y16_118832_c1_1540_2556 326
353 3300059424 Ga0590075_000007 Ga0590075_000007_11706_12722 326
354 3300059426 Ga0590077_000017 Ga0590077_000017_21169_22185 326
355 iso_pu_bacteria 2738543011 2739237312 326
356 iso_pu_bacteria 2889300758 2889302453 326
357 iso_pu_bacteria 2939743619 2939748975 326
358 3300014326 Ga0157380_10378357 Ga0157380_103783571 327
359 3300005614 Ga0068856_100140285 Ga0068856_1001402853 328
360 3300006844 Ga0075428_100349812 Ga0075428_1003498122 328
361 3300009147 Ga0114129_10154143 Ga0114129_101541432 328
362 3300009148 Ga0105243_10000050 Ga0105243_1000005057 328
363 3300009176 Ga0105242_10000654 Ga0105242_1000065418 328
364 3300025934 Ga0207686_10000028 Ga0207686_1000002857 328
365 3300025935 Ga0207709_10000082 Ga0207709_1000008257 328
366 3300050507 nmdc:mga05p37_171351_c1 nmdc:mga05p37_171351_c1_1417_2433 328
367 3300031665 Ga0316575_10002415 Ga0316575_100024154 329
368 3300031727 Ga0316576_10036274 Ga0316576_100362741 329
369 3300031728 Ga0316578_10052553 Ga0316578_100525531 329
370 3300032005 Ga0307411_10078704 Ga0307411_100787042 329
371 3300032133 Ga0316583_10063119 Ga0316583_100631191 329
372 3300035398 Ga0316574_0003944 Ga0316574_0003944_1256_2281 329
373 3300036712 Ga0316584_0065904 Ga0316584_0065904_796_1821 329
374 3300005518 Ga0070699_100002650 Ga0070699_10000265013 331
375 3300005439 Ga0070711_100001613 Ga0070711_10000161310 332
376 3300025916 Ga0207663_10000403 Ga0207663_100004039 332
377 3300044901 Ga0466960_0000033 Ga0466960_0000033_24813_25817 332
378 3300046463 Ga0495653_0005657 Ga0495653_0005657_163_1161 332
379 3300046514 Ga0495618_0000512 Ga0495618_0000512_7739_8737 332
380 3300049571 Ga0501034_0021166 Ga0501034_0021166_4832_5836 332
381 3300050507 nmdc:mga05p37_257403_c1 nmdc:mga05p37_257403_c1_531_1592 332
382 3300053077 Ga0495601_0001652 Ga0495601_0001652_10314_11324 332
383 3300053078 Ga0495612_0000673 Ga0495612_0000673_4680_5690 332
384 3300025942 Ga0207689_10006436 Ga0207689_100064366 333
385 3300006163 Ga0070715_10000023 Ga0070715_1000002344 334
386 3300025905 Ga0207685_10000002 Ga0207685_1000000260 334
387 3300028800 Ga0265338_10068514 Ga0265338_100685142 334
388 3300005336 Ga0070680_100076564 Ga0070680_1000765642 335
389 3300005440 Ga0070705_100050886 Ga0070705_1000508863 335
390 3300005518 Ga0070699_100000701 Ga0070699_10000070121 335
391 3300005545 Ga0070695_100079061 Ga0070695_1000790612 335
392 3300005546 Ga0070696_100004465 Ga0070696_1000044658 335
393 3300009094 Ga0111539_10448275 Ga0111539_104482752 335
394 3300009147 Ga0114129_10509987 Ga0114129_105099872 335
395 3300025939 Ga0207665_10051457 Ga0207665_100514572 335
396 3300035118 Ga0373954_0004504 Ga0373954_0004504_1287_2294 335
397 3300035119 Ga0373956_0012733 Ga0373956_0012733_76_1083 335
398 3300035695 Ga0373927_0263543 Ga0373927_0263543_17_1024 335
399 3300036401 Ga0373937_0002585 Ga0373937_0002585_12697_13704 335
400 3300050511 nmdc:mga08y16_329880_c1 nmdc:mga08y16_329880_c1_130_1143 335
401 3300050512 nmdc:mga0n895_256769_c1 nmdc:mga0n895_256769_c1_470_1507 335
402 3300050515 nmdc:mga0a205_113883_c1 nmdc:mga0a205_113883_c1_676_1713 335
403 3300053085 Ga0495619_0069762 Ga0495619_0069762_1223_2230 335
404 3300005328 Ga0070676_10108670 Ga0070676_101086702 336
405 3300005536 Ga0070697_100130301 Ga0070697_1001303012 336
406 3300007076 Ga0075435_100218404 Ga0075435_1002184042 336
407 3300007265 Ga0099794_10018137 Ga0099794_100181373 336
408 3300009094 Ga0111539_10024253 Ga0111539_100242532 336
409 3300025907 Ga0207645_10095993 Ga0207645_100959931 336
410 3300025923 Ga0207681_10225163 Ga0207681_102251631 336
411 3300025933 Ga0207706_10207539 Ga0207706_102075392 336
412 3300025933 Ga0207706_10228975 Ga0207706_102289752 336
413 3300025940 Ga0207691_10115378 Ga0207691_101153782 336
414 3300026118 Ga0207675_100326816 Ga0207675_1003268162 336
415 3300027671 Ga0209588_1037184 Ga0209588_10371842 336
416 3300035725 Ga0373947_0049295 Ga0373947_0049295_78_1088 336
417 3300037068 Ga0373925_0207331 Ga0373925_0207331_220_1230 336
418 3300050511 nmdc:mga08y16_58929_c1 nmdc:mga08y16_58929_c1_1461_2474 336
419 3300050511 nmdc:mga08y16_88974_c1 nmdc:mga08y16_88974_c1_921_1934 336
420 3300050513 nmdc:mga0rr50_194490_c1 nmdc:mga0rr50_194490_c1_154_1167 336
421 3300005436 Ga0070713_100004983 Ga0070713_1000049837 337
422 3300005614 Ga0068856_100123819 Ga0068856_1001238192 337
423 3300006028 Ga0070717_10021528 Ga0070717_100215284 337
424 3300006028 Ga0070717_10065030 Ga0070717_100650303 337
425 3300006051 Ga0075364_10080680 Ga0075364_100806802 337
426 3300006237 Ga0097621_100000627 Ga0097621_1000006277 337
427 3300009093 Ga0105240_10197488 Ga0105240_101974881 337
428 3300009093 Ga0105240_10219951 Ga0105240_102199512 337
429 3300013307 Ga0157372_10165574 Ga0157372_101655742 337
430 3300014969 Ga0157376_10083927 Ga0157376_100839273 337
431 3300020070 Ga0206356_10120415 Ga0206356_101204151 337
432 3300025928 Ga0207700_10062515 Ga0207700_100625152 337
433 3300025949 Ga0207667_10033136 Ga0207667_100331362 337
434 3300031691 Ga0316579_10014160 Ga0316579_100141603 337
435 3300031733 Ga0316577_10000156 Ga0316577_100001564 337
436 3300032139 Ga0316580_10012217 Ga0316580_100122173 337
437 3300034816 Ga0373930_0000244 Ga0373930_0000244_2618_3637 337
438 3300034819 Ga0373958_0009078 Ga0373958_0009078_441_1460 337
439 3300035091 Ga0373951_0000775 Ga0373951_0000775_4995_6014 337
440 3300036647 Ga0316582_0006844 Ga0316582_0006844_584_1597 337
441 3300036712 Ga0316584_0001379 Ga0316584_0001379_4911_5924 337
442 3300037588 Ga0316581_0043047 Ga0316581_0043047_164_1177 337
443 3300042876 Ga0451577_0005551 Ga0451577_0005551_8150_9169 337
444 3300049571 Ga0501034_0039374 Ga0501034_0039374_946_1959 337
445 3300049588 Ga0501072_0016271 Ga0501072_0016271_4236_5249 337
446 3300050507 nmdc:mga05p37_89322_c1 nmdc:mga05p37_89322_c1_2641_3654 337
447 3300001432 JGI24034J14986_100123 JGI24034J14986_1001235 338
448 3300002074 JGI24748J21848_1000035 JGI24748J21848_100003536 338
449 3300002239 JGI24034J26672_10000039 JGI24034J26672_1000003936 338
450 3300005290 Ga0065712_10016444 Ga0065712_100164442 338
451 3300005295 Ga0065707_10167853 Ga0065707_101678532 338
452 3300005330 Ga0070690_100088022 Ga0070690_1000880222 338
453 3300005331 Ga0070670_100022802 Ga0070670_1000228025 338
454 3300005331 Ga0070670_100079114 Ga0070670_1000791141 338
455 3300005331 Ga0070670_100319054 Ga0070670_1003190542 338
456 3300005364 Ga0070673_100109953 Ga0070673_1001099533 338
457 3300005406 Ga0070703_10000179 Ga0070703_100001793 338
458 3300005406 Ga0070703_10011176 Ga0070703_100111763 338
459 3300005439 Ga0070711_100113992 Ga0070711_1001139922 338
460 3300005440 Ga0070705_100092769 Ga0070705_1000927692 338
461 3300005441 Ga0070700_100000645 Ga0070700_10000064511 338
462 3300005445 Ga0070708_100234531 Ga0070708_1002345311 338
463 3300005445 Ga0070708_100409759 Ga0070708_1004097591 338
464 3300005459 Ga0068867_100171589 Ga0068867_1001715891 338
465 3300005467 Ga0070706_100061376 Ga0070706_1000613762 338
466 3300005467 Ga0070706_100062204 Ga0070706_1000622043 338
467 3300005467 Ga0070706_100073573 Ga0070706_1000735734 338
468 3300005468 Ga0070707_100000108 Ga0070707_10000010826 338
469 3300005468 Ga0070707_100053514 Ga0070707_1000535142 338
470 3300005468 Ga0070707_100127268 Ga0070707_1001272683 338
471 3300005468 Ga0070707_100166555 Ga0070707_1001665552 338
472 3300005471 Ga0070698_100000179 Ga0070698_1000001798 338
473 3300005471 Ga0070698_100123779 Ga0070698_1001237793 338
474 3300005471 Ga0070698_100234608 Ga0070698_1002346082 338
475 3300005518 Ga0070699_100064415 Ga0070699_1000644153 338
476 3300005518 Ga0070699_100149408 Ga0070699_1001494081 338
477 3300005535 Ga0070684_100000994 Ga0070684_10000099418 338
478 3300005536 Ga0070697_100005855 Ga0070697_1000058557 338
479 3300005536 Ga0070697_100009508 Ga0070697_1000095086 338
480 3300005536 Ga0070697_100049853 Ga0070697_1000498531 338
481 3300005536 Ga0070697_100053847 Ga0070697_1000538472 338
482 3300005544 Ga0070686_100001728 Ga0070686_10000172811 338
483 3300005544 Ga0070686_100006775 Ga0070686_1000067756 338
484 3300005546 Ga0070696_100008307 Ga0070696_1000083074 338
485 3300005549 Ga0070704_100032316 Ga0070704_1000323164 338
486 3300005549 Ga0070704_100247730 Ga0070704_1002477302 338
487 3300005549 Ga0070704_100277939 Ga0070704_1002779392 338
488 3300005564 Ga0070664_100001242 Ga0070664_1000012427 338
489 3300005577 Ga0068857_100088454 Ga0068857_1000884542 338
490 3300005578 Ga0068854_100104616 Ga0068854_1001046163 338
491 3300005578 Ga0068854_100129411 Ga0068854_1001294112 338
492 3300005617 Ga0068859_100309459 Ga0068859_1003094593 338
493 3300005718 Ga0068866_10008102 Ga0068866_100081025 338
494 3300005719 Ga0068861_100027459 Ga0068861_1000274593 338
495 3300005842 Ga0068858_100000053 Ga0068858_10000005386 338
496 3300005842 Ga0068858_100018636 Ga0068858_1000186362 338
497 3300005842 Ga0068858_100114093 Ga0068858_1001140932 338
498 3300005843 Ga0068860_100270015 Ga0068860_1002700152 338
499 3300005844 Ga0068862_100003050 Ga0068862_1000030503 338
500 3300005981 Ga0081538_10109519 Ga0081538_101095191 338
501 3300006173 Ga0070716_100000003 Ga0070716_100000003214 338
502 3300006237 Ga0097621_100219544 Ga0097621_1002195442 338
503 3300006844 Ga0075428_100416467 Ga0075428_1004164671 338
504 3300006846 Ga0075430_100147128 Ga0075430_1001471282 338
505 3300006852 Ga0075433_10048060 Ga0075433_100480602 338
506 3300006871 Ga0075434_100123851 Ga0075434_1001238512 338
507 3300006880 Ga0075429_100352036 Ga0075429_1003520362 338
508 3300006914 Ga0075436_100000002 Ga0075436_100000002207 338
509 3300006914 Ga0075436_100023507 Ga0075436_1000235073 338
510 3300006931 Ga0097620_100002186 Ga0097620_1000021869 338
511 3300006931 Ga0097620_100309429 Ga0097620_1003094293 338
512 3300007076 Ga0075435_100000776 Ga0075435_10000077615 338
513 3300007265 Ga0099794_10143517 Ga0099794_101435171 338
514 3300009093 Ga0105240_10204113 Ga0105240_102041132 338
515 3300009094 Ga0111539_10001564 Ga0111539_100015647 338
516 3300009094 Ga0111539_10443895 Ga0111539_104438952 338
517 3300009101 Ga0105247_10000052 Ga0105247_1000005233 338
518 3300009147 Ga0114129_10017723 Ga0114129_100177236 338
519 3300009147 Ga0114129_10045764 Ga0114129_100457642 338
520 3300009148 Ga0105243_10000214 Ga0105243_1000021431 338
521 3300009148 Ga0105243_10254408 Ga0105243_102544083 338
522 3300009174 Ga0105241_10113329 Ga0105241_101133292 338
523 3300009176 Ga0105242_10000811 Ga0105242_100008119 338
524 3300009176 Ga0105242_10304341 Ga0105242_103043412 338
525 3300009177 Ga0105248_10034775 Ga0105248_100347753 338
526 3300009177 Ga0105248_10226585 Ga0105248_102265851 338
527 3300009551 Ga0105238_10000043 Ga0105238_10000043117 338
528 3300009553 Ga0105249_10097360 Ga0105249_100973602 338
529 3300009553 Ga0105249_10196750 Ga0105249_101967502 338
530 3300010375 Ga0105239_10016176 Ga0105239_100161767 338
531 3300013297 Ga0157378_10000026 Ga0157378_100000269 338
532 3300013297 Ga0157378_10005697 Ga0157378_100056976 338
533 3300013297 Ga0157378_10008203 Ga0157378_1000820310 338
534 3300013297 Ga0157378_10025930 Ga0157378_100259306 338
535 3300013297 Ga0157378_10047230 Ga0157378_100472302 338
536 3300013306 Ga0163162_10017085 Ga0163162_100170856 338
537 3300013308 Ga0157375_10005428 Ga0157375_100054289 338
538 3300014326 Ga0157380_10194069 Ga0157380_101940692 338
539 3300017792 Ga0163161_10215579 Ga0163161_102155791 338
540 3300025223 Ga0207672_1000462 Ga0207672_10004626 338
541 3300025885 Ga0207653_10000011 Ga0207653_10000011111 338
542 3300025899 Ga0207642_10005460 Ga0207642_100054602 338
543 3300025900 Ga0207710_10000004 Ga0207710_10000004474 338
544 3300025910 Ga0207684_10002580 Ga0207684_100025806 338
545 3300025910 Ga0207684_10159495 Ga0207684_101594953 338
546 3300025918 Ga0207662_10052666 Ga0207662_100526663 338
547 3300025922 Ga0207646_10005163 Ga0207646_1000516310 338
548 3300025922 Ga0207646_10415780 Ga0207646_104157801 338
549 3300025924 Ga0207694_10000065 Ga0207694_1000006540 338
550 3300025926 Ga0207659_10196387 Ga0207659_101963872 338
551 3300025931 Ga0207644_10000267 Ga0207644_1000026725 338
552 3300025931 Ga0207644_10058736 Ga0207644_100587362 338
553 3300025934 Ga0207686_10003568 Ga0207686_100035682 338
554 3300025934 Ga0207686_10008626 Ga0207686_100086261 338
555 3300025935 Ga0207709_10000590 Ga0207709_1000059013 338
556 3300025939 Ga0207665_10000009 Ga0207665_1000000995 338
557 3300025941 Ga0207711_10012912 Ga0207711_100129123 338
558 3300025942 Ga0207689_10239174 Ga0207689_102391742 338
559 3300025981 Ga0207640_10100394 Ga0207640_101003942 338
560 3300026023 Ga0207677_10341884 Ga0207677_103418842 338
561 3300026035 Ga0207703_10000093 Ga0207703_1000009317 338
562 3300026075 Ga0207708_10001454 Ga0207708_100014548 338
563 3300026075 Ga0207708_10137887 Ga0207708_101378871 338
564 3300026118 Ga0207675_100002639 Ga0207675_10000263911 338
565 3300026118 Ga0207675_100029698 Ga0207675_1000296984 338
566 3300026118 Ga0207675_100189401 Ga0207675_1001894012 338
567 3300027671 Ga0209588_1007099 Ga0209588_10070992 338
568 3300027907 Ga0207428_10006746 Ga0207428_100067468 338
569 3300028379 Ga0268266_10225895 Ga0268266_102258952 338
570 3300028380 Ga0268265_10136485 Ga0268265_101364852 338
571 3300028381 Ga0268264_10257973 Ga0268264_102579732 338
572 3300028381 Ga0268264_10331668 Ga0268264_103316681 338
573 3300031665 Ga0316575_10027206 Ga0316575_100272061 338
574 3300031727 Ga0316576_10352325 Ga0316576_103523251 338
575 3300031728 Ga0316578_10123670 Ga0316578_101236701 338
576 3300031852 Ga0307410_10012276 Ga0307410_100122764 338
577 3300031901 Ga0307406_10240036 Ga0307406_102400362 338
578 3300032002 Ga0307416_100044253 Ga0307416_1000442533 338
579 3300032004 Ga0307414_10290194 Ga0307414_102901941 338
580 3300032005 Ga0307411_10223684 Ga0307411_102236841 338
581 3300034818 Ga0373950_0001349 Ga0373950_0001349_699_1721 338
582 3300034957 Ga0373938_0000568 Ga0373938_0000568_4162_5184 338
583 3300035085 Ga0373929_0002332 Ga0373929_0002332_479_1501 338
584 3300035088 Ga0373940_0000663 Ga0373940_0000663_2044_3066 338
585 3300035089 Ga0373944_0059936 Ga0373944_0059936_79_1095 338
586 3300035090 Ga0373949_0001449 Ga0373949_0001449_3542_4564 338
587 3300035092 Ga0373952_0000131 Ga0373952_0000131_8440_9462 338
588 3300035111 Ga0373923_0023827 Ga0373923_0023827_726_1742 338
589 3300035112 Ga0373932_0001952 Ga0373932_0001952_885_1907 338
590 3300035115 Ga0373941_0000019 Ga0373941_0000019_2059_3081 338
591 3300035117 Ga0373953_0059554 Ga0373953_0059554_333_1349 338
592 3300035118 Ga0373954_0033192 Ga0373954_0033192_1237_2253 338
593 3300035121 Ga0373960_0000344 Ga0373960_0000344_6704_7726 338
594 3300035207 Ga0373942_0000503 Ga0373942_0000503_3518_4540 338
595 3300035241 Ga0373961_0001690 Ga0373961_0001690_3484_4506 338
596 3300035242 Ga0373962_0000153 Ga0373962_0000153_9899_10921 338
597 3300035410 Ga0373924_0005801 Ga0373924_0005801_2559_3584 338
598 3300035691 Ga0373931_0004901 Ga0373931_0004901_606_1628 338
599 3300035692 Ga0373935_0025095 Ga0373935_0025095_427_1452 338
600 3300035725 Ga0373947_0004307 Ga0373947_0004307_2570_3595 338
601 3300036401 Ga0373937_0287666 Ga0373937_0287666_52_1068 338
602 3300036401 Ga0373937_0346308 Ga0373937_0346308_199_1215 338
603 3300039438 Ga0436360_0084461 Ga0436360_0084461_168_1193 338
604 3300042435 Ga0439434_0048884 Ga0439434_0048884_203_1219 338
605 3300044712 Ga0453684_0119478 Ga0453684_0119478_1107_2123 338
606 3300045051 Ga0451576_0040232 Ga0451576_0040232_2554_3570 338
607 3300045051 Ga0451576_0373219 Ga0451576_0373219_167_1183 338
608 3300046454 Ga0495592_0032013 Ga0495592_0032013_2700_3716 338
609 3300046455 Ga0495603_0130769 Ga0495603_0130769_398_1414 338
610 3300046459 Ga0495629_0179867 Ga0495629_0179867_340_1356 338
611 3300046511 Ga0495608_0075495 Ga0495608_0075495_629_1645 338
612 3300046517 Ga0495630_0002760 Ga0495630_0002760_7771_8787 338
613 3300046522 Ga0495643_0001409 Ga0495643_0001409_19106_20122 338
614 3300046539 Ga0495621_0045659 Ga0495621_0045659_77_1093 338
615 3300046559 Ga0495667_0032855 Ga0495667_0032855_1573_2589 338
616 3300046681 Ga0495647_0009083 Ga0495647_0009083_1067_2089 338
617 3300046683 Ga0495658_0047548 Ga0495658_0047548_1273_2289 338
618 3300046684 Ga0495669_0004600 Ga0495669_0004600_2716_3732 338
619 3300046684 Ga0495669_0050117 Ga0495669_0050117_652_1668 338
620 3300046689 Ga0495613_0000392 Ga0495613_0000392_26709_27725 338
621 3300046809 Ga0495600_0028202 Ga0495600_0028202_2290_3306 338
622 3300047319 Ga0495674_0063360 Ga0495674_0063360_629_1645 338
623 3300047471 Ga0495684_0000410 Ga0495684_0000410_17345_18361 338
624 3300048090 Ga0495615_0019285 Ga0495615_0019285_266_1282 338
625 3300048905 Ga0496102_0052493 Ga0496102_0052493_691_1713 338
626 3300048905 Ga0496102_0059347 Ga0496102_0059347_488_1504 338
627 3300048905 Ga0496102_0110291 Ga0496102_0110291_407_1423 338
628 3300048907 Ga0496104_0004198 Ga0496104_0004198_5762_6778 338
629 3300048909 Ga0496106_0018159 Ga0496106_0018159_685_1701 338
630 3300048909 Ga0496106_0023345 Ga0496106_0023345_155_1207 338
631 3300048912 Ga0496109_0110290 Ga0496109_0110290_1487_2503 338
632 3300048913 Ga0496110_0009220 Ga0496110_0009220_694_1710 338
633 3300048913 Ga0496110_0114563 Ga0496110_0114563_224_1240 338
634 3300048915 Ga0496112_0030559 Ga0496112_0030559_656_1672 338
635 3300049514 Ga0501291_003832 Ga0501291_003832_756_1772 338
636 3300049519 Ga0501296_007593 Ga0501296_007593_15_1031 338
637 3300049568 Ga0501031_0141420 Ga0501031_0141420_68_1099 338
638 3300049572 Ga0501036_0120761 Ga0501036_0120761_896_1912 338
639 3300049574 Ga0501038_0168642 Ga0501038_0168642_257_1273 338
640 3300049575 Ga0501039_0114135 Ga0501039_0114135_556_1572 338
641 3300049575 Ga0501039_0164363 Ga0501039_0164363_308_1324 338
642 3300049576 Ga0501040_0034852 Ga0501040_0034852_1687_2703 338
643 3300049576 Ga0501040_0053093 Ga0501040_0053093_190_1206 338
644 3300049576 Ga0501040_0087021 Ga0501040_0087021_184_1200 338
645 3300049577 Ga0501041_0033405 Ga0501041_0033405_1569_2600 338
646 3300049577 Ga0501041_0071403 Ga0501041_0071403_243_1259 338
647 3300049578 Ga0501042_0282717 Ga0501042_0282717_147_1178 338
648 3300049587 Ga0501071_0028941 Ga0501071_0028941_2751_3767 338
649 3300049587 Ga0501071_0052509 Ga0501071_0052509_1682_2698 338
650 3300049587 Ga0501071_0161435 Ga0501071_0161435_444_1460 338
651 3300049588 Ga0501072_0051165 Ga0501072_0051165_1127_2143 338
652 3300049590 Ga0501074_0147928 Ga0501074_0147928_317_1333 338
653 3300049591 Ga0501075_0017282 Ga0501075_0017282_909_1925 338
654 3300049591 Ga0501075_0034517 Ga0501075_0034517_28_1044 338
655 3300049591 Ga0501075_0042478 Ga0501075_0042478_1162_2193 338
656 3300049591 Ga0501075_0072097 Ga0501075_0072097_739_1755 338
657 3300049592 Ga0501076_0014709 Ga0501076_0014709_4730_5746 338
658 3300049592 Ga0501076_0018815 Ga0501076_0018815_3958_4974 338
659 3300049592 Ga0501076_0039280 Ga0501076_0039280_1212_2228 338
660 3300049593 Ga0501077_0052780 Ga0501077_0052780_67_1083 338
661 3300049666 Ga0501228_001032 Ga0501228_001032_444_1460 338
662 3300049705 Ga0501225_0038236 Ga0501225_0038236_249_1265 338
663 3300049708 Ga0501245_009500 Ga0501245_009500_259_1275 338
664 3300049741 Ga0501079_0161132 Ga0501079_0161132_51_1067 338
665 3300049742 Ga0501080_0032031 Ga0501080_0032031_1421_2437 338
666 3300049742 Ga0501080_0491768 Ga0501080_0491768_56_1072 338
667 3300049743 Ga0501081_0122108 Ga0501081_0122108_148_1164 338
668 3300049743 Ga0501081_0179712 Ga0501081_0179712_428_1444 338
669 3300049743 Ga0501081_0321440 Ga0501081_0321440_89_1105 338
670 3300049824 Ga0501045_0011704 Ga0501045_0011704_225_1241 338
671 3300049824 Ga0501045_0025027 Ga0501045_0025027_2528_3544 338
672 3300049824 Ga0501045_0144509 Ga0501045_0144509_156_1187 338
673 3300049851 Ga0501212_001937 Ga0501212_001937_533_1549 338
674 3300050507 nmdc:mga05p37_18589_c1 nmdc:mga05p37_18589_c1_7172_8188 338
675 3300050507 nmdc:mga05p37_36688_c1 nmdc:mga05p37_36688_c1_516_1532 338
676 3300050508 nmdc:mga09592_51940_c2 nmdc:mga09592_51940_c2_1165_2181 338
677 3300050509 nmdc:mga0qj67_139625_c1 nmdc:mga0qj67_139625_c1_724_1740 338
678 3300050510 nmdc:mga06r32_234606_c1 nmdc:mga06r32_234606_c1_425_1441 338
679 3300050511 nmdc:mga08y16_513988_c1 nmdc:mga08y16_513988_c1_19_1035 338
680 3300050512 nmdc:mga0n895_2022_c1 nmdc:mga0n895_2022_c1_3954_4970 338
681 3300050512 nmdc:mga0n895_303186_c1 nmdc:mga0n895_303186_c1_313_1329 338
682 3300050512 nmdc:mga0n895_392444_c1 nmdc:mga0n895_392444_c1_187_1209 338
683 3300050512 nmdc:mga0n895_472454_c1 nmdc:mga0n895_472454_c1_140_1162 338
684 3300050512 nmdc:mga0n895_90460_c1 nmdc:mga0n895_90460_c1_1483_2499 338
685 3300050513 nmdc:mga0rr50_162124_c1 nmdc:mga0rr50_162124_c1_216_1238 338
686 3300050513 nmdc:mga0rr50_783_c1 nmdc:mga0rr50_783_c1_1924_3024 338
687 3300050513 nmdc:mga0rr50_9454_c1 nmdc:mga0rr50_9454_c1_2300_3322 338
688 3300050514 nmdc:mga08x19_127533_c1 nmdc:mga08x19_127533_c1_429_1445 338
689 3300050514 nmdc:mga08x19_61987_c1 nmdc:mga08x19_61987_c1_1355_2371 338
690 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_175759_176859 338
691 3300050515 nmdc:mga0a205_52960_c1 nmdc:mga0a205_52960_c1_1862_2878 338
692 3300053077 Ga0495601_0006540 Ga0495601_0006540_2524_3540 338
693 3300053085 Ga0495619_0082013 Ga0495619_0082013_106_1122 338
694 3300053129 Ga0500628_000685 Ga0500628_000685_2511_3527 338
695 3300054114 Ga0501084_0019389 Ga0501084_0019389_3998_5014 338
696 3300054114 Ga0501084_0097686 Ga0501084_0097686_949_1980 338
697 3300054114 Ga0501084_0221279 Ga0501084_0221279_558_1574 338
698 3300060353 Ga0501082_0328214 Ga0501082_0328214_242_1258 338
699 3300060353 Ga0501082_0338538 Ga0501082_0338538_169_1185 338
700 3300061734 Ga0530510_0006387 Ga0530510_0006387_974_1990 338
701 3300061734 Ga0530510_0032255 Ga0530510_0032255_625_1641 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

45

129

0.89

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

170

315

0.8

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

201

354

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k9y-assembly2.cif.gz_C crystal structure of human vat-1 0.9642 2 338
6lhr-assembly2.cif.gz_C crystal structure of the complex between vesicle amine transport-1 and nadp 0.9614 2 338
6lhr-assembly2.cif.gz_C crystal structure of the complex between vesicle amine transport-1 and nadp 0.9559 2 338
6k9y-assembly2.cif.gz_C crystal structure of human vat-1 0.9555 2 338
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.9549 1 338
ID Description Score Start End Superfamily
af_O07721_1_120_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9727 1 118 3.90.180.10
af_Q80TB8_38_380_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9615 1 337 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9597 1 115 3.90.180.10
af_Q8JFV8_192_377_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 121 306 3.40.50.720
af_Q80TB8_38_380_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9559 1 337 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A7L3Q574-F1-model_v4 VAT1 protein 0.9763 2 237 GO:0005741
GO:0008270
GO:0010637
GO:0016491
AF-A0A2E5U0V2-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9735 1 337 GO:0016491
AF-A0A672UK94-F1-model_v4 Vesicle amine transport 1 0.9722 2 338 GO:0005741
GO:0008270
GO:0010637
GO:0016491
AF-A0A3Q1EEF1-F1-model_v4 Synaptic vesicle membrane protein VAT-1 homolog 0.972 2 337 GO:0005741
GO:0008270
GO:0010637
GO:0016491
AF-A0A7L2RY32-F1-model_v4 VAT1 protein 0.9681 81 317 GO:0005741
GO:0008270
GO:0010637
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map