F476143
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 345 | 698 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100004983|Ga0070713_1000049837 |
| Length | 358 |
| Sequence | VVSAAVCRYPSSPIVILAVMRQVVITRHGPPEVLQAGEAPDPVPRAGEVRIAVRAAGVNFADIMARLGLYPDAPPLPAVVGYEVAGVVDAVSSSDVPFRPGDRVFAFTRFGGYASLAVAPATFVFRTPQELSDVEAAAIPVNYLTAFVALETLAHVSAGETVLVHGAGGGVGIAATQLAKQRGATVIGTASAMKLDAIRSLGVDHPVDHQRDVPGEIRRLTKGRGVDVVLDPIGGRSARISYELLAPLGRLVLYGASTLASGERRNLWRVVRTLIEMPAFRPLSLMNRNRGVFGLNLGHLWSETGRLRSAVETLLSGFVAGQLRPVIAKTFPLDKAADAHRYIQSRANIGKVILTIDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 2 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 3 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 4 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 162 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 165 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 176 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 177 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 224 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 312 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 340 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 342 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 343 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.43 |
| Isolates | 0.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3 |
| Nodule | 0 |
| Rhizoplane | 3.71 |
| Rhizosphere | 93.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J14986_100123 | 3300001432 | Unclassified | 3555 |
| 2 | JGI24748J21848_1000035 | 3300002074 | Bacteria | 73922 |
| 3 | JGI24744J21845_10019466 | 3300002077 | Bacteria | 1342 |
| 4 | JGI24034J26672_10000039 | 3300002239 | Bacteria | 73907 |
| 5 | Ga0065712_10016444 | 3300005290 | Bacteria | 1702 |
| 6 | Ga0065715_10021386 | 3300005293 | Archaea | 2154 |
| 7 | Ga0065715_10107788 | 3300005293 | Bacteria | 2753 |
| 8 | Ga0065707_10167853 | 3300005295 | Bacteria | 1508 |
| 9 | Ga0070658_10070236 | 3300005327 | Bacteria | 2867 |
| 10 | Ga0070658_10083661 | 3300005327 | Bacteria | 2623 |
| 11 | Ga0070658_10346652 | 3300005327 | Bacteria | 1271 |
| 12 | Ga0070676_10108670 | 3300005328 | Bacteria | 1724 |
| 13 | Ga0070683_100009004 | 3300005329 | Bacteria | 8514 |
| 14 | Ga0070683_100126998 | 3300005329 | Bacteria | 2411 |
| 15 | Ga0070690_100088022 | 3300005330 | Bacteria | 2041 |
| 16 | Ga0070670_100012891 | 3300005331 | Bacteria | 7157 |
| 17 | Ga0070670_100022802 | 3300005331 | Bacteria | 5387 |
| 18 | Ga0070670_100079114 | 3300005331 | Bacteria | 2825 |
| 19 | Ga0070670_100319054 | 3300005331 | Bacteria | 1361 |
| 20 | Ga0070670_100371536 | 3300005331 | Bacteria | 1259 |
| 21 | Ga0070666_10018735 | 3300005335 | Bacteria | 4457 |
| 22 | Ga0070680_100021880 | 3300005336 | Bacteria | 5086 |
| 23 | Ga0070680_100076564 | 3300005336 | Bacteria | 2754 |
| 24 | Ga0068868_100157930 | 3300005338 | Bacteria | 1871 |
| 25 | Ga0070660_100069564 | 3300005339 | Bacteria | 2745 |
| 26 | Ga0070687_100092226 | 3300005343 | Bacteria | 1678 |
| 27 | Ga0070661_100130632 | 3300005344 | Bacteria | 1886 |
| 28 | Ga0070669_100000692 | 3300005353 | Bacteria | 24734 |
| 29 | Ga0070673_100009749 | 3300005364 | Bacteria | 6465 |
| 30 | Ga0070673_100109953 | 3300005364 | Bacteria | 2284 |
| 31 | Ga0070673_100450857 | 3300005364 | Bacteria | 1157 |
| 32 | Ga0070688_100246475 | 3300005365 | Unclassified | 1270 |
| 33 | Ga0070659_100100460 | 3300005366 | Bacteria | 2328 |
| 34 | Ga0070659_100188630 | 3300005366 | Bacteria | 1694 |
| 35 | Ga0070703_10000179 | 3300005406 | Bacteria | 30956 |
| 36 | Ga0070703_10011176 | 3300005406 | Bacteria | 2535 |
| 37 | Ga0070714_100066741 | 3300005435 | Bacteria | 3101 |
| 38 | Ga0070713_100004983 | 3300005436 | Bacteria | 9017 |
| 39 | Ga0070711_100001613 | 3300005439 | Bacteria | 12447 |
| 40 | Ga0070711_100113992 | 3300005439 | Bacteria | 1988 |
| 41 | Ga0070705_100050886 | 3300005440 | Bacteria | 2412 |
| 42 | Ga0070705_100092769 | 3300005440 | Unclassified | 1886 |
| 43 | Ga0070705_100113329 | 3300005440 | Bacteria | 1737 |
| 44 | Ga0070700_100000645 | 3300005441 | Bacteria | 17252 |
| 45 | Ga0070694_100024140 | 3300005444 | Unclassified | 3922 |
| 46 | Ga0070708_100174480 | 3300005445 | Bacteria | 2008 |
| 47 | Ga0070708_100234531 | 3300005445 | Unclassified | 1722 |
| 48 | Ga0070708_100409759 | 3300005445 | Unclassified | 1278 |
| 49 | Ga0070663_100073764 | 3300005455 | Bacteria | 2490 |
| 50 | Ga0070678_100036127 | 3300005456 | Bacteria | 3456 |
| 51 | Ga0070678_100062395 | 3300005456 | Bacteria | 2752 |
| 52 | Ga0070662_100120176 | 3300005457 | Bacteria | 2013 |
| 53 | Ga0070662_100229603 | 3300005457 | Bacteria | 1484 |
| 54 | Ga0068867_100171589 | 3300005459 | Bacteria | 1718 |
| 55 | Ga0070706_100061376 | 3300005467 | Bacteria | 3471 |
| 56 | Ga0070706_100062204 | 3300005467 | Bacteria | 3449 |
| 57 | Ga0070706_100073573 | 3300005467 | Bacteria | 3163 |
| 58 | Ga0070707_100000108 | 3300005468 | Bacteria | 76022 |
| 59 | Ga0070707_100031363 | 3300005468 | Bacteria | 5062 |
| 60 | Ga0070707_100053514 | 3300005468 | Bacteria | 3870 |
| 61 | Ga0070707_100127268 | 3300005468 | Bacteria | 2475 |
| 62 | Ga0070707_100166555 | 3300005468 | Bacteria | 2148 |
| 63 | Ga0070698_100000179 | 3300005471 | Bacteria | 59634 |
| 64 | Ga0070698_100059606 | 3300005471 | Bacteria | 3854 |
| 65 | Ga0070698_100123779 | 3300005471 | Bacteria | 2544 |
| 66 | Ga0070698_100234608 | 3300005471 | Bacteria | 1768 |
| 67 | Ga0070699_100000701 | 3300005518 | Bacteria | 31013 |
| 68 | Ga0070699_100002650 | 3300005518 | Bacteria | 15986 |
| 69 | Ga0070699_100035557 | 3300005518 | Bacteria | 4306 |
| 70 | Ga0070699_100064415 | 3300005518 | Bacteria | 3179 |
| 71 | Ga0070699_100149408 | 3300005518 | Bacteria | 2066 |
| 72 | Ga0070699_100192635 | 3300005518 | Bacteria | 1811 |
| 73 | Ga0070679_100205496 | 3300005530 | Bacteria | 1934 |
| 74 | Ga0070684_100000994 | 3300005535 | Bacteria | 20216 |
| 75 | Ga0070697_100005855 | 3300005536 | Bacteria | 9485 |
| 76 | Ga0070697_100009508 | 3300005536 | Bacteria | 7598 |
| 77 | Ga0070697_100025048 | 3300005536 | Bacteria | 4756 |
| 78 | Ga0070697_100049853 | 3300005536 | Bacteria | 3398 |
| 79 | Ga0070697_100053847 | 3300005536 | Bacteria | 3270 |
| 80 | Ga0070697_100130301 | 3300005536 | Bacteria | 2109 |
| 81 | Ga0070686_100001728 | 3300005544 | Bacteria | 12204 |
| 82 | Ga0070686_100006775 | 3300005544 | Bacteria | 6379 |
| 83 | Ga0070695_100079061 | 3300005545 | Bacteria | 2170 |
| 84 | Ga0070696_100004465 | 3300005546 | Bacteria | 9339 |
| 85 | Ga0070696_100008307 | 3300005546 | Bacteria | 6947 |
| 86 | Ga0070704_100007453 | 3300005549 | Bacteria | 6517 |
| 87 | Ga0070704_100032316 | 3300005549 | Bacteria | 3529 |
| 88 | Ga0070704_100247730 | 3300005549 | Bacteria | 1461 |
| 89 | Ga0070704_100277939 | 3300005549 | Unclassified | 1386 |
| 90 | Ga0070664_100001242 | 3300005564 | Bacteria | 20375 |
| 91 | Ga0068857_100028746 | 3300005577 | Bacteria | 4906 |
| 92 | Ga0068857_100088454 | 3300005577 | Bacteria | 2771 |
| 93 | Ga0068857_100271381 | 3300005577 | Bacteria | 1559 |
| 94 | Ga0068854_100039869 | 3300005578 | Bacteria | 3310 |
| 95 | Ga0068854_100104616 | 3300005578 | Bacteria | 2127 |
| 96 | Ga0068854_100129411 | 3300005578 | Bacteria | 1926 |
| 97 | Ga0068856_100123819 | 3300005614 | Bacteria | 2588 |
| 98 | Ga0068856_100140285 | 3300005614 | Bacteria | 2424 |
| 99 | Ga0068852_100052721 | 3300005616 | Bacteria | 3497 |
| 100 | Ga0068859_100309459 | 3300005617 | Unclassified | 1673 |
| 101 | Ga0068859_100413302 | 3300005617 | Bacteria | 1445 |
| 102 | Ga0068859_100490538 | 3300005617 | Bacteria | 1324 |
| 103 | Ga0068866_10008102 | 3300005718 | Bacteria | 4416 |
| 104 | Ga0068861_100019169 | 3300005719 | Bacteria | 4886 |
| 105 | Ga0068861_100027459 | 3300005719 | Bacteria | 4145 |
| 106 | Ga0068870_10020276 | 3300005840 | Bacteria | 3235 |
| 107 | Ga0068858_100000053 | 3300005842 | Bacteria | 119869 |
| 108 | Ga0068858_100018636 | 3300005842 | Bacteria | 6499 |
| 109 | Ga0068858_100114093 | 3300005842 | Bacteria | 2524 |
| 110 | Ga0068860_100270015 | 3300005843 | Bacteria | 1660 |
| 111 | Ga0068862_100003050 | 3300005844 | Bacteria | 14593 |
| 112 | Ga0081538_10109519 | 3300005981 | Unclassified | 1360 |
| 113 | Ga0070717_10021528 | 3300006028 | Bacteria | 5082 |
| 114 | Ga0070717_10065030 | 3300006028 | Bacteria | 3031 |
| 115 | Ga0075365_10057675 | 3300006038 | Bacteria | 2584 |
| 116 | Ga0075365_10087648 | 3300006038 | Bacteria | 2117 |
| 117 | Ga0075365_10136705 | 3300006038 | Bacteria | 1699 |
| 118 | Ga0075368_10026605 | 3300006042 | Bacteria | 2226 |
| 119 | Ga0075364_10051972 | 3300006051 | Bacteria | 2677 |
| 120 | Ga0075364_10080680 | 3300006051 | Bacteria | 2151 |
| 121 | Ga0075364_10162599 | 3300006051 | Bacteria | 1507 |
| 122 | Ga0075364_10186746 | 3300006051 | Bacteria | 1404 |
| 123 | Ga0070715_10000023 | 3300006163 | Bacteria | 117771 |
| 124 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 125 | Ga0070716_100170906 | 3300006173 | Bacteria | 1418 |
| 126 | Ga0075362_10028192 | 3300006177 | Bacteria | 2410 |
| 127 | Ga0075367_10024190 | 3300006178 | Bacteria | 3425 |
| 128 | Ga0075367_10048695 | 3300006178 | Bacteria | 2497 |
| 129 | Ga0097621_100000627 | 3300006237 | Bacteria | 24879 |
| 130 | Ga0097621_100219544 | 3300006237 | Unclassified | 1656 |
| 131 | Ga0075370_10003272 | 3300006353 | Bacteria | 7682 |
| 132 | Ga0068871_100002742 | 3300006358 | Bacteria | 12029 |
| 133 | Ga0075428_100004191 | 3300006844 | Bacteria | 15875 |
| 134 | Ga0075428_100030614 | 3300006844 | Bacteria | 5951 |
| 135 | Ga0075428_100032575 | 3300006844 | Bacteria | 5757 |
| 136 | Ga0075428_100061064 | 3300006844 | Bacteria | 4127 |
| 137 | Ga0075428_100326759 | 3300006844 | Bacteria | 1648 |
| 138 | Ga0075428_100349812 | 3300006844 | Bacteria | 1586 |
| 139 | Ga0075428_100416467 | 3300006844 | Bacteria | 1440 |
| 140 | Ga0075428_100456145 | 3300006844 | Bacteria | 1369 |
| 141 | Ga0075430_100004048 | 3300006846 | Bacteria | 12372 |
| 142 | Ga0075430_100014030 | 3300006846 | Bacteria | 6831 |
| 143 | Ga0075430_100120550 | 3300006846 | Bacteria | 2187 |
| 144 | Ga0075430_100147128 | 3300006846 | Bacteria | 1962 |
| 145 | Ga0075431_100002803 | 3300006847 | Bacteria | 16885 |
| 146 | Ga0075431_100276290 | 3300006847 | Bacteria | 1701 |
| 147 | Ga0075431_100442968 | 3300006847 | Unclassified | 1295 |
| 148 | Ga0075433_10048060 | 3300006852 | Bacteria | 3710 |
| 149 | Ga0075433_10075895 | 3300006852 | Bacteria | 2959 |
| 150 | Ga0075434_100005682 | 3300006871 | Bacteria | 11381 |
| 151 | Ga0075434_100123851 | 3300006871 | Bacteria | 2602 |
| 152 | Ga0075434_100133581 | 3300006871 | Bacteria | 2501 |
| 153 | Ga0075429_100001043 | 3300006880 | Bacteria | 22157 |
| 154 | Ga0075429_100003470 | 3300006880 | Bacteria | 13447 |
| 155 | Ga0075429_100352036 | 3300006880 | Unclassified | 1289 |
| 156 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 157 | Ga0075436_100023507 | 3300006914 | Bacteria | 4233 |
| 158 | Ga0097620_100002186 | 3300006931 | Bacteria | 19854 |
| 159 | Ga0097620_100309429 | 3300006931 | Unclassified | 1673 |
| 160 | Ga0097620_100413316 | 3300006931 | Bacteria | 1445 |
| 161 | Ga0097620_100490545 | 3300006931 | Bacteria | 1324 |
| 162 | Ga0075435_100000776 | 3300007076 | Bacteria | 19804 |
| 163 | Ga0075435_100011606 | 3300007076 | Bacteria | 6492 |
| 164 | Ga0075435_100218404 | 3300007076 | Bacteria | 1618 |
| 165 | Ga0099794_10018137 | 3300007265 | Bacteria | 3150 |
| 166 | Ga0099794_10143517 | 3300007265 | Unclassified | 1210 |
| 167 | Ga0105240_10197488 | 3300009093 | Bacteria | 2360 |
| 168 | Ga0105240_10204113 | 3300009093 | Bacteria | 2315 |
| 169 | Ga0105240_10219951 | 3300009093 | Bacteria | 2213 |
| 170 | Ga0111539_10000118 | 3300009094 | Bacteria | 88106 |
| 171 | Ga0111539_10000587 | 3300009094 | Bacteria | 46880 |
| 172 | Ga0111539_10001564 | 3300009094 | Bacteria | 30474 |
| 173 | Ga0111539_10024253 | 3300009094 | Bacteria | 7448 |
| 174 | Ga0111539_10370253 | 3300009094 | Bacteria | 1668 |
| 175 | Ga0111539_10425324 | 3300009094 | Bacteria | 1547 |
| 176 | Ga0111539_10443895 | 3300009094 | Unclassified | 1511 |
| 177 | Ga0111539_10448275 | 3300009094 | Unclassified | 1503 |
| 178 | Ga0105247_10000052 | 3300009101 | Bacteria | 141465 |
| 179 | Ga0114129_10000324 | 3300009147 | Bacteria | 56067 |
| 180 | Ga0114129_10004439 | 3300009147 | Bacteria | 19796 |
| 181 | Ga0114129_10012726 | 3300009147 | Bacteria | 11977 |
| 182 | Ga0114129_10017723 | 3300009147 | Bacteria | 10141 |
| 183 | Ga0114129_10027164 | 3300009147 | Bacteria | 8102 |
| 184 | Ga0114129_10045764 | 3300009147 | Bacteria | 6150 |
| 185 | Ga0114129_10063845 | 3300009147 | Bacteria | 5140 |
| 186 | Ga0114129_10118576 | 3300009147 | Unclassified | 3645 |
| 187 | Ga0114129_10144348 | 3300009147 | Bacteria | 3261 |
| 188 | Ga0114129_10154143 | 3300009147 | Bacteria | 3143 |
| 189 | Ga0114129_10378306 | 3300009147 | Bacteria | 1870 |
| 190 | Ga0114129_10509987 | 3300009147 | Unclassified | 1569 |
| 191 | Ga0105243_10000050 | 3300009148 | Bacteria | 142670 |
| 192 | Ga0105243_10000214 | 3300009148 | Bacteria | 67405 |
| 193 | Ga0105243_10254408 | 3300009148 | Unclassified | 1570 |
| 194 | Ga0105243_10341515 | 3300009148 | Bacteria | 1372 |
| 195 | Ga0105241_10113329 | 3300009174 | Bacteria | 2174 |
| 196 | Ga0105242_10000654 | 3300009176 | Bacteria | 27117 |
| 197 | Ga0105242_10000811 | 3300009176 | Bacteria | 24253 |
| 198 | Ga0105242_10304341 | 3300009176 | Bacteria | 1456 |
| 199 | Ga0105248_10034775 | 3300009177 | Bacteria | 5638 |
| 200 | Ga0105248_10040098 | 3300009177 | Bacteria | 5249 |
| 201 | Ga0105248_10226585 | 3300009177 | Bacteria | 2104 |
| 202 | Ga0105238_10000043 | 3300009551 | Bacteria | 154120 |
| 203 | Ga0105238_10071935 | 3300009551 | Bacteria | 3455 |
| 204 | Ga0105249_10001518 | 3300009553 | Bacteria | 20365 |
| 205 | Ga0105249_10097360 | 3300009553 | Bacteria | 2762 |
| 206 | Ga0105249_10196750 | 3300009553 | Unclassified | 1970 |
| 207 | Ga0105239_10016176 | 3300010375 | Bacteria | 8254 |
| 208 | Ga0105246_10343557 | 3300011119 | Bacteria | 1220 |
| 209 | Ga0157378_10000026 | 3300013297 | Bacteria | 128499 |
| 210 | Ga0157378_10005697 | 3300013297 | Bacteria | 10900 |
| 211 | Ga0157378_10008203 | 3300013297 | Bacteria | 9107 |
| 212 | Ga0157378_10025930 | 3300013297 | Bacteria | 5165 |
| 213 | Ga0157378_10047230 | 3300013297 | Bacteria | 3827 |
| 214 | Ga0163162_10017085 | 3300013306 | Bacteria | 7099 |
| 215 | Ga0157372_10165574 | 3300013307 | Bacteria | 2556 |
| 216 | Ga0157372_10196052 | 3300013307 | Bacteria | 2339 |
| 217 | Ga0157375_10005428 | 3300013308 | Bacteria | 11083 |
| 218 | Ga0157380_10194069 | 3300014326 | Unclassified | 1795 |
| 219 | Ga0157380_10205966 | 3300014326 | Bacteria | 1749 |
| 220 | Ga0157380_10230286 | 3300014326 | Bacteria | 1664 |
| 221 | Ga0157380_10378357 | 3300014326 | Bacteria | 1335 |
| 222 | Ga0157376_10083927 | 3300014969 | Unclassified | 2742 |
| 223 | Ga0157376_10091538 | 3300014969 | Bacteria | 2635 |
| 224 | Ga0163161_10215579 | 3300017792 | Bacteria | 1484 |
| 225 | Ga0206356_10120415 | 3300020070 | Bacteria | 1165 |
| 226 | Ga0206353_11316981 | 3300020082 | Bacteria | 2205 |
| 227 | Ga0206353_11357636 | 3300020082 | Bacteria | 1740 |
| 228 | Ga0207672_1000462 | 3300025223 | Bacteria | 5137 |
| 229 | Ga0207697_10000602 | 3300025315 | Bacteria | 20487 |
| 230 | Ga0207653_10000011 | 3300025885 | Bacteria | 160949 |
| 231 | Ga0207642_10005460 | 3300025899 | Bacteria | 4153 |
| 232 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 233 | Ga0207680_10018805 | 3300025903 | Bacteria | 3682 |
| 234 | Ga0207685_10000002 | 3300025905 | Bacteria | 438088 |
| 235 | Ga0207645_10095993 | 3300025907 | Bacteria | 1909 |
| 236 | Ga0207643_10131412 | 3300025908 | Bacteria | 1490 |
| 237 | Ga0207705_10282570 | 3300025909 | Bacteria | 1271 |
| 238 | Ga0207684_10002580 | 3300025910 | Bacteria | 18159 |
| 239 | Ga0207684_10159495 | 3300025910 | Bacteria | 1942 |
| 240 | Ga0207695_10143191 | 3300025913 | Bacteria | 2337 |
| 241 | Ga0207695_10316554 | 3300025913 | Bacteria | 1450 |
| 242 | Ga0207663_10000403 | 3300025916 | Bacteria | 18706 |
| 243 | Ga0207660_10126289 | 3300025917 | Bacteria | 1943 |
| 244 | Ga0207662_10052666 | 3300025918 | Unclassified | 2422 |
| 245 | Ga0207662_10183241 | 3300025918 | Bacteria | 1348 |
| 246 | Ga0207646_10000495 | 3300025922 | Bacteria | 52781 |
| 247 | Ga0207646_10005163 | 3300025922 | Bacteria | 13826 |
| 248 | Ga0207646_10020313 | 3300025922 | Bacteria | 6155 |
| 249 | Ga0207646_10415780 | 3300025922 | Bacteria | 1214 |
| 250 | Ga0207681_10038314 | 3300025923 | Bacteria | 3175 |
| 251 | Ga0207681_10225163 | 3300025923 | Bacteria | 1453 |
| 252 | Ga0207694_10000065 | 3300025924 | Bacteria | 131061 |
| 253 | Ga0207650_10066216 | 3300025925 | Bacteria | 2709 |
| 254 | Ga0207659_10196387 | 3300025926 | Bacteria | 1608 |
| 255 | Ga0207700_10062515 | 3300025928 | Bacteria | 2829 |
| 256 | Ga0207700_10121834 | 3300025928 | Bacteria | 2116 |
| 257 | Ga0207644_10000267 | 3300025931 | Bacteria | 35078 |
| 258 | Ga0207644_10058736 | 3300025931 | Bacteria | 2781 |
| 259 | Ga0207690_10036795 | 3300025932 | Bacteria | 3172 |
| 260 | Ga0207690_10167795 | 3300025932 | Bacteria | 1642 |
| 261 | Ga0207706_10207539 | 3300025933 | Bacteria | 1718 |
| 262 | Ga0207706_10228975 | 3300025933 | Bacteria | 1627 |
| 263 | Ga0207686_10000028 | 3300025934 | Bacteria | 163090 |
| 264 | Ga0207686_10003568 | 3300025934 | Bacteria | 8348 |
| 265 | Ga0207686_10008626 | 3300025934 | Bacteria | 5503 |
| 266 | Ga0207709_10000082 | 3300025935 | Bacteria | 163123 |
| 267 | Ga0207709_10000590 | 3300025935 | Bacteria | 30350 |
| 268 | Ga0207665_10000009 | 3300025939 | Bacteria | 162252 |
| 269 | Ga0207665_10051457 | 3300025939 | Bacteria | 2772 |
| 270 | Ga0207691_10115378 | 3300025940 | Bacteria | 2385 |
| 271 | Ga0207691_10133895 | 3300025940 | Bacteria | 2187 |
| 272 | Ga0207711_10012912 | 3300025941 | Bacteria | 6937 |
| 273 | Ga0207689_10006436 | 3300025942 | Bacteria | 10385 |
| 274 | Ga0207689_10239174 | 3300025942 | Unclassified | 1501 |
| 275 | Ga0207661_10043650 | 3300025944 | Bacteria | 3539 |
| 276 | Ga0207661_10164942 | 3300025944 | Bacteria | 1924 |
| 277 | Ga0207679_10190278 | 3300025945 | Bacteria | 1705 |
| 278 | Ga0207667_10033136 | 3300025949 | Bacteria | 5558 |
| 279 | Ga0207712_10076502 | 3300025961 | Bacteria | 2423 |
| 280 | Ga0207640_10100394 | 3300025981 | Bacteria | 2027 |
| 281 | Ga0207677_10245667 | 3300026023 | Bacteria | 1450 |
| 282 | Ga0207677_10341884 | 3300026023 | Bacteria | 1251 |
| 283 | Ga0207703_10000093 | 3300026035 | Bacteria | 104313 |
| 284 | Ga0207703_10215209 | 3300026035 | Bacteria | 1715 |
| 285 | Ga0207639_10091690 | 3300026041 | Bacteria | 2433 |
| 286 | Ga0207708_10001454 | 3300026075 | Bacteria | 17754 |
| 287 | Ga0207708_10137887 | 3300026075 | Bacteria | 1912 |
| 288 | Ga0207708_10391927 | 3300026075 | Bacteria | 1147 |
| 289 | Ga0207648_10232549 | 3300026089 | Bacteria | 1640 |
| 290 | Ga0207674_10039188 | 3300026116 | Bacteria | 4914 |
| 291 | Ga0207674_10110330 | 3300026116 | Bacteria | 2726 |
| 292 | Ga0207675_100002639 | 3300026118 | Bacteria | 17699 |
| 293 | Ga0207675_100029698 | 3300026118 | Bacteria | 5091 |
| 294 | Ga0207675_100043408 | 3300026118 | Bacteria | 4199 |
| 295 | Ga0207675_100189401 | 3300026118 | Bacteria | 1973 |
| 296 | Ga0207675_100326816 | 3300026118 | Bacteria | 1498 |
| 297 | Ga0209588_1007099 | 3300027671 | Bacteria | 3284 |
| 298 | Ga0209588_1037184 | 3300027671 | Bacteria | 1567 |
| 299 | Ga0207428_10000967 | 3300027907 | Bacteria | 31825 |
| 300 | Ga0207428_10006746 | 3300027907 | Bacteria | 10531 |
| 301 | Ga0207428_10057404 | 3300027907 | Bacteria | 3090 |
| 302 | Ga0268266_10225895 | 3300028379 | Unclassified | 1723 |
| 303 | Ga0268265_10136485 | 3300028380 | Unclassified | 2047 |
| 304 | Ga0268264_10257973 | 3300028381 | Bacteria | 1623 |
| 305 | Ga0268264_10331668 | 3300028381 | Bacteria | 1442 |
| 306 | Ga0265334_10013622 | 3300028573 | Bacteria | 3403 |
| 307 | Ga0265318_10028408 | 3300028577 | Bacteria | 2188 |
| 308 | Ga0265322_10006453 | 3300028654 | Bacteria | 3455 |
| 309 | Ga0265338_10005122 | 3300028800 | Bacteria | 17268 |
| 310 | Ga0265338_10054424 | 3300028800 | Bacteria | 3568 |
| 311 | Ga0265338_10068514 | 3300028800 | Bacteria | 3056 |
| 312 | Ga0265329_10006749 | 3300031242 | Bacteria | 4519 |
| 313 | Ga0265331_10070827 | 3300031250 | Unclassified | 1632 |
| 314 | Ga0265327_10012028 | 3300031251 | Bacteria | 5884 |
| 315 | Ga0265316_10005017 | 3300031344 | Bacteria | 12994 |
| 316 | Ga0307408_100015965 | 3300031548 | Bacteria | 5007 |
| 317 | Ga0307408_100238458 | 3300031548 | Bacteria | 1493 |
| 318 | Ga0265313_10014646 | 3300031595 | Bacteria | 4621 |
| 319 | Ga0316575_10002415 | 3300031665 | Bacteria | 6264 |
| 320 | Ga0316575_10027206 | 3300031665 | Bacteria | 2225 |
| 321 | Ga0316575_10027668 | 3300031665 | Bacteria | 2206 |
| 322 | Ga0316579_10014160 | 3300031691 | Bacteria | 3442 |
| 323 | Ga0265314_10003428 | 3300031711 | Bacteria | 15321 |
| 324 | Ga0316576_10036274 | 3300031727 | Bacteria | 3524 |
| 325 | Ga0316576_10352325 | 3300031727 | Unclassified | 1095 |
| 326 | Ga0316578_10052553 | 3300031728 | Bacteria | 2387 |
| 327 | Ga0316578_10123670 | 3300031728 | Unclassified | 1556 |
| 328 | Ga0307405_10010189 | 3300031731 | Bacteria | 4857 |
| 329 | Ga0307405_10113022 | 3300031731 | Bacteria | 1843 |
| 330 | Ga0316577_10000156 | 3300031733 | Bacteria | 21231 |
| 331 | Ga0316577_10061688 | 3300031733 | Bacteria | 2093 |
| 332 | Ga0307410_10012276 | 3300031852 | Bacteria | 4946 |
| 333 | Ga0307406_10149598 | 3300031901 | Archaea | 1664 |
| 334 | Ga0307406_10240036 | 3300031901 | Bacteria | 1359 |
| 335 | Ga0307406_10381575 | 3300031901 | Bacteria | 1111 |
| 336 | Ga0307407_10056688 | 3300031903 | Bacteria | 2270 |
| 337 | Ga0307416_100044253 | 3300032002 | Bacteria | 3494 |
| 338 | Ga0307416_100099938 | 3300032002 | Bacteria | 2521 |
| 339 | Ga0307416_100157291 | 3300032002 | Unclassified | 2094 |
| 340 | Ga0307416_100198601 | 3300032002 | Unclassified | 1900 |
| 341 | Ga0307416_100735449 | 3300032002 | Bacteria | 1078 |
| 342 | Ga0307414_10290194 | 3300032004 | Bacteria | 1379 |
| 343 | Ga0307411_10021439 | 3300032005 | Bacteria | 3781 |
| 344 | Ga0307411_10078704 | 3300032005 | Bacteria | 2261 |
| 345 | Ga0307411_10223684 | 3300032005 | Bacteria | 1462 |
| 346 | Ga0307415_100140245 | 3300032126 | Bacteria | 1845 |
| 347 | Ga0307415_100348365 | 3300032126 | Bacteria | 1246 |
| 348 | Ga0316583_10063119 | 3300032133 | Bacteria | 1297 |
| 349 | Ga0316580_10012217 | 3300032139 | Bacteria | 2615 |
| 350 | Ga0373930_0000244 | 3300034816 | Bacteria | 6913 |
| 351 | Ga0373950_0001349 | 3300034818 | Bacteria | 3179 |
| 352 | Ga0373958_0009078 | 3300034819 | Bacteria | 1629 |
| 353 | Ga0373959_0000891 | 3300034820 | Bacteria | 5042 |
| 354 | Ga0373938_0000568 | 3300034957 | Bacteria | 5970 |
| 355 | Ga0373929_0002332 | 3300035085 | Bacteria | 3488 |
| 356 | Ga0373940_0000663 | 3300035088 | Bacteria | 5505 |
| 357 | Ga0373944_0002673 | 3300035089 | Bacteria | 4542 |
| 358 | Ga0373944_0059936 | 3300035089 | Unclassified | 1219 |
| 359 | Ga0373949_0001449 | 3300035090 | Bacteria | 6782 |
| 360 | Ga0373951_0000775 | 3300035091 | Bacteria | 8729 |
| 361 | Ga0373952_0000131 | 3300035092 | Bacteria | 10723 |
| 362 | Ga0373923_0023827 | 3300035111 | Bacteria | 2412 |
| 363 | Ga0373932_0001952 | 3300035112 | Bacteria | 5459 |
| 364 | Ga0373936_0102803 | 3300035113 | Bacteria | 1207 |
| 365 | Ga0373941_0000019 | 3300035115 | Bacteria | 27005 |
| 366 | Ga0373945_0020912 | 3300035116 | Bacteria | 2244 |
| 367 | Ga0373953_0059554 | 3300035117 | Unclassified | 1559 |
| 368 | Ga0373954_0004504 | 3300035118 | Bacteria | 5990 |
| 369 | Ga0373954_0033192 | 3300035118 | Unclassified | 2388 |
| 370 | Ga0373956_0012733 | 3300035119 | Bacteria | 3492 |
| 371 | Ga0373960_0000344 | 3300035121 | Bacteria | 8964 |
| 372 | Ga0373943_0000048 | 3300035170 | Bacteria | 41033 |
| 373 | Ga0373955_0017989 | 3300035172 | Bacteria | 3506 |
| 374 | Ga0373942_0000503 | 3300035207 | Bacteria | 11030 |
| 375 | Ga0373961_0001690 | 3300035241 | Bacteria | 6162 |
| 376 | Ga0373962_0000153 | 3300035242 | Bacteria | 14342 |
| 377 | Ga0316574_0003944 | 3300035398 | Bacteria | 7721 |
| 378 | Ga0316574_0010860 | 3300035398 | Bacteria | 5160 |
| 379 | Ga0373924_0005801 | 3300035410 | Bacteria | 4393 |
| 380 | Ga0373924_0050144 | 3300035410 | Bacteria | 1729 |
| 381 | Ga0373931_0004901 | 3300035691 | Bacteria | 6153 |
| 382 | Ga0373931_0210689 | 3300035691 | Unclassified | 1165 |
| 383 | Ga0373935_0025095 | 3300035692 | Bacteria | 3673 |
| 384 | Ga0373927_0263543 | 3300035695 | Bacteria | 1133 |
| 385 | Ga0373947_0000658 | 3300035725 | Bacteria | 20469 |
| 386 | Ga0373947_0004307 | 3300035725 | Bacteria | 8361 |
| 387 | Ga0373947_0049295 | 3300035725 | Bacteria | 2528 |
| 388 | Ga0373937_0002273 | 3300036401 | Bacteria | 16039 |
| 389 | Ga0373937_0002585 | 3300036401 | Bacteria | 15054 |
| 390 | Ga0373937_0048276 | 3300036401 | Bacteria | 3896 |
| 391 | Ga0373937_0287666 | 3300036401 | Unclassified | 1553 |
| 392 | Ga0373937_0346308 | 3300036401 | Unclassified | 1407 |
| 393 | Ga0316582_0006844 | 3300036647 | Bacteria | 6026 |
| 394 | Ga0316584_0001379 | 3300036712 | Bacteria | 14472 |
| 395 | Ga0316584_0065904 | 3300036712 | Bacteria | 2713 |
| 396 | Ga0373925_0011642 | 3300037068 | Bacteria | 6362 |
| 397 | Ga0373925_0207331 | 3300037068 | Bacteria | 1560 |
| 398 | Ga0395899_0126231 | 3300037312 | Bacteria | 1830 |
| 399 | Ga0395898_0223370 | 3300037466 | Bacteria | 1796 |
| 400 | Ga0395898_0324264 | 3300037466 | Bacteria | 1469 |
| 401 | Ga0395905_0118230 | 3300037471 | Bacteria | 2491 |
| 402 | Ga0316581_0043047 | 3300037588 | Bacteria | 1378 |
| 403 | Ga0395901_0017241 | 3300038443 | Bacteria | 7370 |
| 404 | Ga0395901_0027704 | 3300038443 | Bacteria | 5825 |
| 405 | Ga0436365_0917382 | 3300039437 | Bacteria | 1483 |
| 406 | Ga0436360_0084461 | 3300039438 | Bacteria | 2177 |
| 407 | Ga0439461_0023094 | 3300041410 | Bacteria | 1250 |
| 408 | Ga0439449_0032473 | 3300042007 | Bacteria | 1946 |
| 409 | Ga0439446_0001453 | 3300042156 | Bacteria | 5407 |
| 410 | Ga0439434_0048884 | 3300042435 | Bacteria | 1309 |
| 411 | Ga0439435_0000202 | 3300042436 | Bacteria | 8376 |
| 412 | Ga0439460_0019865 | 3300042461 | Bacteria | 1823 |
| 413 | Ga0451577_0005551 | 3300042876 | Bacteria | 12851 |
| 414 | Ga0439440_0010671 | 3300042993 | Bacteria | 1925 |
| 415 | Ga0466963_0003999 | 3300044694 | Bacteria | 8527 |
| 416 | Ga0466963_0014151 | 3300044694 | Bacteria | 4915 |
| 417 | Ga0453684_0119478 | 3300044712 | Bacteria | 3185 |
| 418 | Ga0453684_0144569 | 3300044712 | Bacteria | 2835 |
| 419 | Ga0466957_0148788 | 3300044842 | Bacteria | 1513 |
| 420 | Ga0466957_0152261 | 3300044842 | Bacteria | 1496 |
| 421 | Ga0466960_0000033 | 3300044901 | Bacteria | 46153 |
| 422 | Ga0466959_0217918 | 3300045049 | Bacteria | 1324 |
| 423 | Ga0451576_0040232 | 3300045051 | Bacteria | 4949 |
| 424 | Ga0451576_0373219 | 3300045051 | Bacteria | 1495 |
| 425 | Ga0466958_0022930 | 3300045836 | Bacteria | 3660 |
| 426 | Ga0466958_0194223 | 3300045836 | Bacteria | 1291 |
| 427 | Ga0466967_0067919 | 3300045976 | Bacteria | 3181 |
| 428 | Ga0466967_0156395 | 3300045976 | Bacteria | 2136 |
| 429 | Ga0466967_0273605 | 3300045976 | Bacteria | 1619 |
| 430 | Ga0466967_0438244 | 3300045976 | Bacteria | 1276 |
| 431 | Ga0495592_0032013 | 3300046454 | Unclassified | 3972 |
| 432 | Ga0495592_0055736 | 3300046454 | Bacteria | 2923 |
| 433 | Ga0495592_0131019 | 3300046454 | Bacteria | 1754 |
| 434 | Ga0495603_0130769 | 3300046455 | Bacteria | 1462 |
| 435 | Ga0495629_0000159 | 3300046459 | Bacteria | 59616 |
| 436 | Ga0495629_0016241 | 3300046459 | Bacteria | 5344 |
| 437 | Ga0495629_0099492 | 3300046459 | Bacteria | 2029 |
| 438 | Ga0495629_0179867 | 3300046459 | Bacteria | 1466 |
| 439 | Ga0495641_0003425 | 3300046461 | Bacteria | 11883 |
| 440 | Ga0495651_0007517 | 3300046462 | Bacteria | 8336 |
| 441 | Ga0495651_0041923 | 3300046462 | Bacteria | 3555 |
| 442 | Ga0495651_0073811 | 3300046462 | Bacteria | 2589 |
| 443 | Ga0495653_0005657 | 3300046463 | Bacteria | 10203 |
| 444 | Ga0495653_0025252 | 3300046463 | Bacteria | 4779 |
| 445 | Ga0495653_0041699 | 3300046463 | Bacteria | 3581 |
| 446 | Ga0495653_0044397 | 3300046463 | Bacteria | 3449 |
| 447 | Ga0495653_0055532 | 3300046463 | Bacteria | 3022 |
| 448 | Ga0495650_0000398 | 3300046471 | Bacteria | 72672 |
| 449 | Ga0495580_0092053 | 3300046472 | Bacteria | 2110 |
| 450 | Ga0495582_0000183 | 3300046473 | Bacteria | 34098 |
| 451 | Ga0495582_0062304 | 3300046473 | Bacteria | 2061 |
| 452 | Ga0495662_0000220 | 3300046476 | Bacteria | 23891 |
| 453 | Ga0495662_0023171 | 3300046476 | Bacteria | 2999 |
| 454 | Ga0495664_0049594 | 3300046477 | Bacteria | 2492 |
| 455 | Ga0495608_0075495 | 3300046511 | Unclassified | 2197 |
| 456 | Ga0495608_0083084 | 3300046511 | Bacteria | 2079 |
| 457 | Ga0495608_0094669 | 3300046511 | Bacteria | 1930 |
| 458 | Ga0495608_0105871 | 3300046511 | Bacteria | 1811 |
| 459 | Ga0495608_0113079 | 3300046511 | Bacteria | 1744 |
| 460 | Ga0495618_0000512 | 3300046514 | Bacteria | 27479 |
| 461 | Ga0495618_0080991 | 3300046514 | Bacteria | 2072 |
| 462 | Ga0495628_0130551 | 3300046516 | Bacteria | 1922 |
| 463 | Ga0495630_0002760 | 3300046517 | Bacteria | 12184 |
| 464 | Ga0495630_0020164 | 3300046517 | Bacteria | 4912 |
| 465 | Ga0495630_0023403 | 3300046517 | Bacteria | 4567 |
| 466 | Ga0495630_0065501 | 3300046517 | Bacteria | 2730 |
| 467 | Ga0495643_0001409 | 3300046522 | Bacteria | 22295 |
| 468 | Ga0495666_0041605 | 3300046526 | Bacteria | 2225 |
| 469 | Ga0495652_0029681 | 3300046529 | Bacteria | 4802 |
| 470 | Ga0495652_0145126 | 3300046529 | Bacteria | 1861 |
| 471 | Ga0495665_0001453 | 3300046531 | Bacteria | 12705 |
| 472 | Ga0495640_0017528 | 3300046533 | Bacteria | 5336 |
| 473 | Ga0495640_0076220 | 3300046533 | Bacteria | 2238 |
| 474 | Ga0495587_0008243 | 3300046536 | Bacteria | 6708 |
| 475 | Ga0495587_0044110 | 3300046536 | Bacteria | 2653 |
| 476 | Ga0495621_0045659 | 3300046539 | Unclassified | 1552 |
| 477 | Ga0495645_0000023 | 3300046543 | Bacteria | 130982 |
| 478 | Ga0495667_0002831 | 3300046559 | Bacteria | 11595 |
| 479 | Ga0495667_0032855 | 3300046559 | Unclassified | 3474 |
| 480 | Ga0495667_0033511 | 3300046559 | Bacteria | 3437 |
| 481 | Ga0495667_0096059 | 3300046559 | Unclassified | 1918 |
| 482 | Ga0495634_0006252 | 3300046642 | Bacteria | 9068 |
| 483 | Ga0495634_0022820 | 3300046642 | Bacteria | 4407 |
| 484 | Ga0495634_0051646 | 3300046642 | Bacteria | 2758 |
| 485 | Ga0495635_0179944 | 3300046663 | Bacteria | 1437 |
| 486 | Ga0495657_0020336 | 3300046675 | Bacteria | 4772 |
| 487 | Ga0495657_0075452 | 3300046675 | Bacteria | 2192 |
| 488 | Ga0495599_0093614 | 3300046678 | Unclassified | 1874 |
| 489 | Ga0495599_0103068 | 3300046678 | Bacteria | 1778 |
| 490 | Ga0495599_0159430 | 3300046678 | Bacteria | 1395 |
| 491 | Ga0495646_0017390 | 3300046680 | Bacteria | 4562 |
| 492 | Ga0495646_0275497 | 3300046680 | Bacteria | 895 |
| 493 | Ga0495647_0009083 | 3300046681 | Bacteria | 3357 |
| 494 | Ga0495658_0003812 | 3300046683 | Bacteria | 7469 |
| 495 | Ga0495658_0047548 | 3300046683 | Unclassified | 2417 |
| 496 | Ga0495669_0004600 | 3300046684 | Bacteria | 5715 |
| 497 | Ga0495669_0050117 | 3300046684 | Unclassified | 1872 |
| 498 | Ga0495613_0000392 | 3300046689 | Bacteria | 37506 |
| 499 | Ga0495613_0018344 | 3300046689 | Bacteria | 5218 |
| 500 | Ga0495613_0028865 | 3300046689 | Bacteria | 4126 |
| 501 | Ga0495613_0375863 | 3300046689 | Bacteria | 972 |
| 502 | Ga0495600_0028202 | 3300046809 | Unclassified | 3632 |
| 503 | Ga0495600_0060912 | 3300046809 | Bacteria | 2465 |
| 504 | Ga0495600_0063598 | 3300046809 | Bacteria | 2411 |
| 505 | Ga0495604_0052840 | 3300047317 | Bacteria | 3144 |
| 506 | Ga0495604_0072524 | 3300047317 | Bacteria | 2601 |
| 507 | Ga0495604_0096779 | 3300047317 | Bacteria | 2177 |
| 508 | Ga0495636_0034908 | 3300047318 | Unclassified | 2071 |
| 509 | Ga0495674_0003066 | 3300047319 | Bacteria | 16232 |
| 510 | Ga0495674_0043579 | 3300047319 | Bacteria | 3994 |
| 511 | Ga0495674_0053375 | 3300047319 | Bacteria | 3553 |
| 512 | Ga0495674_0063360 | 3300047319 | Unclassified | 3216 |
| 513 | Ga0495676_0059563 | 3300047321 | Bacteria | 2997 |
| 514 | Ga0495680_0006148 | 3300047322 | Bacteria | 11204 |
| 515 | Ga0495680_0009837 | 3300047322 | Bacteria | 8573 |
| 516 | Ga0495680_0044306 | 3300047322 | Bacteria | 3518 |
| 517 | Ga0495680_0159215 | 3300047322 | Bacteria | 1640 |
| 518 | Ga0495675_0202903 | 3300047444 | Bacteria | 1206 |
| 519 | Ga0495684_0000410 | 3300047471 | Bacteria | 34999 |
| 520 | Ga0495684_0019570 | 3300047471 | Bacteria | 5215 |
| 521 | Ga0495684_0032992 | 3300047471 | Bacteria | 3976 |
| 522 | Ga0495684_0067193 | 3300047471 | Bacteria | 2726 |
| 523 | Ga0495684_0096860 | 3300047471 | Bacteria | 2232 |
| 524 | Ga0495593_0010950 | 3300047673 | Bacteria | 5223 |
| 525 | Ga0495602_0276813 | 3300048088 | Unclassified | 1238 |
| 526 | Ga0495615_0019285 | 3300048090 | Bacteria | 1513 |
| 527 | Ga0496100_0027848 | 3300048903 | Bacteria | 3479 |
| 528 | Ga0496101_0062509 | 3300048904 | Bacteria | 2707 |
| 529 | Ga0496102_0052493 | 3300048905 | Bacteria | 3715 |
| 530 | Ga0496102_0059347 | 3300048905 | Bacteria | 3498 |
| 531 | Ga0496102_0110291 | 3300048905 | Bacteria | 2565 |
| 532 | Ga0496102_0594859 | 3300048905 | Unclassified | 1029 |
| 533 | Ga0496104_0004198 | 3300048907 | Bacteria | 12511 |
| 534 | Ga0496104_0133081 | 3300048907 | Bacteria | 2389 |
| 535 | Ga0496104_0136263 | 3300048907 | Bacteria | 2359 |
| 536 | Ga0496104_0303130 | 3300048907 | Bacteria | 1510 |
| 537 | Ga0496105_0094219 | 3300048908 | Bacteria | 2473 |
| 538 | Ga0496106_0018159 | 3300048909 | Bacteria | 5202 |
| 539 | Ga0496106_0023345 | 3300048909 | Bacteria | 4595 |
| 540 | Ga0496106_0251193 | 3300048909 | Unclassified | 1414 |
| 541 | Ga0496108_0041466 | 3300048911 | Bacteria | 3843 |
| 542 | Ga0496109_0110290 | 3300048912 | Bacteria | 2558 |
| 543 | Ga0496110_0009220 | 3300048913 | Bacteria | 7975 |
| 544 | Ga0496110_0114563 | 3300048913 | Bacteria | 2426 |
| 545 | Ga0496110_0429811 | 3300048913 | Bacteria | 1204 |
| 546 | Ga0496111_0167890 | 3300048914 | Bacteria | 1630 |
| 547 | Ga0496112_0030559 | 3300048915 | Bacteria | 5214 |
| 548 | Ga0496112_0443717 | 3300048915 | Bacteria | 1236 |
| 549 | Ga0496114_0048228 | 3300048917 | Bacteria | 3543 |
| 550 | Ga0496114_0062221 | 3300048917 | Bacteria | 3124 |
| 551 | Ga0496114_0238574 | 3300048917 | Bacteria | 1598 |
| 552 | Ga0496115_0029245 | 3300048918 | Bacteria | 4326 |
| 553 | Ga0501291_003832 | 3300049514 | Bacteria | 1890 |
| 554 | Ga0501296_007593 | 3300049519 | Bacteria | 1246 |
| 555 | Ga0501031_0141420 | 3300049568 | Bacteria | 1573 |
| 556 | Ga0501034_0021166 | 3300049571 | Bacteria | 6634 |
| 557 | Ga0501034_0039374 | 3300049571 | Bacteria | 4788 |
| 558 | Ga0501036_0120761 | 3300049572 | Bacteria | 2213 |
| 559 | Ga0501038_0168642 | 3300049574 | Bacteria | 1774 |
| 560 | Ga0501039_0114135 | 3300049575 | Bacteria | 2113 |
| 561 | Ga0501039_0164363 | 3300049575 | Bacteria | 1745 |
| 562 | Ga0501040_0034852 | 3300049576 | Bacteria | 3411 |
| 563 | Ga0501040_0053093 | 3300049576 | Bacteria | 2775 |
| 564 | Ga0501040_0087021 | 3300049576 | Bacteria | 2169 |
| 565 | Ga0501041_0033405 | 3300049577 | Bacteria | 3113 |
| 566 | Ga0501041_0071403 | 3300049577 | Bacteria | 2132 |
| 567 | Ga0501042_0282717 | 3300049578 | Bacteria | 1198 |
| 568 | Ga0501047_0063760 | 3300049581 | Bacteria | 3555 |
| 569 | Ga0501047_0139105 | 3300049581 | Bacteria | 2307 |
| 570 | Ga0501067_0262083 | 3300049583 | Unclassified | 962 |
| 571 | Ga0501071_0028941 | 3300049587 | Bacteria | 3907 |
| 572 | Ga0501071_0052509 | 3300049587 | Bacteria | 2939 |
| 573 | Ga0501071_0161435 | 3300049587 | Bacteria | 1675 |
| 574 | Ga0501072_0001717 | 3300049588 | Bacteria | 16315 |
| 575 | Ga0501072_0016271 | 3300049588 | Bacteria | 5706 |
| 576 | Ga0501072_0041825 | 3300049588 | Bacteria | 3599 |
| 577 | Ga0501072_0051165 | 3300049588 | Bacteria | 3253 |
| 578 | Ga0501073_0054938 | 3300049589 | Bacteria | 2787 |
| 579 | Ga0501074_0016795 | 3300049590 | Bacteria | 5311 |
| 580 | Ga0501074_0147928 | 3300049590 | Bacteria | 1680 |
| 581 | Ga0501074_0163934 | 3300049590 | Unclassified | 1587 |
| 582 | Ga0501075_0017282 | 3300049591 | Bacteria | 5209 |
| 583 | Ga0501075_0031480 | 3300049591 | Bacteria | 3938 |
| 584 | Ga0501075_0034517 | 3300049591 | Bacteria | 3767 |
| 585 | Ga0501075_0042478 | 3300049591 | Bacteria | 3409 |
| 586 | Ga0501075_0072097 | 3300049591 | Bacteria | 2611 |
| 587 | Ga0501076_0014709 | 3300049592 | Bacteria | 5900 |
| 588 | Ga0501076_0018815 | 3300049592 | Bacteria | 5271 |
| 589 | Ga0501076_0039280 | 3300049592 | Bacteria | 3716 |
| 590 | Ga0501076_0103367 | 3300049592 | Bacteria | 2298 |
| 591 | Ga0501077_0052780 | 3300049593 | Bacteria | 2581 |
| 592 | Ga0501228_001032 | 3300049666 | Bacteria | 1940 |
| 593 | Ga0501225_0038236 | 3300049705 | Bacteria | 1322 |
| 594 | Ga0501225_0090986 | 3300049705 | Bacteria | 884 |
| 595 | Ga0501245_009500 | 3300049708 | Bacteria | 1397 |
| 596 | Ga0501079_0052886 | 3300049741 | Bacteria | 3133 |
| 597 | Ga0501079_0076827 | 3300049741 | Bacteria | 2583 |
| 598 | Ga0501079_0161132 | 3300049741 | Bacteria | 1749 |
| 599 | Ga0501080_0032031 | 3300049742 | Bacteria | 4901 |
| 600 | Ga0501080_0100483 | 3300049742 | Bacteria | 2683 |
| 601 | Ga0501080_0148377 | 3300049742 | Bacteria | 2168 |
| 602 | Ga0501080_0491768 | 3300049742 | Bacteria | 1097 |
| 603 | Ga0501081_0067909 | 3300049743 | Bacteria | 2481 |
| 604 | Ga0501081_0122108 | 3300049743 | Bacteria | 1856 |
| 605 | Ga0501081_0160513 | 3300049743 | Bacteria | 1620 |
| 606 | Ga0501081_0179712 | 3300049743 | Bacteria | 1530 |
| 607 | Ga0501081_0321440 | 3300049743 | Bacteria | 1137 |
| 608 | Ga0501083_0003233 | 3300049744 | Bacteria | 11364 |
| 609 | Ga0501045_0011704 | 3300049824 | Bacteria | 6163 |
| 610 | Ga0501045_0025027 | 3300049824 | Bacteria | 4288 |
| 611 | Ga0501045_0047365 | 3300049824 | Bacteria | 3131 |
| 612 | Ga0501045_0144509 | 3300049824 | Bacteria | 1769 |
| 613 | Ga0501212_001937 | 3300049851 | Bacteria | 2423 |
| 614 | nmdc:mga03683_11191_c1 | 3300050489 | Bacteria | 3240 |
| 615 | nmdc:mga00v17_20572_c1 | 3300050491 | Bacteria | 3783 |
| 616 | nmdc:mga0yw44_240855_c1 | 3300050492 | Unclassified | 1202 |
| 617 | nmdc:mga0yw44_47991_c1 | 3300050492 | Bacteria | 2573 |
| 618 | nmdc:mga0k408_60061_c1 | 3300050493 | Bacteria | 2209 |
| 619 | nmdc:mga0k408_7107_c1 | 3300050493 | Bacteria | 4983 |
| 620 | nmdc:mga04h51_27638_c1 | 3300050495 | Unclassified | 1764 |
| 621 | nmdc:mga07m45_26886_c1 | 3300050496 | Bacteria | 3165 |
| 622 | nmdc:mga05p37_171351_c1 | 3300050507 | Bacteria | 2647 |
| 623 | nmdc:mga05p37_18589_c1 | 3300050507 | Bacteria | 8400 |
| 624 | nmdc:mga05p37_257403_c1 | 3300050507 | Unclassified | 2091 |
| 625 | nmdc:mga05p37_287962_c1 | 3300050507 | Bacteria | 1956 |
| 626 | nmdc:mga05p37_3009_c1 | 3300050507 | Bacteria | 19557 |
| 627 | nmdc:mga05p37_36688_c1 | 3300050507 | Bacteria | 6011 |
| 628 | nmdc:mga05p37_67193_c1 | 3300050507 | Bacteria | 4410 |
| 629 | nmdc:mga05p37_89322_c1 | 3300050507 | Bacteria | 3797 |
| 630 | nmdc:mga09592_16509_c1 | 3300050508 | Bacteria | 6040 |
| 631 | nmdc:mga09592_4546_c1 | 3300050508 | Bacteria | 11224 |
| 632 | nmdc:mga09592_51940_c2 | 3300050508 | Bacteria | 2880 |
| 633 | nmdc:mga0qj67_108582_c1 | 3300050509 | Bacteria | 2239 |
| 634 | nmdc:mga0qj67_139625_c1 | 3300050509 | Bacteria | 1964 |
| 635 | nmdc:mga0qj67_226406_c1 | 3300050509 | Bacteria | 1518 |
| 636 | nmdc:mga0qj67_3398_c1 | 3300050509 | Bacteria | 11483 |
| 637 | nmdc:mga06r32_211931_c1 | 3300050510 | Unclassified | 1925 |
| 638 | nmdc:mga06r32_234606_c1 | 3300050510 | Bacteria | 1822 |
| 639 | nmdc:mga06r32_4718_c1 | 3300050510 | Bacteria | 12256 |
| 640 | nmdc:mga06r32_71529_c1 | 3300050510 | Bacteria | 3357 |
| 641 | nmdc:mga08y16_118832_c1 | 3300050511 | Bacteria | 2751 |
| 642 | nmdc:mga08y16_131_c1 | 3300050511 | Bacteria | 64623 |
| 643 | nmdc:mga08y16_22528_c1 | 3300050511 | Bacteria | 6651 |
| 644 | nmdc:mga08y16_329880_c1 | 3300050511 | Unclassified | 1570 |
| 645 | nmdc:mga08y16_513988_c1 | 3300050511 | Bacteria | 1215 |
| 646 | nmdc:mga08y16_58929_c1 | 3300050511 | Bacteria | 4012 |
| 647 | nmdc:mga08y16_71797_c1 | 3300050511 | Bacteria | 3607 |
| 648 | nmdc:mga08y16_88974_c1 | 3300050511 | Bacteria | 3218 |
| 649 | nmdc:mga0n895_15302_c1 | 3300050512 | Bacteria | 6989 |
| 650 | nmdc:mga0n895_2022_c1 | 3300050512 | Bacteria | 15597 |
| 651 | nmdc:mga0n895_256769_c1 | 3300050512 | Bacteria | 1774 |
| 652 | nmdc:mga0n895_303186_c1 | 3300050512 | Bacteria | 1619 |
| 653 | nmdc:mga0n895_392444_c1 | 3300050512 | Bacteria | 1404 |
| 654 | nmdc:mga0n895_472454_c1 | 3300050512 | Bacteria | 1265 |
| 655 | nmdc:mga0n895_90460_c1 | 3300050512 | Bacteria | 3062 |
| 656 | nmdc:mga0n895_95388_c1 | 3300050512 | Bacteria | 2979 |
| 657 | nmdc:mga0rr50_162124_c1 | 3300050513 | Unclassified | 1815 |
| 658 | nmdc:mga0rr50_194490_c1 | 3300050513 | Bacteria | 1664 |
| 659 | nmdc:mga0rr50_21272_c1 | 3300050513 | Bacteria | 4424 |
| 660 | nmdc:mga0rr50_370238_c1 | 3300050513 | Bacteria | 1207 |
| 661 | nmdc:mga0rr50_783_c1 | 3300050513 | Bacteria | 17103 |
| 662 | nmdc:mga0rr50_9454_c1 | 3300050513 | Bacteria | 6130 |
| 663 | nmdc:mga08x19_127533_c1 | 3300050514 | Bacteria | 1710 |
| 664 | nmdc:mga08x19_18246_c1 | 3300050514 | Bacteria | 4300 |
| 665 | nmdc:mga08x19_61987_c1 | 3300050514 | Bacteria | 2424 |
| 666 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 667 | nmdc:mga0a205_113883_c1 | 3300050515 | Bacteria | 2603 |
| 668 | nmdc:mga0a205_15170_c1 | 3300050515 | Bacteria | 7197 |
| 669 | nmdc:mga0a205_32599_c1 | 3300050515 | Bacteria | 4995 |
| 670 | nmdc:mga0a205_382905_c1 | 3300050515 | Bacteria | 1272 |
| 671 | nmdc:mga0a205_52960_c1 | 3300050515 | Bacteria | 3917 |
| 672 | Ga0495601_0001652 | 3300053077 | Bacteria | 12310 |
| 673 | Ga0495601_0006540 | 3300053077 | Bacteria | 6817 |
| 674 | Ga0495601_0047880 | 3300053077 | Bacteria | 2692 |
| 675 | Ga0495601_0074925 | 3300053077 | Bacteria | 2166 |
| 676 | Ga0495601_0082190 | 3300053077 | Bacteria | 2068 |
| 677 | Ga0495612_0000673 | 3300053078 | Bacteria | 13811 |
| 678 | Ga0495595_0009202 | 3300053084 | Bacteria | 4079 |
| 679 | Ga0495595_0037774 | 3300053084 | Bacteria | 2197 |
| 680 | Ga0495619_0025632 | 3300053085 | Bacteria | 3788 |
| 681 | Ga0495619_0034069 | 3300053085 | Bacteria | 3309 |
| 682 | Ga0495619_0043174 | 3300053085 | Bacteria | 2955 |
| 683 | Ga0495619_0069762 | 3300053085 | Bacteria | 2350 |
| 684 | Ga0495619_0082013 | 3300053085 | Bacteria | 2173 |
| 685 | Ga0495619_0182191 | 3300053085 | Unclassified | 1453 |
| 686 | Ga0500628_000685 | 3300053129 | Bacteria | 6093 |
| 687 | Ga0501084_0019389 | 3300054114 | Bacteria | 5666 |
| 688 | Ga0501084_0084855 | 3300054114 | Bacteria | 2659 |
| 689 | Ga0501084_0097686 | 3300054114 | Bacteria | 2466 |
| 690 | Ga0501084_0221279 | 3300054114 | Bacteria | 1597 |
| 691 | Ga0590075_000007 | 3300059424 | Bacteria | 63273 |
| 692 | Ga0590075_010254 | 3300059424 | Bacteria | 2254 |
| 693 | Ga0590077_000017 | 3300059426 | Bacteria | 38492 |
| 694 | Ga0501082_0328214 | 3300060353 | Bacteria | 1333 |
| 695 | Ga0501082_0338538 | 3300060353 | Bacteria | 1311 |
| 696 | Ga0466962_0011030 | 3300061719 | Bacteria | 4351 |
| 697 | Ga0530510_0006387 | 3300061734 | Bacteria | 8206 |
| 698 | Ga0530510_0032255 | 3300061734 | Bacteria | 3768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046680 | Ga0495646_0275497 | Ga0495646_0275497_141_878 | 233 |
| 2 | 3300036401 | Ga0373937_0048276 | Ga0373937_0048276_3131_3868 | 239 |
| 3 | 3300046477 | Ga0495664_0049594 | Ga0495664_0049594_19_774 | 239 |
| 4 | 3300046675 | Ga0495657_0020336 | Ga0495657_0020336_18_755 | 239 |
| 5 | 3300046678 | Ga0495599_0093614 | Ga0495599_0093614_1103_1840 | 239 |
| 6 | 3300053084 | Ga0495595_0037774 | Ga0495595_0037774_18_755 | 239 |
| 7 | 3300048088 | Ga0495602_0276813 | Ga0495602_0276813_461_1216 | 245 |
| 8 | 3300048904 | Ga0496101_0062509 | Ga0496101_0062509_910_1740 | 270 |
| 9 | 3300049705 | Ga0501225_0090986 | Ga0501225_0090986_60_872 | 270 |
| 10 | 3300035691 | Ga0373931_0210689 | Ga0373931_0210689_40_855 | 271 |
| 11 | 3300046675 | Ga0495657_0075452 | Ga0495657_0075452_419_1279 | 280 |
| 12 | 3300005331 | Ga0070670_100371536 | Ga0070670_1003715362 | 286 |
| 13 | 3300025908 | Ga0207643_10131412 | Ga0207643_101314122 | 286 |
| 14 | 3300006038 | Ga0075365_10136705 | Ga0075365_101367051 | 287 |
| 15 | 3300006051 | Ga0075364_10186746 | Ga0075364_101867462 | 287 |
| 16 | 3300009094 | Ga0111539_10370253 | Ga0111539_103702532 | 287 |
| 17 | 3300011119 | Ga0105246_10343557 | Ga0105246_103435572 | 287 |
| 18 | 3300025945 | Ga0207679_10190278 | Ga0207679_101902782 | 287 |
| 19 | 3300046454 | Ga0495592_0131019 | Ga0495592_0131019_143_1042 | 287 |
| 20 | 3300046473 | Ga0495582_0062304 | Ga0495582_0062304_1138_2037 | 287 |
| 21 | 3300046511 | Ga0495608_0083084 | Ga0495608_0083084_995_1894 | 287 |
| 22 | 3300046517 | Ga0495630_0020164 | Ga0495630_0020164_2972_3871 | 287 |
| 23 | 3300046529 | Ga0495652_0029681 | Ga0495652_0029681_3434_4333 | 287 |
| 24 | 3300046533 | Ga0495640_0076220 | Ga0495640_0076220_866_1765 | 287 |
| 25 | 3300046559 | Ga0495667_0002831 | Ga0495667_0002831_4049_4948 | 287 |
| 26 | 3300046642 | Ga0495634_0006252 | Ga0495634_0006252_7826_8725 | 287 |
| 27 | 3300046689 | Ga0495613_0028865 | Ga0495613_0028865_1011_1910 | 287 |
| 28 | 3300047317 | Ga0495604_0052840 | Ga0495604_0052840_983_1882 | 287 |
| 29 | 3300047319 | Ga0495674_0003066 | Ga0495674_0003066_6663_7562 | 287 |
| 30 | 3300047471 | Ga0495684_0032992 | Ga0495684_0032992_1500_2399 | 287 |
| 31 | 3300053077 | Ga0495601_0082190 | Ga0495601_0082190_1100_1999 | 287 |
| 32 | 3300045049 | Ga0466959_0217918 | Ga0466959_0217918_387_1271 | 288 |
| 33 | 3300045836 | Ga0466958_0022930 | Ga0466958_0022930_2256_3140 | 288 |
| 34 | 3300039437 | Ga0436365_0917382 | Ga0436365_0917382_334_1221 | 289 |
| 35 | 3300044842 | Ga0466957_0152261 | Ga0466957_0152261_182_1069 | 289 |
| 36 | 3300045976 | Ga0466967_0067919 | Ga0466967_0067919_1303_2190 | 289 |
| 37 | 3300061719 | Ga0466962_0011030 | Ga0466962_0011030_1875_2762 | 289 |
| 38 | 3300005577 | Ga0068857_100271381 | Ga0068857_1002713812 | 291 |
| 39 | 3300006844 | Ga0075428_100326759 | Ga0075428_1003267592 | 291 |
| 40 | 3300026116 | Ga0207674_10110330 | Ga0207674_101103303 | 291 |
| 41 | 3300053085 | Ga0495619_0182191 | Ga0495619_0182191_10_885 | 291 |
| 42 | 3300005327 | Ga0070658_10346652 | Ga0070658_103466522 | 292 |
| 43 | 3300005336 | Ga0070680_100021880 | Ga0070680_1000218802 | 292 |
| 44 | 3300005530 | Ga0070679_100205496 | Ga0070679_1002054963 | 292 |
| 45 | 3300013307 | Ga0157372_10196052 | Ga0157372_101960523 | 292 |
| 46 | 3300020082 | Ga0206353_11316981 | Ga0206353_113169813 | 292 |
| 47 | 3300020082 | Ga0206353_11357636 | Ga0206353_113576362 | 292 |
| 48 | 3300025909 | Ga0207705_10282570 | Ga0207705_102825702 | 292 |
| 49 | 3300025917 | Ga0207660_10126289 | Ga0207660_101262892 | 292 |
| 50 | 3300028573 | Ga0265334_10013622 | Ga0265334_100136223 | 292 |
| 51 | 3300028577 | Ga0265318_10028408 | Ga0265318_100284082 | 292 |
| 52 | 3300028654 | Ga0265322_10006453 | Ga0265322_100064533 | 292 |
| 53 | 3300028800 | Ga0265338_10054424 | Ga0265338_100544243 | 292 |
| 54 | 3300031242 | Ga0265329_10006749 | Ga0265329_100067494 | 292 |
| 55 | 3300031250 | Ga0265331_10070827 | Ga0265331_100708272 | 292 |
| 56 | 3300031251 | Ga0265327_10012028 | Ga0265327_100120287 | 292 |
| 57 | 3300031344 | Ga0265316_10005017 | Ga0265316_100050173 | 292 |
| 58 | 3300031595 | Ga0265313_10014646 | Ga0265313_100146462 | 292 |
| 59 | 3300031711 | Ga0265314_10003428 | Ga0265314_1000342816 | 292 |
| 60 | 3300035172 | Ga0373955_0017989 | Ga0373955_0017989_1935_2834 | 292 |
| 61 | 3300037466 | Ga0395898_0223370 | Ga0395898_0223370_162_1058 | 292 |
| 62 | 3300044694 | Ga0466963_0003999 | Ga0466963_0003999_4356_5252 | 292 |
| 63 | 3300046454 | Ga0495592_0055736 | Ga0495592_0055736_147_1046 | 292 |
| 64 | 3300046459 | Ga0495629_0016241 | Ga0495629_0016241_70_966 | 292 |
| 65 | 3300046462 | Ga0495651_0007517 | Ga0495651_0007517_5584_6483 | 292 |
| 66 | 3300046463 | Ga0495653_0044397 | Ga0495653_0044397_1081_1980 | 292 |
| 67 | 3300046516 | Ga0495628_0130551 | Ga0495628_0130551_913_1812 | 292 |
| 68 | 3300046517 | Ga0495630_0023403 | Ga0495630_0023403_194_1093 | 292 |
| 69 | 3300046536 | Ga0495587_0008243 | Ga0495587_0008243_2706_3605 | 292 |
| 70 | 3300046559 | Ga0495667_0096059 | Ga0495667_0096059_908_1807 | 292 |
| 71 | 3300046680 | Ga0495646_0017390 | Ga0495646_0017390_95_994 | 292 |
| 72 | 3300047317 | Ga0495604_0072524 | Ga0495604_0072524_1585_2484 | 292 |
| 73 | 3300047322 | Ga0495680_0044306 | Ga0495680_0044306_1724_2623 | 292 |
| 74 | 3300048905 | Ga0496102_0594859 | Ga0496102_0594859_94_990 | 292 |
| 75 | 3300048907 | Ga0496104_0133081 | Ga0496104_0133081_823_1719 | 292 |
| 76 | 3300048908 | Ga0496105_0094219 | Ga0496105_0094219_458_1354 | 292 |
| 77 | 3300048909 | Ga0496106_0251193 | Ga0496106_0251193_371_1267 | 292 |
| 78 | 3300048918 | Ga0496115_0029245 | Ga0496115_0029245_1623_2519 | 292 |
| 79 | 3300005364 | Ga0070673_100450857 | Ga0070673_1004508571 | 293 |
| 80 | 3300014969 | Ga0157376_10091538 | Ga0157376_100915383 | 293 |
| 81 | 3300025928 | Ga0207700_10121834 | Ga0207700_101218342 | 293 |
| 82 | 3300035089 | Ga0373944_0002673 | Ga0373944_0002673_843_1742 | 293 |
| 83 | 3300035113 | Ga0373936_0102803 | Ga0373936_0102803_200_1099 | 293 |
| 84 | 3300035116 | Ga0373945_0020912 | Ga0373945_0020912_624_1523 | 293 |
| 85 | 3300035170 | Ga0373943_0000048 | Ga0373943_0000048_2163_3062 | 293 |
| 86 | 3300035725 | Ga0373947_0000658 | Ga0373947_0000658_15299_16198 | 293 |
| 87 | 3300037068 | Ga0373925_0011642 | Ga0373925_0011642_2843_3742 | 293 |
| 88 | 3300046459 | Ga0495629_0000159 | Ga0495629_0000159_31381_32280 | 293 |
| 89 | 3300046459 | Ga0495629_0099492 | Ga0495629_0099492_269_1168 | 293 |
| 90 | 3300046461 | Ga0495641_0003425 | Ga0495641_0003425_9621_10520 | 293 |
| 91 | 3300046462 | Ga0495651_0041923 | Ga0495651_0041923_2297_3196 | 293 |
| 92 | 3300046463 | Ga0495653_0025252 | Ga0495653_0025252_41_940 | 293 |
| 93 | 3300046463 | Ga0495653_0055532 | Ga0495653_0055532_671_1570 | 293 |
| 94 | 3300046473 | Ga0495582_0000183 | Ga0495582_0000183_30896_31795 | 293 |
| 95 | 3300046476 | Ga0495662_0000220 | Ga0495662_0000220_7955_8854 | 293 |
| 96 | 3300046476 | Ga0495662_0023171 | Ga0495662_0023171_728_1627 | 293 |
| 97 | 3300046511 | Ga0495608_0105871 | Ga0495608_0105871_414_1313 | 293 |
| 98 | 3300046511 | Ga0495608_0113079 | Ga0495608_0113079_668_1567 | 293 |
| 99 | 3300046514 | Ga0495618_0080991 | Ga0495618_0080991_465_1364 | 293 |
| 100 | 3300046517 | Ga0495630_0065501 | Ga0495630_0065501_499_1398 | 293 |
| 101 | 3300046526 | Ga0495666_0041605 | Ga0495666_0041605_608_1507 | 293 |
| 102 | 3300046529 | Ga0495652_0145126 | Ga0495652_0145126_799_1698 | 293 |
| 103 | 3300046531 | Ga0495665_0001453 | Ga0495665_0001453_11465_12364 | 293 |
| 104 | 3300046533 | Ga0495640_0017528 | Ga0495640_0017528_3709_4608 | 293 |
| 105 | 3300046536 | Ga0495587_0044110 | Ga0495587_0044110_1479_2378 | 293 |
| 106 | 3300046559 | Ga0495667_0033511 | Ga0495667_0033511_2415_3314 | 293 |
| 107 | 3300046642 | Ga0495634_0022820 | Ga0495634_0022820_2048_2947 | 293 |
| 108 | 3300046642 | Ga0495634_0051646 | Ga0495634_0051646_550_1449 | 293 |
| 109 | 3300046678 | Ga0495599_0103068 | Ga0495599_0103068_351_1250 | 293 |
| 110 | 3300046683 | Ga0495658_0003812 | Ga0495658_0003812_2142_3041 | 293 |
| 111 | 3300046689 | Ga0495613_0018344 | Ga0495613_0018344_4306_5205 | 293 |
| 112 | 3300046689 | Ga0495613_0375863 | Ga0495613_0375863_28_927 | 293 |
| 113 | 3300046809 | Ga0495600_0063598 | Ga0495600_0063598_777_1676 | 293 |
| 114 | 3300047317 | Ga0495604_0096779 | Ga0495604_0096779_131_1030 | 293 |
| 115 | 3300047319 | Ga0495674_0043579 | Ga0495674_0043579_2733_3632 | 293 |
| 116 | 3300047319 | Ga0495674_0053375 | Ga0495674_0053375_1193_2092 | 293 |
| 117 | 3300047321 | Ga0495676_0059563 | Ga0495676_0059563_682_1581 | 293 |
| 118 | 3300047322 | Ga0495680_0006148 | Ga0495680_0006148_2001_2900 | 293 |
| 119 | 3300047322 | Ga0495680_0009837 | Ga0495680_0009837_6267_7166 | 293 |
| 120 | 3300047444 | Ga0495675_0202903 | Ga0495675_0202903_89_988 | 293 |
| 121 | 3300047471 | Ga0495684_0019570 | Ga0495684_0019570_3773_4672 | 293 |
| 122 | 3300047471 | Ga0495684_0096860 | Ga0495684_0096860_492_1391 | 293 |
| 123 | 3300047673 | Ga0495593_0010950 | Ga0495593_0010950_4063_4962 | 293 |
| 124 | 3300048903 | Ga0496100_0027848 | Ga0496100_0027848_1975_2874 | 293 |
| 125 | 3300048907 | Ga0496104_0136263 | Ga0496104_0136263_612_1511 | 293 |
| 126 | 3300048914 | Ga0496111_0167890 | Ga0496111_0167890_573_1472 | 293 |
| 127 | 3300048915 | Ga0496112_0443717 | Ga0496112_0443717_266_1165 | 293 |
| 128 | 3300048917 | Ga0496114_0062221 | Ga0496114_0062221_278_1177 | 293 |
| 129 | 3300053077 | Ga0495601_0047880 | Ga0495601_0047880_750_1649 | 293 |
| 130 | 3300053084 | Ga0495595_0009202 | Ga0495595_0009202_1463_2362 | 293 |
| 131 | 3300053085 | Ga0495619_0025632 | Ga0495619_0025632_1417_2316 | 293 |
| 132 | 3300053085 | Ga0495619_0034069 | Ga0495619_0034069_1347_2246 | 293 |
| 133 | 3300005435 | Ga0070714_100066741 | Ga0070714_1000667412 | 294 |
| 134 | 3300045976 | Ga0466967_0438244 | Ga0466967_0438244_152_1054 | 294 |
| 135 | 3300005327 | Ga0070658_10083661 | Ga0070658_100836612 | 297 |
| 136 | 3300028800 | Ga0265338_10005122 | Ga0265338_100051222 | 297 |
| 137 | 3300035410 | Ga0373924_0050144 | Ga0373924_0050144_522_1433 | 297 |
| 138 | 3300041410 | Ga0439461_0023094 | Ga0439461_0023094_217_1131 | 297 |
| 139 | 3300042156 | Ga0439446_0001453 | Ga0439446_0001453_2659_3573 | 297 |
| 140 | 3300045976 | Ga0466967_0156395 | Ga0466967_0156395_186_1097 | 297 |
| 141 | 3300045976 | Ga0466967_0273605 | Ga0466967_0273605_609_1520 | 297 |
| 142 | 3300046462 | Ga0495651_0073811 | Ga0495651_0073811_493_1404 | 297 |
| 143 | 3300046463 | Ga0495653_0041699 | Ga0495653_0041699_1288_2199 | 297 |
| 144 | 3300046511 | Ga0495608_0094669 | Ga0495608_0094669_390_1301 | 297 |
| 145 | 3300046663 | Ga0495635_0179944 | Ga0495635_0179944_34_945 | 297 |
| 146 | 3300046809 | Ga0495600_0060912 | Ga0495600_0060912_82_993 | 297 |
| 147 | 3300047322 | Ga0495680_0159215 | Ga0495680_0159215_698_1609 | 297 |
| 148 | 3300047471 | Ga0495684_0067193 | Ga0495684_0067193_445_1356 | 297 |
| 149 | 3300048907 | Ga0496104_0303130 | Ga0496104_0303130_376_1287 | 297 |
| 150 | 3300048913 | Ga0496110_0429811 | Ga0496110_0429811_249_1160 | 297 |
| 151 | 3300053085 | Ga0495619_0043174 | Ga0495619_0043174_1879_2790 | 297 |
| 152 | 3300005327 | Ga0070658_10070236 | Ga0070658_100702362 | 298 |
| 153 | 3300037312 | Ga0395899_0126231 | Ga0395899_0126231_807_1718 | 298 |
| 154 | 3300037466 | Ga0395898_0324264 | Ga0395898_0324264_69_980 | 298 |
| 155 | 3300038443 | Ga0395901_0017241 | Ga0395901_0017241_2099_3010 | 298 |
| 156 | 3300044694 | Ga0466963_0014151 | Ga0466963_0014151_329_1240 | 298 |
| 157 | 3300045836 | Ga0466958_0194223 | Ga0466958_0194223_333_1244 | 298 |
| 158 | 3300049581 | Ga0501047_0063760 | Ga0501047_0063760_653_1564 | 298 |
| 159 | 3300049588 | Ga0501072_0041825 | Ga0501072_0041825_1455_2366 | 298 |
| 160 | 3300049589 | Ga0501073_0054938 | Ga0501073_0054938_436_1347 | 298 |
| 161 | 3300049590 | Ga0501074_0016795 | Ga0501074_0016795_556_1467 | 298 |
| 162 | 3300049741 | Ga0501079_0052886 | Ga0501079_0052886_1415_2326 | 298 |
| 163 | 3300049742 | Ga0501080_0100483 | Ga0501080_0100483_1623_2534 | 298 |
| 164 | 3300049744 | Ga0501083_0003233 | Ga0501083_0003233_920_1831 | 298 |
| 165 | 3300054114 | Ga0501084_0084855 | Ga0501084_0084855_1697_2608 | 298 |
| 166 | 3300009177 | Ga0105248_10040098 | Ga0105248_100400983 | 299 |
| 167 | 3300044842 | Ga0466957_0148788 | Ga0466957_0148788_27_974 | 299 |
| 168 | 3300050513 | nmdc:mga0rr50_370238_c1 | nmdc:mga0rr50_370238_c1_14_913 | 299 |
| 169 | 3300005364 | Ga0070673_100009749 | Ga0070673_1000097493 | 300 |
| 170 | 3300005616 | Ga0068852_100052721 | Ga0068852_1000527211 | 303 |
| 171 | 3300009551 | Ga0105238_10071935 | Ga0105238_100719352 | 303 |
| 172 | 3300026041 | Ga0207639_10091690 | Ga0207639_100916902 | 303 |
| 173 | 3300049583 | Ga0501067_0262083 | Ga0501067_0262083_29_943 | 304 |
| 174 | 3300031731 | Ga0307405_10010189 | Ga0307405_100101894 | 305 |
| 175 | 3300009147 | Ga0114129_10004439 | Ga0114129_1000443915 | 306 |
| 176 | 3300050510 | nmdc:mga06r32_211931_c1 | nmdc:mga06r32_211931_c1_66_995 | 306 |
| 177 | 3300031548 | Ga0307408_100238458 | Ga0307408_1002384582 | 307 |
| 178 | 3300031731 | Ga0307405_10113022 | Ga0307405_101130222 | 307 |
| 179 | 3300031903 | Ga0307407_10056688 | Ga0307407_100566882 | 307 |
| 180 | 3300050515 | nmdc:mga0a205_15170_c1 | nmdc:mga0a205_15170_c1_3742_4758 | 307 |
| 181 | 3300009147 | Ga0114129_10012726 | Ga0114129_100127263 | 308 |
| 182 | 3300026089 | Ga0207648_10232549 | Ga0207648_102325492 | 312 |
| 183 | 3300005444 | Ga0070694_100024140 | Ga0070694_1000241402 | 313 |
| 184 | 3300026035 | Ga0207703_10215209 | Ga0207703_102152092 | 313 |
| 185 | 3300006358 | Ga0068871_100002742 | Ga0068871_1000027424 | 314 |
| 186 | 3300046471 | Ga0495650_0000398 | Ga0495650_0000398_16490_17494 | 314 |
| 187 | 3300009147 | Ga0114129_10378306 | Ga0114129_103783062 | 315 |
| 188 | 3300005366 | Ga0070659_100188630 | Ga0070659_1001886302 | 316 |
| 189 | 3300025932 | Ga0207690_10036795 | Ga0207690_100367952 | 316 |
| 190 | 3300005440 | Ga0070705_100113329 | Ga0070705_1001133291 | 317 |
| 191 | 3300009148 | Ga0105243_10341515 | Ga0105243_103415152 | 317 |
| 192 | 3300026075 | Ga0207708_10391927 | Ga0207708_103919271 | 317 |
| 193 | 3300025913 | Ga0207695_10316554 | Ga0207695_103165542 | 318 |
| 194 | 3300005329 | Ga0070683_100009004 | Ga0070683_1000090042 | 319 |
| 195 | 3300006051 | Ga0075364_10051972 | Ga0075364_100519722 | 319 |
| 196 | 3300025944 | Ga0207661_10043650 | Ga0207661_100436502 | 319 |
| 197 | 3300046543 | Ga0495645_0000023 | Ga0495645_0000023_104279_105238 | 319 |
| 198 | 3300046678 | Ga0495599_0159430 | Ga0495599_0159430_269_1228 | 319 |
| 199 | 3300050491 | nmdc:mga00v17_20572_c1 | nmdc:mga00v17_20572_c1_683_1696 | 319 |
| 200 | 3300005456 | Ga0070678_100062395 | Ga0070678_1000623951 | 320 |
| 201 | 3300031733 | Ga0316577_10061688 | Ga0316577_100616881 | 320 |
| 202 | 3300048917 | Ga0496114_0048228 | Ga0496114_0048228_1048_2064 | 320 |
| 203 | 3300006038 | Ga0075365_10057675 | Ga0075365_100576751 | 321 |
| 204 | 3300006042 | Ga0075368_10026605 | Ga0075368_100266053 | 321 |
| 205 | 3300006177 | Ga0075362_10028192 | Ga0075362_100281923 | 321 |
| 206 | 3300006178 | Ga0075367_10048695 | Ga0075367_100486951 | 321 |
| 207 | 3300036401 | Ga0373937_0002273 | Ga0373937_0002273_14849_15862 | 321 |
| 208 | 3300037471 | Ga0395905_0118230 | Ga0395905_0118230_902_1918 | 321 |
| 209 | 3300038443 | Ga0395901_0027704 | Ga0395901_0027704_4735_5751 | 321 |
| 210 | 3300050489 | nmdc:mga03683_11191_c1 | nmdc:mga03683_11191_c1_2066_3079 | 321 |
| 211 | 3300050492 | nmdc:mga0yw44_47991_c1 | nmdc:mga0yw44_47991_c1_1247_2260 | 321 |
| 212 | 3300050493 | nmdc:mga0k408_60061_c1 | nmdc:mga0k408_60061_c1_294_1307 | 321 |
| 213 | 3300050493 | nmdc:mga0k408_7107_c1 | nmdc:mga0k408_7107_c1_205_1218 | 321 |
| 214 | 3300053077 | Ga0495601_0074925 | Ga0495601_0074925_928_1941 | 321 |
| 215 | 3300002077 | JGI24744J21845_10019466 | JGI24744J21845_100194661 | 322 |
| 216 | 3300005293 | Ga0065715_10107788 | Ga0065715_101077882 | 322 |
| 217 | 3300005329 | Ga0070683_100126998 | Ga0070683_1001269983 | 322 |
| 218 | 3300005331 | Ga0070670_100012891 | Ga0070670_1000128916 | 322 |
| 219 | 3300005335 | Ga0070666_10018735 | Ga0070666_100187355 | 322 |
| 220 | 3300005338 | Ga0068868_100157930 | Ga0068868_1001579302 | 322 |
| 221 | 3300005344 | Ga0070661_100130632 | Ga0070661_1001306321 | 322 |
| 222 | 3300005366 | Ga0070659_100100460 | Ga0070659_1001004602 | 322 |
| 223 | 3300005455 | Ga0070663_100073764 | Ga0070663_1000737643 | 322 |
| 224 | 3300005457 | Ga0070662_100120176 | Ga0070662_1001201762 | 322 |
| 225 | 3300005471 | Ga0070698_100059606 | Ga0070698_1000596061 | 322 |
| 226 | 3300005578 | Ga0068854_100039869 | Ga0068854_1000398693 | 322 |
| 227 | 3300005617 | Ga0068859_100490538 | Ga0068859_1004905381 | 322 |
| 228 | 3300006871 | Ga0075434_100133581 | Ga0075434_1001335814 | 322 |
| 229 | 3300006931 | Ga0097620_100490545 | Ga0097620_1004905452 | 322 |
| 230 | 3300007076 | Ga0075435_100011606 | Ga0075435_1000116062 | 322 |
| 231 | 3300025315 | Ga0207697_10000602 | Ga0207697_100006026 | 322 |
| 232 | 3300025903 | Ga0207680_10018805 | Ga0207680_100188052 | 322 |
| 233 | 3300025913 | Ga0207695_10143191 | Ga0207695_101431912 | 322 |
| 234 | 3300025918 | Ga0207662_10183241 | Ga0207662_101832412 | 322 |
| 235 | 3300025925 | Ga0207650_10066216 | Ga0207650_100662162 | 322 |
| 236 | 3300025932 | Ga0207690_10167795 | Ga0207690_101677952 | 322 |
| 237 | 3300025940 | Ga0207691_10133895 | Ga0207691_101338951 | 322 |
| 238 | 3300025944 | Ga0207661_10164942 | Ga0207661_101649421 | 322 |
| 239 | 3300026023 | Ga0207677_10245667 | Ga0207677_102456671 | 322 |
| 240 | 3300032002 | Ga0307416_100099938 | Ga0307416_1000999381 | 322 |
| 241 | 3300032002 | Ga0307416_100735449 | Ga0307416_1007354491 | 322 |
| 242 | 3300032005 | Ga0307411_10021439 | Ga0307411_100214392 | 322 |
| 243 | 3300032126 | Ga0307415_100140245 | Ga0307415_1001402452 | 322 |
| 244 | 3300046472 | Ga0495580_0092053 | Ga0495580_0092053_607_1617 | 322 |
| 245 | 3300048911 | Ga0496108_0041466 | Ga0496108_0041466_1474_2499 | 322 |
| 246 | 3300005468 | Ga0070707_100031363 | Ga0070707_1000313632 | 323 |
| 247 | 3300005518 | Ga0070699_100035557 | Ga0070699_1000355571 | 323 |
| 248 | 3300005518 | Ga0070699_100192635 | Ga0070699_1001926352 | 323 |
| 249 | 3300005536 | Ga0070697_100025048 | Ga0070697_1000250482 | 323 |
| 250 | 3300005719 | Ga0068861_100019169 | Ga0068861_1000191692 | 323 |
| 251 | 3300006173 | Ga0070716_100170906 | Ga0070716_1001709062 | 323 |
| 252 | 3300009147 | Ga0114129_10063845 | Ga0114129_100638454 | 323 |
| 253 | 3300014326 | Ga0157380_10205966 | Ga0157380_102059662 | 323 |
| 254 | 3300014326 | Ga0157380_10230286 | Ga0157380_102302862 | 323 |
| 255 | 3300025922 | Ga0207646_10020313 | Ga0207646_100203135 | 323 |
| 256 | 3300026118 | Ga0207675_100043408 | Ga0207675_1000434082 | 323 |
| 257 | 3300042436 | Ga0439435_0000202 | Ga0439435_0000202_5921_6937 | 323 |
| 258 | 3300050512 | nmdc:mga0n895_95388_c1 | nmdc:mga0n895_95388_c1_163_1179 | 323 |
| 259 | 3300050514 | nmdc:mga08x19_18246_c1 | nmdc:mga08x19_18246_c1_2513_3529 | 323 |
| 260 | 3300005339 | Ga0070660_100069564 | Ga0070660_1000695642 | 324 |
| 261 | 3300005445 | Ga0070708_100174480 | Ga0070708_1001744803 | 324 |
| 262 | 3300005456 | Ga0070678_100036127 | Ga0070678_1000361272 | 324 |
| 263 | 3300005549 | Ga0070704_100007453 | Ga0070704_1000074533 | 324 |
| 264 | 3300006038 | Ga0075365_10087648 | Ga0075365_100876482 | 324 |
| 265 | 3300006051 | Ga0075364_10162599 | Ga0075364_101625991 | 324 |
| 266 | 3300006178 | Ga0075367_10024190 | Ga0075367_100241902 | 324 |
| 267 | 3300006353 | Ga0075370_10003272 | Ga0075370_100032725 | 324 |
| 268 | 3300006844 | Ga0075428_100004191 | Ga0075428_1000041914 | 324 |
| 269 | 3300006844 | Ga0075428_100030614 | Ga0075428_1000306145 | 324 |
| 270 | 3300006844 | Ga0075428_100061064 | Ga0075428_1000610641 | 324 |
| 271 | 3300006846 | Ga0075430_100004048 | Ga0075430_1000040484 | 324 |
| 272 | 3300006846 | Ga0075430_100014030 | Ga0075430_1000140303 | 324 |
| 273 | 3300006846 | Ga0075430_100120550 | Ga0075430_1001205502 | 324 |
| 274 | 3300006847 | Ga0075431_100002803 | Ga0075431_1000028038 | 324 |
| 275 | 3300006847 | Ga0075431_100276290 | Ga0075431_1002762902 | 324 |
| 276 | 3300006847 | Ga0075431_100442968 | Ga0075431_1004429682 | 324 |
| 277 | 3300006880 | Ga0075429_100001043 | Ga0075429_1000010438 | 324 |
| 278 | 3300006880 | Ga0075429_100003470 | Ga0075429_1000034706 | 324 |
| 279 | 3300009094 | Ga0111539_10000118 | Ga0111539_1000011834 | 324 |
| 280 | 3300009094 | Ga0111539_10425324 | Ga0111539_104253241 | 324 |
| 281 | 3300009147 | Ga0114129_10000324 | Ga0114129_1000032439 | 324 |
| 282 | 3300009147 | Ga0114129_10027164 | Ga0114129_100271648 | 324 |
| 283 | 3300009147 | Ga0114129_10118576 | Ga0114129_101185763 | 324 |
| 284 | 3300025922 | Ga0207646_10000495 | Ga0207646_1000049540 | 324 |
| 285 | 3300027907 | Ga0207428_10000967 | Ga0207428_1000096719 | 324 |
| 286 | 3300031548 | Ga0307408_100015965 | Ga0307408_1000159655 | 324 |
| 287 | 3300031665 | Ga0316575_10027668 | Ga0316575_100276681 | 324 |
| 288 | 3300031901 | Ga0307406_10149598 | Ga0307406_101495982 | 324 |
| 289 | 3300031901 | Ga0307406_10381575 | Ga0307406_103815751 | 324 |
| 290 | 3300032002 | Ga0307416_100157291 | Ga0307416_1001572911 | 324 |
| 291 | 3300032002 | Ga0307416_100198601 | Ga0307416_1001986012 | 324 |
| 292 | 3300032126 | Ga0307415_100348365 | Ga0307415_1003483651 | 324 |
| 293 | 3300035398 | Ga0316574_0010860 | Ga0316574_0010860_4077_5093 | 324 |
| 294 | 3300042007 | Ga0439449_0032473 | Ga0439449_0032473_161_1177 | 324 |
| 295 | 3300042461 | Ga0439460_0019865 | Ga0439460_0019865_84_1100 | 324 |
| 296 | 3300042993 | Ga0439440_0010671 | Ga0439440_0010671_888_1904 | 324 |
| 297 | 3300047318 | Ga0495636_0034908 | Ga0495636_0034908_26_1000 | 324 |
| 298 | 3300048917 | Ga0496114_0238574 | Ga0496114_0238574_20_1036 | 324 |
| 299 | 3300050492 | nmdc:mga0yw44_240855_c1 | nmdc:mga0yw44_240855_c1_64_1077 | 324 |
| 300 | 3300050495 | nmdc:mga04h51_27638_c1 | nmdc:mga04h51_27638_c1_337_1350 | 324 |
| 301 | 3300050496 | nmdc:mga07m45_26886_c1 | nmdc:mga07m45_26886_c1_1326_2339 | 324 |
| 302 | 3300050507 | nmdc:mga05p37_3009_c1 | nmdc:mga05p37_3009_c1_15648_16664 | 324 |
| 303 | 3300050507 | nmdc:mga05p37_67193_c1 | nmdc:mga05p37_67193_c1_3118_4134 | 324 |
| 304 | 3300050508 | nmdc:mga09592_16509_c1 | nmdc:mga09592_16509_c1_674_1690 | 324 |
| 305 | 3300050508 | nmdc:mga09592_4546_c1 | nmdc:mga09592_4546_c1_2041_3057 | 324 |
| 306 | 3300050509 | nmdc:mga0qj67_108582_c1 | nmdc:mga0qj67_108582_c1_292_1308 | 324 |
| 307 | 3300050509 | nmdc:mga0qj67_226406_c1 | nmdc:mga0qj67_226406_c1_196_1212 | 324 |
| 308 | 3300050509 | nmdc:mga0qj67_3398_c1 | nmdc:mga0qj67_3398_c1_8509_9525 | 324 |
| 309 | 3300050510 | nmdc:mga06r32_4718_c1 | nmdc:mga06r32_4718_c1_5176_6192 | 324 |
| 310 | 3300050510 | nmdc:mga06r32_71529_c1 | nmdc:mga06r32_71529_c1_969_1985 | 324 |
| 311 | 3300050511 | nmdc:mga08y16_131_c1 | nmdc:mga08y16_131_c1_11108_12124 | 324 |
| 312 | 3300059424 | Ga0590075_010254 | Ga0590075_010254_86_1102 | 324 |
| 313 | 3300005293 | Ga0065715_10021386 | Ga0065715_100213861 | 325 |
| 314 | 3300005343 | Ga0070687_100092226 | Ga0070687_1000922262 | 325 |
| 315 | 3300005353 | Ga0070669_100000692 | Ga0070669_10000069219 | 325 |
| 316 | 3300005365 | Ga0070688_100246475 | Ga0070688_1002464751 | 325 |
| 317 | 3300005457 | Ga0070662_100229603 | Ga0070662_1002296031 | 325 |
| 318 | 3300005577 | Ga0068857_100028746 | Ga0068857_1000287462 | 325 |
| 319 | 3300005617 | Ga0068859_100413302 | Ga0068859_1004133022 | 325 |
| 320 | 3300005840 | Ga0068870_10020276 | Ga0068870_100202762 | 325 |
| 321 | 3300006844 | Ga0075428_100456145 | Ga0075428_1004561452 | 325 |
| 322 | 3300006852 | Ga0075433_10075895 | Ga0075433_100758952 | 325 |
| 323 | 3300006871 | Ga0075434_100005682 | Ga0075434_1000056829 | 325 |
| 324 | 3300006931 | Ga0097620_100413316 | Ga0097620_1004133162 | 325 |
| 325 | 3300009094 | Ga0111539_10000587 | Ga0111539_100005871 | 325 |
| 326 | 3300009553 | Ga0105249_10001518 | Ga0105249_100015182 | 325 |
| 327 | 3300025923 | Ga0207681_10038314 | Ga0207681_100383142 | 325 |
| 328 | 3300025961 | Ga0207712_10076502 | Ga0207712_100765022 | 325 |
| 329 | 3300026116 | Ga0207674_10039188 | Ga0207674_100391885 | 325 |
| 330 | 3300027907 | Ga0207428_10057404 | Ga0207428_100574042 | 325 |
| 331 | 3300034820 | Ga0373959_0000891 | Ga0373959_0000891_154_1173 | 325 |
| 332 | 3300044712 | Ga0453684_0144569 | Ga0453684_0144569_565_1581 | 325 |
| 333 | 3300049581 | Ga0501047_0139105 | Ga0501047_0139105_505_1518 | 325 |
| 334 | 3300049742 | Ga0501080_0148377 | Ga0501080_0148377_597_1610 | 325 |
| 335 | 3300050511 | nmdc:mga08y16_22528_c1 | nmdc:mga08y16_22528_c1_1597_2613 | 325 |
| 336 | 3300050511 | nmdc:mga08y16_71797_c1 | nmdc:mga08y16_71797_c1_1430_2446 | 325 |
| 337 | 3300050512 | nmdc:mga0n895_15302_c1 | nmdc:mga0n895_15302_c1_1466_2482 | 325 |
| 338 | 3300050513 | nmdc:mga0rr50_21272_c1 | nmdc:mga0rr50_21272_c1_1657_2673 | 325 |
| 339 | 3300050515 | nmdc:mga0a205_32599_c1 | nmdc:mga0a205_32599_c1_755_1771 | 325 |
| 340 | 3300050515 | nmdc:mga0a205_382905_c1 | nmdc:mga0a205_382905_c1_244_1260 | 325 |
| 341 | 3300006844 | Ga0075428_100032575 | Ga0075428_1000325751 | 326 |
| 342 | 3300009147 | Ga0114129_10144348 | Ga0114129_101443483 | 326 |
| 343 | 3300049588 | Ga0501072_0001717 | Ga0501072_0001717_4571_5587 | 326 |
| 344 | 3300049590 | Ga0501074_0163934 | Ga0501074_0163934_351_1367 | 326 |
| 345 | 3300049591 | Ga0501075_0031480 | Ga0501075_0031480_2090_3106 | 326 |
| 346 | 3300049592 | Ga0501076_0103367 | Ga0501076_0103367_50_1066 | 326 |
| 347 | 3300049741 | Ga0501079_0076827 | Ga0501079_0076827_80_1096 | 326 |
| 348 | 3300049743 | Ga0501081_0067909 | Ga0501081_0067909_741_1757 | 326 |
| 349 | 3300049743 | Ga0501081_0160513 | Ga0501081_0160513_33_1049 | 326 |
| 350 | 3300049824 | Ga0501045_0047365 | Ga0501045_0047365_471_1487 | 326 |
| 351 | 3300050507 | nmdc:mga05p37_287962_c1 | nmdc:mga05p37_287962_c1_33_1049 | 326 |
| 352 | 3300050511 | nmdc:mga08y16_118832_c1 | nmdc:mga08y16_118832_c1_1540_2556 | 326 |
| 353 | 3300059424 | Ga0590075_000007 | Ga0590075_000007_11706_12722 | 326 |
| 354 | 3300059426 | Ga0590077_000017 | Ga0590077_000017_21169_22185 | 326 |
| 355 | iso_pu_bacteria | 2738543011 | 2739237312 | 326 |
| 356 | iso_pu_bacteria | 2889300758 | 2889302453 | 326 |
| 357 | iso_pu_bacteria | 2939743619 | 2939748975 | 326 |
| 358 | 3300014326 | Ga0157380_10378357 | Ga0157380_103783571 | 327 |
| 359 | 3300005614 | Ga0068856_100140285 | Ga0068856_1001402853 | 328 |
| 360 | 3300006844 | Ga0075428_100349812 | Ga0075428_1003498122 | 328 |
| 361 | 3300009147 | Ga0114129_10154143 | Ga0114129_101541432 | 328 |
| 362 | 3300009148 | Ga0105243_10000050 | Ga0105243_1000005057 | 328 |
| 363 | 3300009176 | Ga0105242_10000654 | Ga0105242_1000065418 | 328 |
| 364 | 3300025934 | Ga0207686_10000028 | Ga0207686_1000002857 | 328 |
| 365 | 3300025935 | Ga0207709_10000082 | Ga0207709_1000008257 | 328 |
| 366 | 3300050507 | nmdc:mga05p37_171351_c1 | nmdc:mga05p37_171351_c1_1417_2433 | 328 |
| 367 | 3300031665 | Ga0316575_10002415 | Ga0316575_100024154 | 329 |
| 368 | 3300031727 | Ga0316576_10036274 | Ga0316576_100362741 | 329 |
| 369 | 3300031728 | Ga0316578_10052553 | Ga0316578_100525531 | 329 |
| 370 | 3300032005 | Ga0307411_10078704 | Ga0307411_100787042 | 329 |
| 371 | 3300032133 | Ga0316583_10063119 | Ga0316583_100631191 | 329 |
| 372 | 3300035398 | Ga0316574_0003944 | Ga0316574_0003944_1256_2281 | 329 |
| 373 | 3300036712 | Ga0316584_0065904 | Ga0316584_0065904_796_1821 | 329 |
| 374 | 3300005518 | Ga0070699_100002650 | Ga0070699_10000265013 | 331 |
| 375 | 3300005439 | Ga0070711_100001613 | Ga0070711_10000161310 | 332 |
| 376 | 3300025916 | Ga0207663_10000403 | Ga0207663_100004039 | 332 |
| 377 | 3300044901 | Ga0466960_0000033 | Ga0466960_0000033_24813_25817 | 332 |
| 378 | 3300046463 | Ga0495653_0005657 | Ga0495653_0005657_163_1161 | 332 |
| 379 | 3300046514 | Ga0495618_0000512 | Ga0495618_0000512_7739_8737 | 332 |
| 380 | 3300049571 | Ga0501034_0021166 | Ga0501034_0021166_4832_5836 | 332 |
| 381 | 3300050507 | nmdc:mga05p37_257403_c1 | nmdc:mga05p37_257403_c1_531_1592 | 332 |
| 382 | 3300053077 | Ga0495601_0001652 | Ga0495601_0001652_10314_11324 | 332 |
| 383 | 3300053078 | Ga0495612_0000673 | Ga0495612_0000673_4680_5690 | 332 |
| 384 | 3300025942 | Ga0207689_10006436 | Ga0207689_100064366 | 333 |
| 385 | 3300006163 | Ga0070715_10000023 | Ga0070715_1000002344 | 334 |
| 386 | 3300025905 | Ga0207685_10000002 | Ga0207685_1000000260 | 334 |
| 387 | 3300028800 | Ga0265338_10068514 | Ga0265338_100685142 | 334 |
| 388 | 3300005336 | Ga0070680_100076564 | Ga0070680_1000765642 | 335 |
| 389 | 3300005440 | Ga0070705_100050886 | Ga0070705_1000508863 | 335 |
| 390 | 3300005518 | Ga0070699_100000701 | Ga0070699_10000070121 | 335 |
| 391 | 3300005545 | Ga0070695_100079061 | Ga0070695_1000790612 | 335 |
| 392 | 3300005546 | Ga0070696_100004465 | Ga0070696_1000044658 | 335 |
| 393 | 3300009094 | Ga0111539_10448275 | Ga0111539_104482752 | 335 |
| 394 | 3300009147 | Ga0114129_10509987 | Ga0114129_105099872 | 335 |
| 395 | 3300025939 | Ga0207665_10051457 | Ga0207665_100514572 | 335 |
| 396 | 3300035118 | Ga0373954_0004504 | Ga0373954_0004504_1287_2294 | 335 |
| 397 | 3300035119 | Ga0373956_0012733 | Ga0373956_0012733_76_1083 | 335 |
| 398 | 3300035695 | Ga0373927_0263543 | Ga0373927_0263543_17_1024 | 335 |
| 399 | 3300036401 | Ga0373937_0002585 | Ga0373937_0002585_12697_13704 | 335 |
| 400 | 3300050511 | nmdc:mga08y16_329880_c1 | nmdc:mga08y16_329880_c1_130_1143 | 335 |
| 401 | 3300050512 | nmdc:mga0n895_256769_c1 | nmdc:mga0n895_256769_c1_470_1507 | 335 |
| 402 | 3300050515 | nmdc:mga0a205_113883_c1 | nmdc:mga0a205_113883_c1_676_1713 | 335 |
| 403 | 3300053085 | Ga0495619_0069762 | Ga0495619_0069762_1223_2230 | 335 |
| 404 | 3300005328 | Ga0070676_10108670 | Ga0070676_101086702 | 336 |
| 405 | 3300005536 | Ga0070697_100130301 | Ga0070697_1001303012 | 336 |
| 406 | 3300007076 | Ga0075435_100218404 | Ga0075435_1002184042 | 336 |
| 407 | 3300007265 | Ga0099794_10018137 | Ga0099794_100181373 | 336 |
| 408 | 3300009094 | Ga0111539_10024253 | Ga0111539_100242532 | 336 |
| 409 | 3300025907 | Ga0207645_10095993 | Ga0207645_100959931 | 336 |
| 410 | 3300025923 | Ga0207681_10225163 | Ga0207681_102251631 | 336 |
| 411 | 3300025933 | Ga0207706_10207539 | Ga0207706_102075392 | 336 |
| 412 | 3300025933 | Ga0207706_10228975 | Ga0207706_102289752 | 336 |
| 413 | 3300025940 | Ga0207691_10115378 | Ga0207691_101153782 | 336 |
| 414 | 3300026118 | Ga0207675_100326816 | Ga0207675_1003268162 | 336 |
| 415 | 3300027671 | Ga0209588_1037184 | Ga0209588_10371842 | 336 |
| 416 | 3300035725 | Ga0373947_0049295 | Ga0373947_0049295_78_1088 | 336 |
| 417 | 3300037068 | Ga0373925_0207331 | Ga0373925_0207331_220_1230 | 336 |
| 418 | 3300050511 | nmdc:mga08y16_58929_c1 | nmdc:mga08y16_58929_c1_1461_2474 | 336 |
| 419 | 3300050511 | nmdc:mga08y16_88974_c1 | nmdc:mga08y16_88974_c1_921_1934 | 336 |
| 420 | 3300050513 | nmdc:mga0rr50_194490_c1 | nmdc:mga0rr50_194490_c1_154_1167 | 336 |
| 421 | 3300005436 | Ga0070713_100004983 | Ga0070713_1000049837 | 337 |
| 422 | 3300005614 | Ga0068856_100123819 | Ga0068856_1001238192 | 337 |
| 423 | 3300006028 | Ga0070717_10021528 | Ga0070717_100215284 | 337 |
| 424 | 3300006028 | Ga0070717_10065030 | Ga0070717_100650303 | 337 |
| 425 | 3300006051 | Ga0075364_10080680 | Ga0075364_100806802 | 337 |
| 426 | 3300006237 | Ga0097621_100000627 | Ga0097621_1000006277 | 337 |
| 427 | 3300009093 | Ga0105240_10197488 | Ga0105240_101974881 | 337 |
| 428 | 3300009093 | Ga0105240_10219951 | Ga0105240_102199512 | 337 |
| 429 | 3300013307 | Ga0157372_10165574 | Ga0157372_101655742 | 337 |
| 430 | 3300014969 | Ga0157376_10083927 | Ga0157376_100839273 | 337 |
| 431 | 3300020070 | Ga0206356_10120415 | Ga0206356_101204151 | 337 |
| 432 | 3300025928 | Ga0207700_10062515 | Ga0207700_100625152 | 337 |
| 433 | 3300025949 | Ga0207667_10033136 | Ga0207667_100331362 | 337 |
| 434 | 3300031691 | Ga0316579_10014160 | Ga0316579_100141603 | 337 |
| 435 | 3300031733 | Ga0316577_10000156 | Ga0316577_100001564 | 337 |
| 436 | 3300032139 | Ga0316580_10012217 | Ga0316580_100122173 | 337 |
| 437 | 3300034816 | Ga0373930_0000244 | Ga0373930_0000244_2618_3637 | 337 |
| 438 | 3300034819 | Ga0373958_0009078 | Ga0373958_0009078_441_1460 | 337 |
| 439 | 3300035091 | Ga0373951_0000775 | Ga0373951_0000775_4995_6014 | 337 |
| 440 | 3300036647 | Ga0316582_0006844 | Ga0316582_0006844_584_1597 | 337 |
| 441 | 3300036712 | Ga0316584_0001379 | Ga0316584_0001379_4911_5924 | 337 |
| 442 | 3300037588 | Ga0316581_0043047 | Ga0316581_0043047_164_1177 | 337 |
| 443 | 3300042876 | Ga0451577_0005551 | Ga0451577_0005551_8150_9169 | 337 |
| 444 | 3300049571 | Ga0501034_0039374 | Ga0501034_0039374_946_1959 | 337 |
| 445 | 3300049588 | Ga0501072_0016271 | Ga0501072_0016271_4236_5249 | 337 |
| 446 | 3300050507 | nmdc:mga05p37_89322_c1 | nmdc:mga05p37_89322_c1_2641_3654 | 337 |
| 447 | 3300001432 | JGI24034J14986_100123 | JGI24034J14986_1001235 | 338 |
| 448 | 3300002074 | JGI24748J21848_1000035 | JGI24748J21848_100003536 | 338 |
| 449 | 3300002239 | JGI24034J26672_10000039 | JGI24034J26672_1000003936 | 338 |
| 450 | 3300005290 | Ga0065712_10016444 | Ga0065712_100164442 | 338 |
| 451 | 3300005295 | Ga0065707_10167853 | Ga0065707_101678532 | 338 |
| 452 | 3300005330 | Ga0070690_100088022 | Ga0070690_1000880222 | 338 |
| 453 | 3300005331 | Ga0070670_100022802 | Ga0070670_1000228025 | 338 |
| 454 | 3300005331 | Ga0070670_100079114 | Ga0070670_1000791141 | 338 |
| 455 | 3300005331 | Ga0070670_100319054 | Ga0070670_1003190542 | 338 |
| 456 | 3300005364 | Ga0070673_100109953 | Ga0070673_1001099533 | 338 |
| 457 | 3300005406 | Ga0070703_10000179 | Ga0070703_100001793 | 338 |
| 458 | 3300005406 | Ga0070703_10011176 | Ga0070703_100111763 | 338 |
| 459 | 3300005439 | Ga0070711_100113992 | Ga0070711_1001139922 | 338 |
| 460 | 3300005440 | Ga0070705_100092769 | Ga0070705_1000927692 | 338 |
| 461 | 3300005441 | Ga0070700_100000645 | Ga0070700_10000064511 | 338 |
| 462 | 3300005445 | Ga0070708_100234531 | Ga0070708_1002345311 | 338 |
| 463 | 3300005445 | Ga0070708_100409759 | Ga0070708_1004097591 | 338 |
| 464 | 3300005459 | Ga0068867_100171589 | Ga0068867_1001715891 | 338 |
| 465 | 3300005467 | Ga0070706_100061376 | Ga0070706_1000613762 | 338 |
| 466 | 3300005467 | Ga0070706_100062204 | Ga0070706_1000622043 | 338 |
| 467 | 3300005467 | Ga0070706_100073573 | Ga0070706_1000735734 | 338 |
| 468 | 3300005468 | Ga0070707_100000108 | Ga0070707_10000010826 | 338 |
| 469 | 3300005468 | Ga0070707_100053514 | Ga0070707_1000535142 | 338 |
| 470 | 3300005468 | Ga0070707_100127268 | Ga0070707_1001272683 | 338 |
| 471 | 3300005468 | Ga0070707_100166555 | Ga0070707_1001665552 | 338 |
| 472 | 3300005471 | Ga0070698_100000179 | Ga0070698_1000001798 | 338 |
| 473 | 3300005471 | Ga0070698_100123779 | Ga0070698_1001237793 | 338 |
| 474 | 3300005471 | Ga0070698_100234608 | Ga0070698_1002346082 | 338 |
| 475 | 3300005518 | Ga0070699_100064415 | Ga0070699_1000644153 | 338 |
| 476 | 3300005518 | Ga0070699_100149408 | Ga0070699_1001494081 | 338 |
| 477 | 3300005535 | Ga0070684_100000994 | Ga0070684_10000099418 | 338 |
| 478 | 3300005536 | Ga0070697_100005855 | Ga0070697_1000058557 | 338 |
| 479 | 3300005536 | Ga0070697_100009508 | Ga0070697_1000095086 | 338 |
| 480 | 3300005536 | Ga0070697_100049853 | Ga0070697_1000498531 | 338 |
| 481 | 3300005536 | Ga0070697_100053847 | Ga0070697_1000538472 | 338 |
| 482 | 3300005544 | Ga0070686_100001728 | Ga0070686_10000172811 | 338 |
| 483 | 3300005544 | Ga0070686_100006775 | Ga0070686_1000067756 | 338 |
| 484 | 3300005546 | Ga0070696_100008307 | Ga0070696_1000083074 | 338 |
| 485 | 3300005549 | Ga0070704_100032316 | Ga0070704_1000323164 | 338 |
| 486 | 3300005549 | Ga0070704_100247730 | Ga0070704_1002477302 | 338 |
| 487 | 3300005549 | Ga0070704_100277939 | Ga0070704_1002779392 | 338 |
| 488 | 3300005564 | Ga0070664_100001242 | Ga0070664_1000012427 | 338 |
| 489 | 3300005577 | Ga0068857_100088454 | Ga0068857_1000884542 | 338 |
| 490 | 3300005578 | Ga0068854_100104616 | Ga0068854_1001046163 | 338 |
| 491 | 3300005578 | Ga0068854_100129411 | Ga0068854_1001294112 | 338 |
| 492 | 3300005617 | Ga0068859_100309459 | Ga0068859_1003094593 | 338 |
| 493 | 3300005718 | Ga0068866_10008102 | Ga0068866_100081025 | 338 |
| 494 | 3300005719 | Ga0068861_100027459 | Ga0068861_1000274593 | 338 |
| 495 | 3300005842 | Ga0068858_100000053 | Ga0068858_10000005386 | 338 |
| 496 | 3300005842 | Ga0068858_100018636 | Ga0068858_1000186362 | 338 |
| 497 | 3300005842 | Ga0068858_100114093 | Ga0068858_1001140932 | 338 |
| 498 | 3300005843 | Ga0068860_100270015 | Ga0068860_1002700152 | 338 |
| 499 | 3300005844 | Ga0068862_100003050 | Ga0068862_1000030503 | 338 |
| 500 | 3300005981 | Ga0081538_10109519 | Ga0081538_101095191 | 338 |
| 501 | 3300006173 | Ga0070716_100000003 | Ga0070716_100000003214 | 338 |
| 502 | 3300006237 | Ga0097621_100219544 | Ga0097621_1002195442 | 338 |
| 503 | 3300006844 | Ga0075428_100416467 | Ga0075428_1004164671 | 338 |
| 504 | 3300006846 | Ga0075430_100147128 | Ga0075430_1001471282 | 338 |
| 505 | 3300006852 | Ga0075433_10048060 | Ga0075433_100480602 | 338 |
| 506 | 3300006871 | Ga0075434_100123851 | Ga0075434_1001238512 | 338 |
| 507 | 3300006880 | Ga0075429_100352036 | Ga0075429_1003520362 | 338 |
| 508 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002207 | 338 |
| 509 | 3300006914 | Ga0075436_100023507 | Ga0075436_1000235073 | 338 |
| 510 | 3300006931 | Ga0097620_100002186 | Ga0097620_1000021869 | 338 |
| 511 | 3300006931 | Ga0097620_100309429 | Ga0097620_1003094293 | 338 |
| 512 | 3300007076 | Ga0075435_100000776 | Ga0075435_10000077615 | 338 |
| 513 | 3300007265 | Ga0099794_10143517 | Ga0099794_101435171 | 338 |
| 514 | 3300009093 | Ga0105240_10204113 | Ga0105240_102041132 | 338 |
| 515 | 3300009094 | Ga0111539_10001564 | Ga0111539_100015647 | 338 |
| 516 | 3300009094 | Ga0111539_10443895 | Ga0111539_104438952 | 338 |
| 517 | 3300009101 | Ga0105247_10000052 | Ga0105247_1000005233 | 338 |
| 518 | 3300009147 | Ga0114129_10017723 | Ga0114129_100177236 | 338 |
| 519 | 3300009147 | Ga0114129_10045764 | Ga0114129_100457642 | 338 |
| 520 | 3300009148 | Ga0105243_10000214 | Ga0105243_1000021431 | 338 |
| 521 | 3300009148 | Ga0105243_10254408 | Ga0105243_102544083 | 338 |
| 522 | 3300009174 | Ga0105241_10113329 | Ga0105241_101133292 | 338 |
| 523 | 3300009176 | Ga0105242_10000811 | Ga0105242_100008119 | 338 |
| 524 | 3300009176 | Ga0105242_10304341 | Ga0105242_103043412 | 338 |
| 525 | 3300009177 | Ga0105248_10034775 | Ga0105248_100347753 | 338 |
| 526 | 3300009177 | Ga0105248_10226585 | Ga0105248_102265851 | 338 |
| 527 | 3300009551 | Ga0105238_10000043 | Ga0105238_10000043117 | 338 |
| 528 | 3300009553 | Ga0105249_10097360 | Ga0105249_100973602 | 338 |
| 529 | 3300009553 | Ga0105249_10196750 | Ga0105249_101967502 | 338 |
| 530 | 3300010375 | Ga0105239_10016176 | Ga0105239_100161767 | 338 |
| 531 | 3300013297 | Ga0157378_10000026 | Ga0157378_100000269 | 338 |
| 532 | 3300013297 | Ga0157378_10005697 | Ga0157378_100056976 | 338 |
| 533 | 3300013297 | Ga0157378_10008203 | Ga0157378_1000820310 | 338 |
| 534 | 3300013297 | Ga0157378_10025930 | Ga0157378_100259306 | 338 |
| 535 | 3300013297 | Ga0157378_10047230 | Ga0157378_100472302 | 338 |
| 536 | 3300013306 | Ga0163162_10017085 | Ga0163162_100170856 | 338 |
| 537 | 3300013308 | Ga0157375_10005428 | Ga0157375_100054289 | 338 |
| 538 | 3300014326 | Ga0157380_10194069 | Ga0157380_101940692 | 338 |
| 539 | 3300017792 | Ga0163161_10215579 | Ga0163161_102155791 | 338 |
| 540 | 3300025223 | Ga0207672_1000462 | Ga0207672_10004626 | 338 |
| 541 | 3300025885 | Ga0207653_10000011 | Ga0207653_10000011111 | 338 |
| 542 | 3300025899 | Ga0207642_10005460 | Ga0207642_100054602 | 338 |
| 543 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004474 | 338 |
| 544 | 3300025910 | Ga0207684_10002580 | Ga0207684_100025806 | 338 |
| 545 | 3300025910 | Ga0207684_10159495 | Ga0207684_101594953 | 338 |
| 546 | 3300025918 | Ga0207662_10052666 | Ga0207662_100526663 | 338 |
| 547 | 3300025922 | Ga0207646_10005163 | Ga0207646_1000516310 | 338 |
| 548 | 3300025922 | Ga0207646_10415780 | Ga0207646_104157801 | 338 |
| 549 | 3300025924 | Ga0207694_10000065 | Ga0207694_1000006540 | 338 |
| 550 | 3300025926 | Ga0207659_10196387 | Ga0207659_101963872 | 338 |
| 551 | 3300025931 | Ga0207644_10000267 | Ga0207644_1000026725 | 338 |
| 552 | 3300025931 | Ga0207644_10058736 | Ga0207644_100587362 | 338 |
| 553 | 3300025934 | Ga0207686_10003568 | Ga0207686_100035682 | 338 |
| 554 | 3300025934 | Ga0207686_10008626 | Ga0207686_100086261 | 338 |
| 555 | 3300025935 | Ga0207709_10000590 | Ga0207709_1000059013 | 338 |
| 556 | 3300025939 | Ga0207665_10000009 | Ga0207665_1000000995 | 338 |
| 557 | 3300025941 | Ga0207711_10012912 | Ga0207711_100129123 | 338 |
| 558 | 3300025942 | Ga0207689_10239174 | Ga0207689_102391742 | 338 |
| 559 | 3300025981 | Ga0207640_10100394 | Ga0207640_101003942 | 338 |
| 560 | 3300026023 | Ga0207677_10341884 | Ga0207677_103418842 | 338 |
| 561 | 3300026035 | Ga0207703_10000093 | Ga0207703_1000009317 | 338 |
| 562 | 3300026075 | Ga0207708_10001454 | Ga0207708_100014548 | 338 |
| 563 | 3300026075 | Ga0207708_10137887 | Ga0207708_101378871 | 338 |
| 564 | 3300026118 | Ga0207675_100002639 | Ga0207675_10000263911 | 338 |
| 565 | 3300026118 | Ga0207675_100029698 | Ga0207675_1000296984 | 338 |
| 566 | 3300026118 | Ga0207675_100189401 | Ga0207675_1001894012 | 338 |
| 567 | 3300027671 | Ga0209588_1007099 | Ga0209588_10070992 | 338 |
| 568 | 3300027907 | Ga0207428_10006746 | Ga0207428_100067468 | 338 |
| 569 | 3300028379 | Ga0268266_10225895 | Ga0268266_102258952 | 338 |
| 570 | 3300028380 | Ga0268265_10136485 | Ga0268265_101364852 | 338 |
| 571 | 3300028381 | Ga0268264_10257973 | Ga0268264_102579732 | 338 |
| 572 | 3300028381 | Ga0268264_10331668 | Ga0268264_103316681 | 338 |
| 573 | 3300031665 | Ga0316575_10027206 | Ga0316575_100272061 | 338 |
| 574 | 3300031727 | Ga0316576_10352325 | Ga0316576_103523251 | 338 |
| 575 | 3300031728 | Ga0316578_10123670 | Ga0316578_101236701 | 338 |
| 576 | 3300031852 | Ga0307410_10012276 | Ga0307410_100122764 | 338 |
| 577 | 3300031901 | Ga0307406_10240036 | Ga0307406_102400362 | 338 |
| 578 | 3300032002 | Ga0307416_100044253 | Ga0307416_1000442533 | 338 |
| 579 | 3300032004 | Ga0307414_10290194 | Ga0307414_102901941 | 338 |
| 580 | 3300032005 | Ga0307411_10223684 | Ga0307411_102236841 | 338 |
| 581 | 3300034818 | Ga0373950_0001349 | Ga0373950_0001349_699_1721 | 338 |
| 582 | 3300034957 | Ga0373938_0000568 | Ga0373938_0000568_4162_5184 | 338 |
| 583 | 3300035085 | Ga0373929_0002332 | Ga0373929_0002332_479_1501 | 338 |
| 584 | 3300035088 | Ga0373940_0000663 | Ga0373940_0000663_2044_3066 | 338 |
| 585 | 3300035089 | Ga0373944_0059936 | Ga0373944_0059936_79_1095 | 338 |
| 586 | 3300035090 | Ga0373949_0001449 | Ga0373949_0001449_3542_4564 | 338 |
| 587 | 3300035092 | Ga0373952_0000131 | Ga0373952_0000131_8440_9462 | 338 |
| 588 | 3300035111 | Ga0373923_0023827 | Ga0373923_0023827_726_1742 | 338 |
| 589 | 3300035112 | Ga0373932_0001952 | Ga0373932_0001952_885_1907 | 338 |
| 590 | 3300035115 | Ga0373941_0000019 | Ga0373941_0000019_2059_3081 | 338 |
| 591 | 3300035117 | Ga0373953_0059554 | Ga0373953_0059554_333_1349 | 338 |
| 592 | 3300035118 | Ga0373954_0033192 | Ga0373954_0033192_1237_2253 | 338 |
| 593 | 3300035121 | Ga0373960_0000344 | Ga0373960_0000344_6704_7726 | 338 |
| 594 | 3300035207 | Ga0373942_0000503 | Ga0373942_0000503_3518_4540 | 338 |
| 595 | 3300035241 | Ga0373961_0001690 | Ga0373961_0001690_3484_4506 | 338 |
| 596 | 3300035242 | Ga0373962_0000153 | Ga0373962_0000153_9899_10921 | 338 |
| 597 | 3300035410 | Ga0373924_0005801 | Ga0373924_0005801_2559_3584 | 338 |
| 598 | 3300035691 | Ga0373931_0004901 | Ga0373931_0004901_606_1628 | 338 |
| 599 | 3300035692 | Ga0373935_0025095 | Ga0373935_0025095_427_1452 | 338 |
| 600 | 3300035725 | Ga0373947_0004307 | Ga0373947_0004307_2570_3595 | 338 |
| 601 | 3300036401 | Ga0373937_0287666 | Ga0373937_0287666_52_1068 | 338 |
| 602 | 3300036401 | Ga0373937_0346308 | Ga0373937_0346308_199_1215 | 338 |
| 603 | 3300039438 | Ga0436360_0084461 | Ga0436360_0084461_168_1193 | 338 |
| 604 | 3300042435 | Ga0439434_0048884 | Ga0439434_0048884_203_1219 | 338 |
| 605 | 3300044712 | Ga0453684_0119478 | Ga0453684_0119478_1107_2123 | 338 |
| 606 | 3300045051 | Ga0451576_0040232 | Ga0451576_0040232_2554_3570 | 338 |
| 607 | 3300045051 | Ga0451576_0373219 | Ga0451576_0373219_167_1183 | 338 |
| 608 | 3300046454 | Ga0495592_0032013 | Ga0495592_0032013_2700_3716 | 338 |
| 609 | 3300046455 | Ga0495603_0130769 | Ga0495603_0130769_398_1414 | 338 |
| 610 | 3300046459 | Ga0495629_0179867 | Ga0495629_0179867_340_1356 | 338 |
| 611 | 3300046511 | Ga0495608_0075495 | Ga0495608_0075495_629_1645 | 338 |
| 612 | 3300046517 | Ga0495630_0002760 | Ga0495630_0002760_7771_8787 | 338 |
| 613 | 3300046522 | Ga0495643_0001409 | Ga0495643_0001409_19106_20122 | 338 |
| 614 | 3300046539 | Ga0495621_0045659 | Ga0495621_0045659_77_1093 | 338 |
| 615 | 3300046559 | Ga0495667_0032855 | Ga0495667_0032855_1573_2589 | 338 |
| 616 | 3300046681 | Ga0495647_0009083 | Ga0495647_0009083_1067_2089 | 338 |
| 617 | 3300046683 | Ga0495658_0047548 | Ga0495658_0047548_1273_2289 | 338 |
| 618 | 3300046684 | Ga0495669_0004600 | Ga0495669_0004600_2716_3732 | 338 |
| 619 | 3300046684 | Ga0495669_0050117 | Ga0495669_0050117_652_1668 | 338 |
| 620 | 3300046689 | Ga0495613_0000392 | Ga0495613_0000392_26709_27725 | 338 |
| 621 | 3300046809 | Ga0495600_0028202 | Ga0495600_0028202_2290_3306 | 338 |
| 622 | 3300047319 | Ga0495674_0063360 | Ga0495674_0063360_629_1645 | 338 |
| 623 | 3300047471 | Ga0495684_0000410 | Ga0495684_0000410_17345_18361 | 338 |
| 624 | 3300048090 | Ga0495615_0019285 | Ga0495615_0019285_266_1282 | 338 |
| 625 | 3300048905 | Ga0496102_0052493 | Ga0496102_0052493_691_1713 | 338 |
| 626 | 3300048905 | Ga0496102_0059347 | Ga0496102_0059347_488_1504 | 338 |
| 627 | 3300048905 | Ga0496102_0110291 | Ga0496102_0110291_407_1423 | 338 |
| 628 | 3300048907 | Ga0496104_0004198 | Ga0496104_0004198_5762_6778 | 338 |
| 629 | 3300048909 | Ga0496106_0018159 | Ga0496106_0018159_685_1701 | 338 |
| 630 | 3300048909 | Ga0496106_0023345 | Ga0496106_0023345_155_1207 | 338 |
| 631 | 3300048912 | Ga0496109_0110290 | Ga0496109_0110290_1487_2503 | 338 |
| 632 | 3300048913 | Ga0496110_0009220 | Ga0496110_0009220_694_1710 | 338 |
| 633 | 3300048913 | Ga0496110_0114563 | Ga0496110_0114563_224_1240 | 338 |
| 634 | 3300048915 | Ga0496112_0030559 | Ga0496112_0030559_656_1672 | 338 |
| 635 | 3300049514 | Ga0501291_003832 | Ga0501291_003832_756_1772 | 338 |
| 636 | 3300049519 | Ga0501296_007593 | Ga0501296_007593_15_1031 | 338 |
| 637 | 3300049568 | Ga0501031_0141420 | Ga0501031_0141420_68_1099 | 338 |
| 638 | 3300049572 | Ga0501036_0120761 | Ga0501036_0120761_896_1912 | 338 |
| 639 | 3300049574 | Ga0501038_0168642 | Ga0501038_0168642_257_1273 | 338 |
| 640 | 3300049575 | Ga0501039_0114135 | Ga0501039_0114135_556_1572 | 338 |
| 641 | 3300049575 | Ga0501039_0164363 | Ga0501039_0164363_308_1324 | 338 |
| 642 | 3300049576 | Ga0501040_0034852 | Ga0501040_0034852_1687_2703 | 338 |
| 643 | 3300049576 | Ga0501040_0053093 | Ga0501040_0053093_190_1206 | 338 |
| 644 | 3300049576 | Ga0501040_0087021 | Ga0501040_0087021_184_1200 | 338 |
| 645 | 3300049577 | Ga0501041_0033405 | Ga0501041_0033405_1569_2600 | 338 |
| 646 | 3300049577 | Ga0501041_0071403 | Ga0501041_0071403_243_1259 | 338 |
| 647 | 3300049578 | Ga0501042_0282717 | Ga0501042_0282717_147_1178 | 338 |
| 648 | 3300049587 | Ga0501071_0028941 | Ga0501071_0028941_2751_3767 | 338 |
| 649 | 3300049587 | Ga0501071_0052509 | Ga0501071_0052509_1682_2698 | 338 |
| 650 | 3300049587 | Ga0501071_0161435 | Ga0501071_0161435_444_1460 | 338 |
| 651 | 3300049588 | Ga0501072_0051165 | Ga0501072_0051165_1127_2143 | 338 |
| 652 | 3300049590 | Ga0501074_0147928 | Ga0501074_0147928_317_1333 | 338 |
| 653 | 3300049591 | Ga0501075_0017282 | Ga0501075_0017282_909_1925 | 338 |
| 654 | 3300049591 | Ga0501075_0034517 | Ga0501075_0034517_28_1044 | 338 |
| 655 | 3300049591 | Ga0501075_0042478 | Ga0501075_0042478_1162_2193 | 338 |
| 656 | 3300049591 | Ga0501075_0072097 | Ga0501075_0072097_739_1755 | 338 |
| 657 | 3300049592 | Ga0501076_0014709 | Ga0501076_0014709_4730_5746 | 338 |
| 658 | 3300049592 | Ga0501076_0018815 | Ga0501076_0018815_3958_4974 | 338 |
| 659 | 3300049592 | Ga0501076_0039280 | Ga0501076_0039280_1212_2228 | 338 |
| 660 | 3300049593 | Ga0501077_0052780 | Ga0501077_0052780_67_1083 | 338 |
| 661 | 3300049666 | Ga0501228_001032 | Ga0501228_001032_444_1460 | 338 |
| 662 | 3300049705 | Ga0501225_0038236 | Ga0501225_0038236_249_1265 | 338 |
| 663 | 3300049708 | Ga0501245_009500 | Ga0501245_009500_259_1275 | 338 |
| 664 | 3300049741 | Ga0501079_0161132 | Ga0501079_0161132_51_1067 | 338 |
| 665 | 3300049742 | Ga0501080_0032031 | Ga0501080_0032031_1421_2437 | 338 |
| 666 | 3300049742 | Ga0501080_0491768 | Ga0501080_0491768_56_1072 | 338 |
| 667 | 3300049743 | Ga0501081_0122108 | Ga0501081_0122108_148_1164 | 338 |
| 668 | 3300049743 | Ga0501081_0179712 | Ga0501081_0179712_428_1444 | 338 |
| 669 | 3300049743 | Ga0501081_0321440 | Ga0501081_0321440_89_1105 | 338 |
| 670 | 3300049824 | Ga0501045_0011704 | Ga0501045_0011704_225_1241 | 338 |
| 671 | 3300049824 | Ga0501045_0025027 | Ga0501045_0025027_2528_3544 | 338 |
| 672 | 3300049824 | Ga0501045_0144509 | Ga0501045_0144509_156_1187 | 338 |
| 673 | 3300049851 | Ga0501212_001937 | Ga0501212_001937_533_1549 | 338 |
| 674 | 3300050507 | nmdc:mga05p37_18589_c1 | nmdc:mga05p37_18589_c1_7172_8188 | 338 |
| 675 | 3300050507 | nmdc:mga05p37_36688_c1 | nmdc:mga05p37_36688_c1_516_1532 | 338 |
| 676 | 3300050508 | nmdc:mga09592_51940_c2 | nmdc:mga09592_51940_c2_1165_2181 | 338 |
| 677 | 3300050509 | nmdc:mga0qj67_139625_c1 | nmdc:mga0qj67_139625_c1_724_1740 | 338 |
| 678 | 3300050510 | nmdc:mga06r32_234606_c1 | nmdc:mga06r32_234606_c1_425_1441 | 338 |
| 679 | 3300050511 | nmdc:mga08y16_513988_c1 | nmdc:mga08y16_513988_c1_19_1035 | 338 |
| 680 | 3300050512 | nmdc:mga0n895_2022_c1 | nmdc:mga0n895_2022_c1_3954_4970 | 338 |
| 681 | 3300050512 | nmdc:mga0n895_303186_c1 | nmdc:mga0n895_303186_c1_313_1329 | 338 |
| 682 | 3300050512 | nmdc:mga0n895_392444_c1 | nmdc:mga0n895_392444_c1_187_1209 | 338 |
| 683 | 3300050512 | nmdc:mga0n895_472454_c1 | nmdc:mga0n895_472454_c1_140_1162 | 338 |
| 684 | 3300050512 | nmdc:mga0n895_90460_c1 | nmdc:mga0n895_90460_c1_1483_2499 | 338 |
| 685 | 3300050513 | nmdc:mga0rr50_162124_c1 | nmdc:mga0rr50_162124_c1_216_1238 | 338 |
| 686 | 3300050513 | nmdc:mga0rr50_783_c1 | nmdc:mga0rr50_783_c1_1924_3024 | 338 |
| 687 | 3300050513 | nmdc:mga0rr50_9454_c1 | nmdc:mga0rr50_9454_c1_2300_3322 | 338 |
| 688 | 3300050514 | nmdc:mga08x19_127533_c1 | nmdc:mga08x19_127533_c1_429_1445 | 338 |
| 689 | 3300050514 | nmdc:mga08x19_61987_c1 | nmdc:mga08x19_61987_c1_1355_2371 | 338 |
| 690 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_175759_176859 | 338 |
| 691 | 3300050515 | nmdc:mga0a205_52960_c1 | nmdc:mga0a205_52960_c1_1862_2878 | 338 |
| 692 | 3300053077 | Ga0495601_0006540 | Ga0495601_0006540_2524_3540 | 338 |
| 693 | 3300053085 | Ga0495619_0082013 | Ga0495619_0082013_106_1122 | 338 |
| 694 | 3300053129 | Ga0500628_000685 | Ga0500628_000685_2511_3527 | 338 |
| 695 | 3300054114 | Ga0501084_0019389 | Ga0501084_0019389_3998_5014 | 338 |
| 696 | 3300054114 | Ga0501084_0097686 | Ga0501084_0097686_949_1980 | 338 |
| 697 | 3300054114 | Ga0501084_0221279 | Ga0501084_0221279_558_1574 | 338 |
| 698 | 3300060353 | Ga0501082_0328214 | Ga0501082_0328214_242_1258 | 338 |
| 699 | 3300060353 | Ga0501082_0338538 | Ga0501082_0338538_169_1185 | 338 |
| 700 | 3300061734 | Ga0530510_0006387 | Ga0530510_0006387_974_1990 | 338 |
| 701 | 3300061734 | Ga0530510_0032255 | Ga0530510_0032255_625_1641 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k9y-assembly2.cif.gz_C | crystal structure of human vat-1 | 0.9642 | 2 | 338 |
| 6lhr-assembly2.cif.gz_C | crystal structure of the complex between vesicle amine transport-1 and nadp | 0.9614 | 2 | 338 |
| 6lhr-assembly2.cif.gz_C | crystal structure of the complex between vesicle amine transport-1 and nadp | 0.9559 | 2 | 338 |
| 6k9y-assembly2.cif.gz_C | crystal structure of human vat-1 | 0.9555 | 2 | 338 |
| 4a27-assembly1.cif.gz_A | crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein | 0.9549 | 1 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07721_1_120_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9727 | 1 | 118 | 3.90.180.10 |
| af_Q80TB8_38_380_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9615 | 1 | 337 | 3.90.180.10 |
| af_M0R3N4_1_117_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9597 | 1 | 115 | 3.90.180.10 |
| af_Q8JFV8_192_377_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9581 | 121 | 306 | 3.40.50.720 |
| af_Q80TB8_38_380_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9559 | 1 | 337 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7L3Q574-F1-model_v4 | VAT1 protein | 0.9763 | 2 | 237 |
GO:0005741
GO:0008270 GO:0010637 GO:0016491 |
| AF-A0A2E5U0V2-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9735 | 1 | 337 |
GO:0016491
|
| AF-A0A672UK94-F1-model_v4 | Vesicle amine transport 1 | 0.9722 | 2 | 338 |
GO:0005741
GO:0008270 GO:0010637 GO:0016491 |
| AF-A0A3Q1EEF1-F1-model_v4 | Synaptic vesicle membrane protein VAT-1 homolog | 0.972 | 2 | 337 |
GO:0005741
GO:0008270 GO:0010637 GO:0016491 |
| AF-A0A7L2RY32-F1-model_v4 | VAT1 protein | 0.9681 | 81 | 317 |
GO:0005741
GO:0008270 GO:0010637 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar