F476153

General Info

Members Datasets Scaffolds Average Seq Length
701 298 1402 245

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100199429|Ga0075428_1001994293
Length 262
Sequence VVDPILRILRQPRVSLKCTPVSAAASAARARILPHGPLDLVRQLAIWFGFYYAYRYTRGVADRSPYEAFQNGLRVADVEHRLTGLWELSLQSFVASSDVLRELTSWTYWNSQFTVLGLVLLWVYLRRNEAFVRFRNTLLLANVIGLVGFVLMPTAPPRMFPELGFVDTLAGFGINHESAIVRNDANPYAAMPSLHAADALIVGVGLFLIVRTQWLRFVWFSVVATGNHFWLDILAGIVVAAVAGAVVNYRHVRGWFARPVPA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
199 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 12.55
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100199429 3300006844 Bacteria 2164
2 JGI24744J21845_10007414 3300002077 Bacteria 2266
3 JGI25407J50210_10000558 3300003373 Bacteria 7479
4 Ga0070676_10089953 3300005328 Bacteria 1879
5 Ga0070683_100002197 3300005329 Bacteria 15442
6 Ga0070683_100020219 3300005329 Bacteria 5923
7 Ga0070683_100108468 3300005329 Bacteria 2618
8 Ga0070683_100139151 3300005329 Bacteria 2299
9 Ga0070690_100256595 3300005330 Bacteria 1239
10 Ga0068869_100286991 3300005334 Bacteria 1325
11 Ga0068869_100680369 3300005334 Bacteria 876
12 Ga0070666_10307929 3300005335 Bacteria 1129
13 Ga0070680_100064676 3300005336 Bacteria 2998
14 Ga0070680_100118192 3300005336 Bacteria 2211
15 Ga0070680_100128834 3300005336 Bacteria 2116
16 Ga0070682_100012226 3300005337 Bacteria 4915
17 Ga0068868_100016225 3300005338 Bacteria 5526
18 Ga0068868_100107174 3300005338 Bacteria 2267
19 Ga0068868_100111565 3300005338 Bacteria 2223
20 Ga0068868_100273075 3300005338 Bacteria 1429
21 Ga0068868_100381686 3300005338 Bacteria 1213
22 Ga0068868_100598448 3300005338 Bacteria 977
23 Ga0070660_100011699 3300005339 Bacteria 6248
24 Ga0070660_100393880 3300005339 Bacteria 1145
25 Ga0070689_100015560 3300005340 Bacteria 5550
26 Ga0070689_100254509 3300005340 Bacteria 1450
27 Ga0070691_10020184 3300005341 Bacteria 3077
28 Ga0070691_10020298 3300005341 Bacteria 3070
29 Ga0070692_10020127 3300005345 Bacteria 3231
30 Ga0070692_10038999 3300005345 Bacteria 2424
31 Ga0070668_100005010 3300005347 Bacteria 9813
32 Ga0070668_100016085 3300005347 Bacteria 5599
33 Ga0070669_100394688 3300005353 Bacteria 1131
34 Ga0070671_100016630 3300005355 Bacteria 5946
35 Ga0070671_100080995 3300005355 Bacteria 2714
36 Ga0070674_100041134 3300005356 Bacteria 3130
37 Ga0070673_100539474 3300005364 Bacteria 1059
38 Ga0070673_100659856 3300005364 Bacteria 958
39 Ga0070688_100011685 3300005365 Bacteria 4889
40 Ga0070688_100054452 3300005365 Bacteria 2505
41 Ga0070659_100031080 3300005366 Bacteria 4134
42 Ga0070659_100117847 3300005366 Bacteria 2148
43 Ga0070659_100515172 3300005366 Bacteria 1021
44 Ga0070659_100861822 3300005366 Unclassified 790
45 Ga0070667_100110520 3300005367 Bacteria 2383
46 Ga0070703_10009816 3300005406 Bacteria 2698
47 Ga0070703_10012046 3300005406 Bacteria 2449
48 Ga0070713_100430077 3300005436 Bacteria 1237
49 Ga0070713_100658590 3300005436 Unclassified 998
50 Ga0070710_10027406 3300005437 Bacteria 3037
51 Ga0070710_10035305 3300005437 Bacteria 2725
52 Ga0070710_10044088 3300005437 Bacteria 2473
53 Ga0070701_10020160 3300005438 Bacteria 3161
54 Ga0070711_100001144 3300005439 Bacteria 14228
55 Ga0070711_100101546 3300005439 Bacteria 2093
56 Ga0070705_100005343 3300005440 Bacteria 6253
57 Ga0070705_100009138 3300005440 Bacteria 4919
58 Ga0070705_100012231 3300005440 Bacteria 4357
59 Ga0070705_100026458 3300005440 Bacteria 3158
60 Ga0070705_100039162 3300005440 Unclassified 2688
61 Ga0070705_100050151 3300005440 Bacteria 2427
62 Ga0070705_100102991 3300005440 Bacteria 1807
63 Ga0070700_100007946 3300005441 Bacteria 5757
64 Ga0070700_100321162 3300005441 Bacteria 1137
65 Ga0070694_100025028 3300005444 Bacteria 3857
66 Ga0070694_100161656 3300005444 Bacteria 1644
67 Ga0070694_100389465 3300005444 Bacteria 1089
68 Ga0070708_100069276 3300005445 Bacteria 3172
69 Ga0070708_100342710 3300005445 Bacteria 1408
70 Ga0070663_100121034 3300005455 Bacteria 1977
71 Ga0070678_100010550 3300005456 Bacteria 5651
72 Ga0070678_100096056 3300005456 Bacteria 2285
73 Ga0070678_100213671 3300005456 Bacteria 1600
74 Ga0070662_100036405 3300005457 Bacteria 3481
75 Ga0070662_100169863 3300005457 Bacteria 1712
76 Ga0070681_10011953 3300005458 Bacteria 8607
77 Ga0070681_10052560 3300005458 Bacteria 4064
78 Ga0068867_100013318 3300005459 Bacteria 5826
79 Ga0068867_100053155 3300005459 Bacteria 2991
80 Ga0068867_100161556 3300005459 Bacteria 1767
81 Ga0068867_100310101 3300005459 Bacteria 1304
82 Ga0070685_10155493 3300005466 Bacteria 1453
83 Ga0070706_100020810 3300005467 Bacteria 6040
84 Ga0070706_100028038 3300005467 Bacteria 5181
85 Ga0070706_100089965 3300005467 Bacteria 2846
86 Ga0070706_100190059 3300005467 Bacteria 1919
87 Ga0070707_100026202 3300005468 Bacteria 5534
88 Ga0070698_100010941 3300005471 Bacteria 9653
89 Ga0070698_100169255 3300005471 Bacteria 2126
90 Ga0070698_100268902 3300005471 Bacteria 1636
91 Ga0070699_100023224 3300005518 Bacteria 5342
92 Ga0070699_100053256 3300005518 Bacteria 3502
93 Ga0070699_100076885 3300005518 Bacteria 2906
94 Ga0070699_100410160 3300005518 Unclassified 1226
95 Ga0070679_100005825 3300005530 Bacteria 11431
96 Ga0070679_100208067 3300005530 Bacteria 1921
97 Ga0070684_100007207 3300005535 Bacteria 8639
98 Ga0070684_100025193 3300005535 Bacteria 4998
99 Ga0070684_100042071 3300005535 Bacteria 3943
100 Ga0070684_100061086 3300005535 Bacteria 3297
101 Ga0070697_100101861 3300005536 Bacteria 2386
102 Ga0070697_100219121 3300005536 Bacteria 1622
103 Ga0068853_100028151 3300005539 Bacteria 4724
104 Ga0070672_100045592 3300005543 Bacteria 3392
105 Ga0070672_100111706 3300005543 Unclassified 2228
106 Ga0070672_100326865 3300005543 Bacteria 1304
107 Ga0070686_100007022 3300005544 Bacteria 6276
108 Ga0070686_100029459 3300005544 Bacteria 3340
109 Ga0070695_100048599 3300005545 Bacteria 2713
110 Ga0070695_100083582 3300005545 Bacteria 2115
111 Ga0070695_100145410 3300005545 Bacteria 1649
112 Ga0070695_100157306 3300005545 Bacteria 1592
113 Ga0070696_100005071 3300005546 Bacteria 8798
114 Ga0070696_100017185 3300005546 Bacteria 4882
115 Ga0070696_100060877 3300005546 Bacteria 2640
116 Ga0070696_100100302 3300005546 Bacteria 2074
117 Ga0070696_100613121 3300005546 Bacteria 879
118 Ga0070693_100012521 3300005547 Bacteria 4294
119 Ga0070693_100015386 3300005547 Bacteria 3938
120 Ga0070693_100018792 3300005547 Bacteria 3614
121 Ga0070693_100090375 3300005547 Bacteria 1845
122 Ga0070704_100141977 3300005549 Bacteria 1876
123 Ga0070704_100223084 3300005549 Bacteria 1533
124 Ga0070704_100458536 3300005549 Bacteria 1099
125 Ga0068855_100018218 3300005563 Bacteria 8435
126 Ga0068855_100143195 3300005563 Bacteria 2723
127 Ga0068855_100284095 3300005563 Bacteria 1836
128 Ga0068855_100353804 3300005563 Bacteria 1617
129 Ga0068855_100393015 3300005563 Bacteria 1521
130 Ga0068857_100010134 3300005577 Bacteria 8190
131 Ga0068857_100062591 3300005577 Bacteria 3308
132 Ga0068854_100006403 3300005578 Bacteria 7490
133 Ga0068854_100127321 3300005578 Bacteria 1941
134 Ga0068856_100006244 3300005614 Bacteria 11694
135 Ga0068856_100015364 3300005614 Bacteria 7399
136 Ga0068856_100048213 3300005614 Bacteria 4196
137 Ga0068856_100411735 3300005614 Bacteria 1372
138 Ga0068856_100466098 3300005614 Bacteria 1284
139 Ga0070702_100020621 3300005615 Bacteria 3455
140 Ga0070702_100026383 3300005615 Bacteria 3121
141 Ga0070702_100065014 3300005615 Bacteria 2135
142 Ga0068864_100280972 3300005618 Bacteria 1554
143 Ga0068866_10003857 3300005718 Bacteria 6153
144 Ga0068866_10058356 3300005718 Bacteria 1993
145 Ga0068866_10441468 3300005718 Bacteria 849
146 Ga0068861_100027194 3300005719 Bacteria 4164
147 Ga0068851_10194033 3300005834 Bacteria 1130
148 Ga0068860_100139091 3300005843 Bacteria 2333
149 Ga0068860_100151524 3300005843 Bacteria 2233
150 Ga0068860_100248385 3300005843 Bacteria 1732
151 Ga0081455_10002168 3300005937 Bacteria 23428
152 Ga0081455_10027563 3300005937 Bacteria 5205
153 Ga0081455_10064378 3300005937 Bacteria 3070
154 Ga0081455_10105421 3300005937 Bacteria 2253
155 Ga0081455_10314464 3300005937 Bacteria 1118
156 Ga0081538_10000361 3300005981 Bacteria 51863
157 Ga0081538_10000795 3300005981 Bacteria 34267
158 Ga0081538_10062594 3300005981 Bacteria 2121
159 Ga0081540_1000836 3300005983 Bacteria 28072
160 Ga0081540_1002829 3300005983 Bacteria 14050
161 Ga0081540_1003929 3300005983 Bacteria 11561
162 Ga0070717_10015579 3300006028 Bacteria 5875
163 Ga0070717_10276277 3300006028 Bacteria 1489
164 Ga0070717_10774776 3300006028 Unclassified 872
165 Ga0075365_10021647 3300006038 Bacteria 4014
166 Ga0075365_10164730 3300006038 Bacteria 1546
167 Ga0075432_10036902 3300006058 Bacteria 1700
168 Ga0070715_10012587 3300006163 Bacteria 3084
169 Ga0070715_10033213 3300006163 Bacteria 2107
170 Ga0070715_10090218 3300006163 Unclassified 1409
171 Ga0070716_100074904 3300006173 Bacteria 2001
172 Ga0070712_100002015 3300006175 Bacteria 12440
173 Ga0070712_100048608 3300006175 Bacteria 2941
174 Ga0070712_100080151 3300006175 Bacteria 2362
175 Ga0097621_100011354 3300006237 Bacteria 6553
176 Ga0068871_100021747 3300006358 Bacteria 4936
177 Ga0068871_100026438 3300006358 Bacteria 4528
178 Ga0075428_100066920 3300006844 Bacteria 3933
179 Ga0075428_100277932 3300006844 Bacteria 1802
180 Ga0075430_100046842 3300006846 Bacteria 3651
181 Ga0075431_100061008 3300006847 Bacteria 3892
182 Ga0075431_100075417 3300006847 Bacteria 3480
183 Ga0075433_10048775 3300006852 Bacteria 3683
184 Ga0075433_10248760 3300006852 Bacteria 1577
185 Ga0075434_100166472 3300006871 Bacteria 2224
186 Ga0075434_100294603 3300006871 Bacteria 1642
187 Ga0075436_100030768 3300006914 Bacteria 3694
188 Ga0075436_100051044 3300006914 Bacteria 2854
189 Ga0075436_100074215 3300006914 Bacteria 2355
190 Ga0075435_100018593 3300007076 Bacteria 5290
191 Ga0075435_100023563 3300007076 Bacteria 4763
192 Ga0075435_100072619 3300007076 Bacteria 2811
193 Ga0075435_100104404 3300007076 Unclassified 2351
194 Ga0105240_10168916 3300009093 Bacteria 2592
195 Ga0105240_10284495 3300009093 Bacteria 1898
196 Ga0111539_10132901 3300009094 Bacteria 2914
197 Ga0111539_10190148 3300009094 Bacteria 2396
198 Ga0111539_10302316 3300009094 Bacteria 1862
199 Ga0111539_10638354 3300009094 Bacteria 1240
200 Ga0105245_10018759 3300009098 Bacteria 6052
201 Ga0105245_10245991 3300009098 Bacteria 1736
202 Ga0105245_10628173 3300009098 Bacteria 1103
203 Ga0105247_10104196 3300009101 Bacteria 1817
204 Ga0105247_10449419 3300009101 Bacteria 929
205 Ga0114129_10018702 3300009147 Bacteria 9867
206 Ga0114129_10028476 3300009147 Bacteria 7916
207 Ga0114129_10157822 3300009147 Bacteria 3101
208 Ga0114129_10267683 3300009147 Bacteria 2287
209 Ga0114129_10344075 3300009147 Bacteria 1977
210 Ga0114129_10821335 3300009147 Bacteria 1184
211 Ga0114129_11042501 3300009147 Bacteria 1027
212 Ga0105243_10003921 3300009148 Bacteria 11874
213 Ga0105243_10006547 3300009148 Bacteria 8997
214 Ga0105243_10029032 3300009148 Bacteria 4251
215 Ga0105243_10064707 3300009148 Bacteria 2935
216 Ga0105243_10168938 3300009148 Bacteria 1892
217 Ga0105243_11056215 3300009148 Bacteria 818
218 Ga0105241_10030769 3300009174 Bacteria 4015
219 Ga0105241_10455893 3300009174 Bacteria 1132
220 Ga0105241_10509724 3300009174 Unclassified 1074
221 Ga0105242_10095002 3300009176 Bacteria 2516
222 Ga0105242_10107978 3300009176 Bacteria 2368
223 Ga0105242_10275209 3300009176 Unclassified 1527
224 Ga0105242_10395497 3300009176 Bacteria 1288
225 Ga0105242_10451424 3300009176 Bacteria 1212
226 Ga0105248_10006882 3300009177 Bacteria 12462
227 Ga0105248_10489308 3300009177 Bacteria 1387
228 Ga0105237_10098088 3300009545 Bacteria 2921
229 Ga0105237_10412854 3300009545 Bacteria 1355
230 Ga0105238_10042715 3300009551 Bacteria 4589
231 Ga0105249_10003964 3300009553 Bacteria 12771
232 Ga0105249_10013936 3300009553 Bacteria 7107
233 Ga0105249_10323783 3300009553 Bacteria 1553
234 Ga0105249_10583682 3300009553 Bacteria 1171
235 Ga0105246_10035463 3300011119 Bacteria 3335
236 Ga0105246_10242533 3300011119 Bacteria 1425
237 Ga0157371_10083395 3300013102 Bacteria 2263
238 Ga0157370_10047827 3300013104 Bacteria 4099
239 Ga0157369_10576314 3300013105 Bacteria 1162
240 Ga0157374_10026155 3300013296 Bacteria 5248
241 Ga0157374_10221741 3300013296 Bacteria 1856
242 Ga0157374_10742822 3300013296 Bacteria 996
243 Ga0157378_10068908 3300013297 Bacteria 3173
244 Ga0157378_10069015 3300013297 Bacteria 3170
245 Ga0157378_10318970 3300013297 Bacteria 1509
246 Ga0163162_10005877 3300013306 Bacteria 11871
247 Ga0163162_10062591 3300013306 Bacteria 3761
248 Ga0163162_10116178 3300013306 Bacteria 2776
249 Ga0163162_10464388 3300013306 Bacteria 1397
250 Ga0157375_10043262 3300013308 Bacteria 4366
251 Ga0157375_10263450 3300013308 Bacteria 1885
252 Ga0163163_10024110 3300014325 Bacteria 5788
253 Ga0157380_10075110 3300014326 Bacteria 2746
254 Ga0157377_10056037 3300014745 Bacteria 2237
255 Ga0157377_10246028 3300014745 Bacteria 1157
256 Ga0157379_10624786 3300014968 Bacteria 1007
257 Ga0157376_10007598 3300014969 Bacteria 7755
258 Ga0157376_10035080 3300014969 Bacteria 4055
259 Ga0224712_10042297 3300022467 Bacteria 1726
260 Ga0207653_10056216 3300025885 Bacteria 1319
261 Ga0207692_10014051 3300025898 Bacteria 3489
262 Ga0207692_10041837 3300025898 Bacteria 2271
263 Ga0207642_10002665 3300025899 Bacteria 5560
264 Ga0207688_10078718 3300025901 Bacteria 1879
265 Ga0207688_10101416 3300025901 Unclassified 1663
266 Ga0207688_10104784 3300025901 Bacteria 1637
267 Ga0207647_10106264 3300025904 Bacteria 1662
268 Ga0207685_10005762 3300025905 Bacteria 3306
269 Ga0207685_10029854 3300025905 Bacteria 1935
270 Ga0207685_10161676 3300025905 Unclassified 1023
271 Ga0207699_10022007 3300025906 Bacteria 3447
272 Ga0207699_10083814 3300025906 Bacteria 1984
273 Ga0207699_10086257 3300025906 Unclassified 1960
274 Ga0207699_10226256 3300025906 Bacteria 1279
275 Ga0207684_10136773 3300025910 Unclassified 2104
276 Ga0207684_10203818 3300025910 Bacteria 1706
277 Ga0207684_10413395 3300025910 Bacteria 1159
278 Ga0207654_10045383 3300025911 Bacteria 2501
279 Ga0207654_10049818 3300025911 Bacteria 2404
280 Ga0207654_10069834 3300025911 Unclassified 2083
281 Ga0207707_10351885 3300025912 Bacteria 1269
282 Ga0207671_10741021 3300025914 Unclassified 781
283 Ga0207693_10001754 3300025915 Bacteria 19046
284 Ga0207693_10005169 3300025915 Bacteria 10919
285 Ga0207693_10014460 3300025915 Bacteria 6344
286 Ga0207693_10086893 3300025915 Bacteria 2450
287 Ga0207693_10213061 3300025915 Bacteria 1518
288 Ga0207663_10030048 3300025916 Bacteria 3200
289 Ga0207663_10042415 3300025916 Bacteria 2779
290 Ga0207663_10149382 3300025916 Bacteria 1637
291 Ga0207663_10189107 3300025916 Bacteria 1477
292 Ga0207660_10082537 3300025917 Bacteria 2365
293 Ga0207660_10123410 3300025917 Bacteria 1964
294 Ga0207660_10277461 3300025917 Bacteria 1329
295 Ga0207662_10014548 3300025918 Bacteria 4417
296 Ga0207662_10162680 3300025918 Bacteria 1427
297 Ga0207657_10020124 3300025919 Bacteria 6315
298 Ga0207652_10009702 3300025921 Bacteria 7744
299 Ga0207652_10209112 3300025921 Bacteria 1757
300 Ga0207646_10010720 3300025922 Bacteria 8919
301 Ga0207646_10020464 3300025922 Bacteria 6129
302 Ga0207681_10092286 3300025923 Bacteria 2165
303 Ga0207694_10096333 3300025924 Bacteria 2340
304 Ga0207687_10014541 3300025927 Bacteria 5152
305 Ga0207700_10277472 3300025928 Bacteria 1440
306 Ga0207664_10087593 3300025929 Bacteria 2545
307 Ga0207644_10064658 3300025931 Bacteria 2658
308 Ga0207690_10151310 3300025932 Bacteria 1720
309 Ga0207706_10005210 3300025933 Bacteria 12133
310 Ga0207686_10044127 3300025934 Bacteria 2736
311 Ga0207686_10131652 3300025934 Bacteria 1716
312 Ga0207709_10014190 3300025935 Bacteria 4398
313 Ga0207709_10021892 3300025935 Bacteria 3622
314 Ga0207709_10053694 3300025935 Bacteria 2481
315 Ga0207709_10061462 3300025935 Bacteria 2348
316 Ga0207709_10542218 3300025935 Bacteria 914
317 Ga0207670_10011870 3300025936 Bacteria 5073
318 Ga0207669_10340371 3300025937 Bacteria 1155
319 Ga0207704_10035413 3300025938 Bacteria 2860
320 Ga0207665_10001527 3300025939 Bacteria 15566
321 Ga0207665_10030514 3300025939 Bacteria 3563
322 Ga0207665_10361366 3300025939 Bacteria 1098
323 Ga0207691_10002643 3300025940 Bacteria 17505
324 Ga0207691_10121873 3300025940 Bacteria 2310
325 Ga0207711_10061100 3300025941 Bacteria 3248
326 Ga0207689_10078101 3300025942 Bacteria 2720
327 Ga0207661_10021855 3300025944 Bacteria 4803
328 Ga0207661_10023006 3300025944 Bacteria 4704
329 Ga0207661_10072784 3300025944 Bacteria 2813
330 Ga0207661_10113938 3300025944 Unclassified 2292
331 Ga0207667_10020628 3300025949 Bacteria 7323
332 Ga0207651_10153591 3300025960 Bacteria 1795
333 Ga0207651_10361047 3300025960 Bacteria 1226
334 Ga0207712_10003765 3300025961 Bacteria 9580
335 Ga0207712_10004878 3300025961 Bacteria 8485
336 Ga0207712_10328732 3300025961 Bacteria 1264
337 Ga0207668_10013595 3300025972 Bacteria 5020
338 Ga0207668_10066612 3300025972 Bacteria 2553
339 Ga0207640_10101833 3300025981 Bacteria 2016
340 Ga0207640_10406128 3300025981 Bacteria 1110
341 Ga0207640_10561886 3300025981 Bacteria 960
342 Ga0207658_10366959 3300025986 Unclassified 1258
343 Ga0207677_10071251 3300026023 Bacteria 2452
344 Ga0207677_10088916 3300026023 Bacteria 2241
345 Ga0207677_10475087 3300026023 Bacteria 1076
346 Ga0207678_10056287 3300026067 Bacteria 3385
347 Ga0207678_10197110 3300026067 Bacteria 1721
348 Ga0207678_10222378 3300026067 Bacteria 1616
349 Ga0207678_10490831 3300026067 Bacteria 1070
350 Ga0207708_10004755 3300026075 Bacteria 9992
351 Ga0207702_10003702 3300026078 Bacteria 13834
352 Ga0207702_10069185 3300026078 Bacteria 3034
353 Ga0207702_10297717 3300026078 Bacteria 1530
354 Ga0207702_10733873 3300026078 Bacteria 974
355 Ga0207648_10000150 3300026089 Bacteria 70019
356 Ga0207648_10027855 3300026089 Bacteria 5013
357 Ga0207648_10296658 3300026089 Bacteria 1449
358 Ga0207674_10008931 3300026116 Bacteria 11518
359 Ga0207674_10059854 3300026116 Bacteria 3854
360 Ga0207675_100000664 3300026118 Bacteria 33832
361 Ga0207675_100011845 3300026118 Bacteria 8150
362 Ga0207675_100054109 3300026118 Bacteria 3744
363 Ga0207675_100097748 3300026118 Bacteria 2765
364 Ga0207683_10000131 3300026121 Bacteria 61423
365 Ga0207683_10000973 3300026121 Bacteria 26237
366 Ga0207683_10081814 3300026121 Bacteria 2867
367 Ga0207683_10122346 3300026121 Bacteria 2337
368 Ga0207698_10121691 3300026142 Bacteria 2210
369 Ga0207428_10003178 3300027907 Bacteria 16086
370 Ga0207428_10142836 3300027907 Bacteria 1826
371 Ga0268265_10219065 3300028380 Bacteria 1664
372 Ga0268265_10272334 3300028380 Bacteria 1511
373 Ga0268265_10274317 3300028380 Bacteria 1506
374 Ga0268264_10163371 3300028381 Bacteria 2008
375 Ga0265338_10071361 3300028800 Bacteria 2972
376 Ga0265327_10034849 3300031251 Bacteria 2788
377 Ga0265327_10114544 3300031251 Bacteria 1284
378 Ga0265327_10242439 3300031251 Unclassified 805
379 Ga0307413_10206311 3300031824 Bacteria 1423
380 Ga0307409_100087628 3300031995 Bacteria 2538
381 Ga0307409_100126628 3300031995 Bacteria 2174
382 Ga0307416_100054820 3300032002 Bacteria 3207
383 Ga0307416_100075241 3300032002 Bacteria 2825
384 Ga0307416_100124970 3300032002 Bacteria 2302
385 Ga0307415_100196094 3300032126 Bacteria 1598
386 Ga0307415_100261757 3300032126 Bacteria 1412
387 Ga0373930_0005529 3300034816 Bacteria 2107
388 Ga0373930_0035830 3300034816 Unclassified 1039
389 Ga0373948_0006404 3300034817 Bacteria 1945
390 Ga0373929_0007869 3300035085 Bacteria 1956
391 Ga0373940_0003245 3300035088 Bacteria 3295
392 Ga0373940_0003563 3300035088 Bacteria 3192
393 Ga0373944_0030842 3300035089 Bacteria 1610
394 Ga0373944_0059791 3300035089 Bacteria 1220
395 Ga0373949_0016356 3300035090 Bacteria 1662
396 Ga0373932_0001300 3300035112 Bacteria 7049
397 Ga0373932_0061451 3300035112 Bacteria 1143
398 Ga0373941_0022032 3300035115 Bacteria 1804
399 Ga0373941_0069535 3300035115 Bacteria 1165
400 Ga0373945_0025864 3300035116 Bacteria 2042
401 Ga0373960_0000715 3300035121 Bacteria 6900
402 Ga0373960_0004146 3300035121 Unclassified 3312
403 Ga0373960_0075368 3300035121 Bacteria 1052
404 Ga0373943_0008073 3300035170 Bacteria 4720
405 Ga0373943_0035190 3300035170 Bacteria 2392
406 Ga0373943_0036413 3300035170 Bacteria 2356
407 Ga0373946_0011292 3300035171 Bacteria 3329
408 Ga0373946_0266605 3300035171 Bacteria 839
409 Ga0373942_0003500 3300035207 Bacteria 3686
410 Ga0373961_0002632 3300035241 Bacteria 4610
411 Ga0373961_0076326 3300035241 Bacteria 1046
412 Ga0373962_0017658 3300035242 Bacteria 1850
413 Ga0373931_0005421 3300035691 Bacteria 5895
414 Ga0373931_0007806 3300035691 Bacteria 5056
415 Ga0373935_0048387 3300035692 Bacteria 2692
416 Ga0373927_0015946 3300035695 Bacteria 4959
417 Ga0373947_0000749 3300035725 Bacteria 19462
418 Ga0373947_0252946 3300035725 Bacteria 1165
419 Ga0373925_0007350 3300037068 Bacteria 8038
420 Ga0395899_0003797 3300037312 Bacteria 11928
421 Ga0395899_0004395 3300037312 Bacteria 10989
422 Ga0395899_0005269 3300037312 Bacteria 10044
423 Ga0395899_0007077 3300037312 Bacteria 8684
424 Ga0395899_0024716 3300037312 Bacteria 4541
425 Ga0395899_0051392 3300037312 Bacteria 3059
426 Ga0395899_0279527 3300037312 Unclassified 1136
427 Ga0395900_0002805 3300037418 Bacteria 19026
428 Ga0395900_0005085 3300037418 Bacteria 13803
429 Ga0395900_0008280 3300037418 Bacteria 10703
430 Ga0395900_0024784 3300037418 Bacteria 6141
431 Ga0395900_0026751 3300037418 Bacteria 5904
432 Ga0395900_0046996 3300037418 Bacteria 4444
433 Ga0395900_0071822 3300037418 Bacteria 3558
434 Ga0395900_0074442 3300037418 Bacteria 3491
435 Ga0395900_0159202 3300037418 Bacteria 2304
436 Ga0395900_0191056 3300037418 Bacteria 2077
437 Ga0395900_0210549 3300037418 Bacteria 1963
438 Ga0395900_0267091 3300037418 Bacteria 1707
439 Ga0395898_0001821 3300037466 Bacteria 27497
440 Ga0395898_0002929 3300037466 Bacteria 19412
441 Ga0395898_0010435 3300037466 Bacteria 9710
442 Ga0395898_0022231 3300037466 Bacteria 6426
443 Ga0395898_0030395 3300037466 Bacteria 5405
444 Ga0395898_0031689 3300037466 Bacteria 5280
445 Ga0395898_0039114 3300037466 Bacteria 4697
446 Ga0395898_0062449 3300037466 Bacteria 3617
447 Ga0395898_0123803 3300037466 Bacteria 2477
448 Ga0395898_0147719 3300037466 Bacteria 2250
449 Ga0395898_0330880 3300037466 Bacteria 1452
450 Ga0395898_0777068 3300037466 Unclassified 898
451 Ga0395905_0006879 3300037471 Bacteria 11369
452 Ga0395905_0008092 3300037471 Bacteria 10385
453 Ga0395905_0012742 3300037471 Bacteria 8087
454 Ga0395905_0016711 3300037471 Bacteria 6973
455 Ga0395905_0017066 3300037471 Bacteria 6893
456 Ga0395905_0019582 3300037471 Bacteria 6415
457 Ga0395905_0023688 3300037471 Bacteria 5796
458 Ga0395905_0077445 3300037471 Bacteria 3116
459 Ga0395905_0092557 3300037471 Bacteria 2835
460 Ga0395905_0142238 3300037471 Bacteria 2257
461 Ga0395905_0159497 3300037471 Bacteria 2120
462 Ga0395905_0275654 3300037471 Unclassified 1568
463 Ga0395905_0317574 3300037471 Unclassified 1447
464 Ga0395905_0412267 3300037471 Bacteria 1246
465 Ga0395901_0004120 3300038443 Bacteria 14646
466 Ga0395901_0005214 3300038443 Bacteria 13118
467 Ga0395901_0009262 3300038443 Bacteria 9984
468 Ga0395901_0009857 3300038443 Bacteria 9683
469 Ga0395901_0009875 3300038443 Bacteria 9673
470 Ga0395901_0016980 3300038443 Bacteria 7417
471 Ga0395901_0029310 3300038443 Bacteria 5665
472 Ga0395901_0038910 3300038443 Bacteria 4919
473 Ga0395901_0053953 3300038443 Bacteria 4177
474 Ga0395901_0066248 3300038443 Bacteria 3762
475 Ga0395901_0136266 3300038443 Bacteria 2580
476 Ga0395901_0162385 3300038443 Bacteria 2346
477 Ga0395901_0164928 3300038443 Bacteria 2326
478 Ga0395901_0198235 3300038443 Bacteria 2105
479 Ga0395901_0205527 3300038443 Unclassified 2063
480 Ga0436360_0923120 3300039438 Bacteria 2475
481 Ga0451789_1135361 3300041443 Bacteria 1315
482 Ga0451791_1677906 3300041451 Bacteria 2075
483 Ga0451800_0294813 3300041459 Bacteria 1599
484 Ga0451806_195080 3300041462 Bacteria 1180
485 Ga0451804_0887536 3300041463 Bacteria 2495
486 Ga0451807_2710088 3300041486 Bacteria 1061
487 Ga0451835_0532361 3300041492 Bacteria 2055
488 Ga0451839_1094689 3300041496 Bacteria 2422
489 Ga0451841_1399179 3300041498 Bacteria 2389
490 Ga0451849_0734362 3300041505 Bacteria 2520
491 Ga0451855_0878391 3300041511 Bacteria 4553
492 Ga0451853_0976575 3300041512 Bacteria 2999
493 Ga0439455_0017391 3300042012 Bacteria 1675
494 Ga0439464_0047626 3300042439 Bacteria 1234
495 Ga0466963_0012513 3300044694 Bacteria 5197
496 Ga0466963_0092161 3300044694 Bacteria 2065
497 Ga0466964_0000074 3300044706 Bacteria 22392
498 Ga0466964_0055012 3300044706 Unclassified 1642
499 Ga0466964_0066297 3300044706 Bacteria 1515
500 Ga0466968_0005495 3300044735 Bacteria 4744
501 Ga0466968_0058474 3300044735 Bacteria 1659
502 Ga0466960_0038383 3300044901 Bacteria 2251
503 Ga0466960_0191160 3300044901 Bacteria 1114
504 Ga0451576_0082519 3300045051 Bacteria 3343
505 Ga0466958_0073665 3300045836 Bacteria 2092
506 Ga0466967_0000085 3300045976 Bacteria 34226
507 Ga0466967_0029322 3300045976 Bacteria 4604
508 Ga0495603_0004227 3300046455 Bacteria 8548
509 Ga0495603_0051830 3300046455 Bacteria 2437
510 Ga0495603_0162313 3300046455 Bacteria 1296
511 Ga0495629_0087564 3300046459 Bacteria 2173
512 Ga0495641_0101545 3300046461 Bacteria 1283
513 Ga0495580_0202270 3300046472 Bacteria 1368
514 Ga0495582_0014808 3300046473 Bacteria 4285
515 Ga0495582_0067798 3300046473 Bacteria 1972
516 Ga0495605_0118298 3300046474 Bacteria 1203
517 Ga0495639_0031242 3300046475 Bacteria 2370
518 Ga0495662_0089718 3300046476 Bacteria 1498
519 Ga0495584_0052204 3300046491 Bacteria 2058
520 Ga0495584_0062891 3300046491 Bacteria 1865
521 Ga0495584_0077091 3300046491 Bacteria 1676
522 Ga0495585_0068129 3300046492 Bacteria 1945
523 Ga0495594_0007999 3300046499 Bacteria 5436
524 Ga0495596_0020418 3300046500 Bacteria 2713
525 Ga0495596_0066704 3300046500 Bacteria 1399
526 Ga0495583_0107827 3300046506 Bacteria 1183
527 Ga0495618_0151592 3300046514 Bacteria 1481
528 Ga0495630_0028470 3300046517 Bacteria 4151
529 Ga0495631_0037483 3300046518 Bacteria 2160
530 Ga0495631_0091480 3300046518 Unclassified 1310
531 Ga0495631_0111853 3300046518 Bacteria 1174
532 Ga0495644_0016606 3300046523 Bacteria 2818
533 Ga0495644_0079581 3300046523 Bacteria 1235
534 Ga0495644_0098729 3300046523 Unclassified 1104
535 Ga0495663_0041585 3300046525 Unclassified 1398
536 Ga0495666_0016966 3300046526 Bacteria 3624
537 Ga0495666_0111734 3300046526 Bacteria 1283
538 Ga0495642_0089134 3300046528 Unclassified 1305
539 Ga0495665_0150664 3300046531 Bacteria 1214
540 Ga0495665_0206062 3300046531 Bacteria 1019
541 Ga0495598_0042995 3300046537 Unclassified 1329
542 Ga0495609_0035990 3300046538 Bacteria 2238
543 Ga0495656_0121969 3300046615 Bacteria 1231
544 Ga0495668_0045234 3300046616 Bacteria 2447
545 Ga0495668_0078718 3300046616 Bacteria 1810
546 Ga0495635_0075695 3300046663 Bacteria 2306
547 Ga0495635_0242975 3300046663 Unclassified 1214
548 Ga0495659_0044845 3300046664 Unclassified 1591
549 Ga0495588_0004005 3300046674 Bacteria 6477
550 Ga0495588_0047299 3300046674 Bacteria 2208
551 Ga0495588_0067246 3300046674 Unclassified 1860
552 Ga0495647_0179014 3300046681 Bacteria 922
553 Ga0495658_0260153 3300046683 Bacteria 1092
554 Ga0495624_0043738 3300046690 Bacteria 2856
555 Ga0495670_0084185 3300046691 Bacteria 1623
556 Ga0495670_0091776 3300046691 Bacteria 1555
557 Ga0495589_0041606 3300046794 Bacteria 2292
558 Ga0495589_0093611 3300046794 Bacteria 1459
559 Ga0495589_0139544 3300046794 Bacteria 1161
560 Ga0495581_0010820 3300047315 Bacteria 5275
561 Ga0495636_0045838 3300047318 Bacteria 1823
562 Ga0495674_0305772 3300047319 Bacteria 1298
563 Ga0495676_0007215 3300047321 Bacteria 10194
564 Ga0495676_0030405 3300047321 Bacteria 4584
565 Ga0495676_0036162 3300047321 Bacteria 4126
566 Ga0495676_0083785 3300047321 Bacteria 2408
567 Ga0495676_0233572 3300047321 Bacteria 1262
568 Ga0495680_0006974 3300047322 Bacteria 10420
569 Ga0495683_0097204 3300047323 Bacteria 1420
570 Ga0495677_0037406 3300047445 Bacteria 1773
571 Ga0495684_0023917 3300047471 Bacteria 4699
572 Ga0495593_0188062 3300047673 Bacteria 1039
573 Ga0495614_0075677 3300048089 Bacteria 1455
574 Ga0496100_0004272 3300048903 Bacteria 7559
575 Ga0496100_0052824 3300048903 Bacteria 2643
576 Ga0496100_0363865 3300048903 Bacteria 1095
577 Ga0496100_0425270 3300048903 Bacteria 1015
578 Ga0496101_0011585 3300048904 Bacteria 5855
579 Ga0496101_0012742 3300048904 Bacteria 5621
580 Ga0496101_0119159 3300048904 Bacteria 1994
581 Ga0496101_0306482 3300048904 Bacteria 1244
582 Ga0496101_0572014 3300048904 Bacteria 893
583 Ga0496102_0013185 3300048905 Bacteria 7151
584 Ga0496102_0028507 3300048905 Bacteria 4987
585 Ga0496102_0068632 3300048905 Bacteria 3253
586 Ga0496102_0156622 3300048905 Bacteria 2141
587 Ga0496102_0165177 3300048905 Bacteria 2083
588 Ga0496102_0524002 3300048905 Bacteria 1108
589 Ga0496103_0010053 3300048906 Bacteria 5594
590 Ga0496103_0091345 3300048906 Bacteria 1921
591 Ga0496104_0000654 3300048907 Bacteria 29729
592 Ga0496104_0001021 3300048907 Bacteria 23944
593 Ga0496104_0008731 3300048907 Bacteria 9009
594 Ga0496104_0020456 3300048907 Bacteria 6068
595 Ga0496104_0615003 3300048907 Bacteria 996
596 Ga0496105_0005089 3300048908 Bacteria 9964
597 Ga0496105_0005405 3300048908 Bacteria 9694
598 Ga0496105_0006751 3300048908 Bacteria 8823
599 Ga0496105_0017361 3300048908 Bacteria 5767
600 Ga0496106_0022615 3300048909 Bacteria 4672
601 Ga0496106_0294849 3300048909 Bacteria 1300
602 Ga0496107_0008894 3300048910 Bacteria 6958
603 Ga0496107_0017194 3300048910 Bacteria 5087
604 Ga0496107_0022608 3300048910 Bacteria 4443
605 Ga0496107_0079380 3300048910 Bacteria 2392
606 Ga0496107_0101918 3300048910 Bacteria 2105
607 Ga0496108_0001366 3300048911 Bacteria 19192
608 Ga0496108_0002313 3300048911 Bacteria 15258
609 Ga0496108_0009368 3300048911 Bacteria 7925
610 Ga0496108_0065911 3300048911 Bacteria 3053
611 Ga0496108_0067431 3300048911 Bacteria 3018
612 Ga0496108_0075648 3300048911 Bacteria 2845
613 Ga0496108_0428702 3300048911 Unclassified 1155
614 Ga0496109_0009592 3300048912 Bacteria 8254
615 Ga0496109_0012212 3300048912 Bacteria 7409
616 Ga0496109_0020631 3300048912 Bacteria 5822
617 Ga0496109_0040143 3300048912 Bacteria 4238
618 Ga0496109_0048012 3300048912 Bacteria 3883
619 Ga0496109_0050312 3300048912 Bacteria 3795
620 Ga0496109_0062509 3300048912 Bacteria 3405
621 Ga0496109_0069099 3300048912 Bacteria 3239
622 Ga0496109_0204306 3300048912 Bacteria 1857
623 Ga0496109_0381137 3300048912 Bacteria 1332
624 Ga0496110_0004394 3300048913 Bacteria 10920
625 Ga0496110_0008576 3300048913 Bacteria 8231
626 Ga0496110_0098067 3300048913 Bacteria 2626
627 Ga0496110_0298850 3300048913 Bacteria 1466
628 Ga0496110_0390461 3300048913 Bacteria 1268
629 Ga0496110_0436688 3300048913 Bacteria 1193
630 Ga0496110_0438821 3300048913 Bacteria 1190
631 Ga0496111_0000144 3300048914 Bacteria 31915
632 Ga0496111_0005146 3300048914 Bacteria 8338
633 Ga0496111_0005654 3300048914 Bacteria 8050
634 Ga0496111_0091267 3300048914 Bacteria 2232
635 Ga0496112_0014729 3300048915 Bacteria 7271
636 Ga0496112_0022689 3300048915 Bacteria 5986
637 Ga0496112_0055715 3300048915 Bacteria 3888
638 Ga0496112_0148877 3300048915 Bacteria 2308
639 Ga0496112_0178705 3300048915 Unclassified 2086
640 Ga0496112_0220163 3300048915 Bacteria 1854
641 Ga0496112_0259474 3300048915 Bacteria 1687
642 Ga0496112_0268932 3300048915 Bacteria 1653
643 Ga0496112_0569909 3300048915 Unclassified 1065
644 Ga0496113_0016601 3300048916 Bacteria 5089
645 Ga0496113_0107137 3300048916 Bacteria 2171
646 Ga0496113_0346387 3300048916 Unclassified 1192
647 Ga0496113_0380168 3300048916 Unclassified 1133
648 Ga0496114_0038816 3300048917 Bacteria 3940
649 Ga0496114_0044717 3300048917 Bacteria 3675
650 Ga0496114_0110449 3300048917 Bacteria 2355
651 Ga0496114_0354371 3300048917 Bacteria 1298
652 Ga0496115_0008795 3300048918 Bacteria 7481
653 Ga0496115_0011570 3300048918 Bacteria 6615
654 Ga0496115_0011987 3300048918 Bacteria 6514
655 Ga0496115_0085906 3300048918 Bacteria 2566
656 Ga0501040_0151104 3300049576 Unclassified 1638
657 Ga0501041_0196555 3300049577 Unclassified 1264
658 Ga0501042_0251589 3300049578 Unclassified 1275
659 Ga0501067_0005975 3300049583 Bacteria 6749
660 Ga0501067_0142618 3300049583 Bacteria 1334
661 Ga0501069_0013210 3300049585 Bacteria 4399
662 Ga0501070_0076846 3300049586 Bacteria 2764
663 Ga0501075_0461102 3300049591 Unclassified 969
664 Ga0501079_0173369 3300049741 Unclassified 1682
665 Ga0501080_0237148 3300049742 Bacteria 1666
666 Ga0501081_0085485 3300049743 Bacteria 2214
667 Ga0501045_0478590 3300049824 Bacteria 925
668 nmdc:mga0yw44_45111_c1 3300050492 Bacteria 2641
669 nmdc:mga05p37_25240_c1 3300050507 Bacteria 7227
670 nmdc:mga05p37_267747_c1 3300050507 Bacteria 2043
671 nmdc:mga05p37_308934_c1 3300050507 Bacteria 1875
672 nmdc:mga05p37_644494_c1 3300050507 Bacteria 1187
673 nmdc:mga05p37_99478_c1 3300050507 Bacteria 3582
674 nmdc:mga09592_369187_c1 3300050508 Bacteria 1241
675 nmdc:mga0qj67_14604_c1 3300050509 Bacteria 5937
676 nmdc:mga06r32_221514_c1 3300050510 Bacteria 1880
677 nmdc:mga06r32_463758_c1 3300050510 Bacteria 1246
678 nmdc:mga08y16_119539_c1 3300050511 Bacteria 2743
679 nmdc:mga08y16_203455_c1 3300050511 Unclassified 2051
680 nmdc:mga08y16_413703_c1 3300050511 Bacteria 1379
681 nmdc:mga0n895_280209_c1 3300050512 Bacteria 1691
682 nmdc:mga0n895_430448_c1 3300050512 Unclassified 1333
683 nmdc:mga0n895_57562_c1 3300050512 Bacteria 3832
684 nmdc:mga0n895_79791_c1 3300050512 Bacteria 3260
685 nmdc:mga0n895_91096_c1 3300050512 Bacteria 3051
686 nmdc:mga0rr50_143562_c1 3300050513 Bacteria 1923
687 nmdc:mga0rr50_43590_c1 3300050513 Bacteria 3285
688 nmdc:mga0rr50_45289_c1 3300050513 Bacteria 3232
689 nmdc:mga0rr50_64016_c1 3300050513 Bacteria 2780
690 nmdc:mga0rr50_9029_c1 3300050513 Bacteria 6238
691 nmdc:mga0rr50_98741_c1 3300050513 Unclassified 2289
692 nmdc:mga08x19_153510_c1 3300050514 Bacteria 1561
693 nmdc:mga08x19_49972_c1 3300050514 Bacteria 2683
694 nmdc:mga0a205_43348_c1 3300050515 Bacteria 4339
695 Ga0495601_0476234 3300053077 Bacteria 807
696 Ga0495595_0018078 3300053084 Bacteria 3042
697 Ga0495619_0032393 3300053085 Bacteria 3392
698 Ga0501084_0255618 3300054114 Bacteria 1479
699 Ga0501084_0282538 3300054114 Bacteria 1402
700 Ga0587083_0046856 3300059505 Bacteria 928
701 Ga0530510_0011036 3300061734 Bacteria 6337
702 Ga0075428_100199429
703 JGI24744J21845_10007414
704 JGI25407J50210_10000558
705 Ga0070676_10089953
706 Ga0070683_100002197
707 Ga0070683_100020219
708 Ga0070683_100108468
709 Ga0070683_100139151
710 Ga0070690_100256595
711 Ga0068869_100286991
712 Ga0068869_100680369
713 Ga0070666_10307929
714 Ga0070680_100064676
715 Ga0070680_100118192
716 Ga0070680_100128834
717 Ga0070682_100012226
718 Ga0068868_100016225
719 Ga0068868_100107174
720 Ga0068868_100111565
721 Ga0068868_100273075
722 Ga0068868_100381686
723 Ga0068868_100598448
724 Ga0070660_100011699
725 Ga0070660_100393880
726 Ga0070689_100015560
727 Ga0070689_100254509
728 Ga0070691_10020184
729 Ga0070691_10020298
730 Ga0070692_10020127
731 Ga0070692_10038999
732 Ga0070668_100005010
733 Ga0070668_100016085
734 Ga0070669_100394688
735 Ga0070671_100016630
736 Ga0070671_100080995
737 Ga0070674_100041134
738 Ga0070673_100539474
739 Ga0070673_100659856
740 Ga0070688_100011685
741 Ga0070688_100054452
742 Ga0070659_100031080
743 Ga0070659_100117847
744 Ga0070659_100515172
745 Ga0070659_100861822
746 Ga0070667_100110520
747 Ga0070703_10009816
748 Ga0070703_10012046
749 Ga0070713_100430077
750 Ga0070713_100658590
751 Ga0070710_10027406
752 Ga0070710_10035305
753 Ga0070710_10044088
754 Ga0070701_10020160
755 Ga0070711_100001144
756 Ga0070711_100101546
757 Ga0070705_100005343
758 Ga0070705_100009138
759 Ga0070705_100012231
760 Ga0070705_100026458
761 Ga0070705_100039162
762 Ga0070705_100050151
763 Ga0070705_100102991
764 Ga0070700_100007946
765 Ga0070700_100321162
766 Ga0070694_100025028
767 Ga0070694_100161656
768 Ga0070694_100389465
769 Ga0070708_100069276
770 Ga0070708_100342710
771 Ga0070663_100121034
772 Ga0070678_100010550
773 Ga0070678_100096056
774 Ga0070678_100213671
775 Ga0070662_100036405
776 Ga0070662_100169863
777 Ga0070681_10011953
778 Ga0070681_10052560
779 Ga0068867_100013318
780 Ga0068867_100053155
781 Ga0068867_100161556
782 Ga0068867_100310101
783 Ga0070685_10155493
784 Ga0070706_100020810
785 Ga0070706_100028038
786 Ga0070706_100089965
787 Ga0070706_100190059
788 Ga0070707_100026202
789 Ga0070698_100010941
790 Ga0070698_100169255
791 Ga0070698_100268902
792 Ga0070699_100023224
793 Ga0070699_100053256
794 Ga0070699_100076885
795 Ga0070699_100410160
796 Ga0070679_100005825
797 Ga0070679_100208067
798 Ga0070684_100007207
799 Ga0070684_100025193
800 Ga0070684_100042071
801 Ga0070684_100061086
802 Ga0070697_100101861
803 Ga0070697_100219121
804 Ga0068853_100028151
805 Ga0070672_100045592
806 Ga0070672_100111706
807 Ga0070672_100326865
808 Ga0070686_100007022
809 Ga0070686_100029459
810 Ga0070695_100048599
811 Ga0070695_100083582
812 Ga0070695_100145410
813 Ga0070695_100157306
814 Ga0070696_100005071
815 Ga0070696_100017185
816 Ga0070696_100060877
817 Ga0070696_100100302
818 Ga0070696_100613121
819 Ga0070693_100012521
820 Ga0070693_100015386
821 Ga0070693_100018792
822 Ga0070693_100090375
823 Ga0070704_100141977
824 Ga0070704_100223084
825 Ga0070704_100458536
826 Ga0068855_100018218
827 Ga0068855_100143195
828 Ga0068855_100284095
829 Ga0068855_100353804
830 Ga0068855_100393015
831 Ga0068857_100010134
832 Ga0068857_100062591
833 Ga0068854_100006403
834 Ga0068854_100127321
835 Ga0068856_100006244
836 Ga0068856_100015364
837 Ga0068856_100048213
838 Ga0068856_100411735
839 Ga0068856_100466098
840 Ga0070702_100020621
841 Ga0070702_100026383
842 Ga0070702_100065014
843 Ga0068864_100280972
844 Ga0068866_10003857
845 Ga0068866_10058356
846 Ga0068866_10441468
847 Ga0068861_100027194
848 Ga0068851_10194033
849 Ga0068860_100139091
850 Ga0068860_100151524
851 Ga0068860_100248385
852 Ga0081455_10002168
853 Ga0081455_10027563
854 Ga0081455_10064378
855 Ga0081455_10105421
856 Ga0081455_10314464
857 Ga0081538_10000361
858 Ga0081538_10000795
859 Ga0081538_10062594
860 Ga0081540_1000836
861 Ga0081540_1002829
862 Ga0081540_1003929
863 Ga0070717_10015579
864 Ga0070717_10276277
865 Ga0070717_10774776
866 Ga0075365_10021647
867 Ga0075365_10164730
868 Ga0075432_10036902
869 Ga0070715_10012587
870 Ga0070715_10033213
871 Ga0070715_10090218
872 Ga0070716_100074904
873 Ga0070712_100002015
874 Ga0070712_100048608
875 Ga0070712_100080151
876 Ga0097621_100011354
877 Ga0068871_100021747
878 Ga0068871_100026438
879 Ga0075428_100066920
880 Ga0075428_100277932
881 Ga0075430_100046842
882 Ga0075431_100061008
883 Ga0075431_100075417
884 Ga0075433_10048775
885 Ga0075433_10248760
886 Ga0075434_100166472
887 Ga0075434_100294603
888 Ga0075436_100030768
889 Ga0075436_100051044
890 Ga0075436_100074215
891 Ga0075435_100018593
892 Ga0075435_100023563
893 Ga0075435_100072619
894 Ga0075435_100104404
895 Ga0105240_10168916
896 Ga0105240_10284495
897 Ga0111539_10132901
898 Ga0111539_10190148
899 Ga0111539_10302316
900 Ga0111539_10638354
901 Ga0105245_10018759
902 Ga0105245_10245991
903 Ga0105245_10628173
904 Ga0105247_10104196
905 Ga0105247_10449419
906 Ga0114129_10018702
907 Ga0114129_10028476
908 Ga0114129_10157822
909 Ga0114129_10267683
910 Ga0114129_10344075
911 Ga0114129_10821335
912 Ga0114129_11042501
913 Ga0105243_10003921
914 Ga0105243_10006547
915 Ga0105243_10029032
916 Ga0105243_10064707
917 Ga0105243_10168938
918 Ga0105243_11056215
919 Ga0105241_10030769
920 Ga0105241_10455893
921 Ga0105241_10509724
922 Ga0105242_10095002
923 Ga0105242_10107978
924 Ga0105242_10275209
925 Ga0105242_10395497
926 Ga0105242_10451424
927 Ga0105248_10006882
928 Ga0105248_10489308
929 Ga0105237_10098088
930 Ga0105237_10412854
931 Ga0105238_10042715
932 Ga0105249_10003964
933 Ga0105249_10013936
934 Ga0105249_10323783
935 Ga0105249_10583682
936 Ga0105246_10035463
937 Ga0105246_10242533
938 Ga0157371_10083395
939 Ga0157370_10047827
940 Ga0157369_10576314
941 Ga0157374_10026155
942 Ga0157374_10221741
943 Ga0157374_10742822
944 Ga0157378_10068908
945 Ga0157378_10069015
946 Ga0157378_10318970
947 Ga0163162_10005877
948 Ga0163162_10062591
949 Ga0163162_10116178
950 Ga0163162_10464388
951 Ga0157375_10043262
952 Ga0157375_10263450
953 Ga0163163_10024110
954 Ga0157380_10075110
955 Ga0157377_10056037
956 Ga0157377_10246028
957 Ga0157379_10624786
958 Ga0157376_10007598
959 Ga0157376_10035080
960 Ga0224712_10042297
961 Ga0207653_10056216
962 Ga0207692_10014051
963 Ga0207692_10041837
964 Ga0207642_10002665
965 Ga0207688_10078718
966 Ga0207688_10101416
967 Ga0207688_10104784
968 Ga0207647_10106264
969 Ga0207685_10005762
970 Ga0207685_10029854
971 Ga0207685_10161676
972 Ga0207699_10022007
973 Ga0207699_10083814
974 Ga0207699_10086257
975 Ga0207699_10226256
976 Ga0207684_10136773
977 Ga0207684_10203818
978 Ga0207684_10413395
979 Ga0207654_10045383
980 Ga0207654_10049818
981 Ga0207654_10069834
982 Ga0207707_10351885
983 Ga0207671_10741021
984 Ga0207693_10001754
985 Ga0207693_10005169
986 Ga0207693_10014460
987 Ga0207693_10086893
988 Ga0207693_10213061
989 Ga0207663_10030048
990 Ga0207663_10042415
991 Ga0207663_10149382
992 Ga0207663_10189107
993 Ga0207660_10082537
994 Ga0207660_10123410
995 Ga0207660_10277461
996 Ga0207662_10014548
997 Ga0207662_10162680
998 Ga0207657_10020124
999 Ga0207652_10009702
1000 Ga0207652_10209112
1001 Ga0207646_10010720
1002 Ga0207646_10020464
1003 Ga0207681_10092286
1004 Ga0207694_10096333
1005 Ga0207687_10014541
1006 Ga0207700_10277472
1007 Ga0207664_10087593
1008 Ga0207644_10064658
1009 Ga0207690_10151310
1010 Ga0207706_10005210
1011 Ga0207686_10044127
1012 Ga0207686_10131652
1013 Ga0207709_10014190
1014 Ga0207709_10021892
1015 Ga0207709_10053694
1016 Ga0207709_10061462
1017 Ga0207709_10542218
1018 Ga0207670_10011870
1019 Ga0207669_10340371
1020 Ga0207704_10035413
1021 Ga0207665_10001527
1022 Ga0207665_10030514
1023 Ga0207665_10361366
1024 Ga0207691_10002643
1025 Ga0207691_10121873
1026 Ga0207711_10061100
1027 Ga0207689_10078101
1028 Ga0207661_10021855
1029 Ga0207661_10023006
1030 Ga0207661_10072784
1031 Ga0207661_10113938
1032 Ga0207667_10020628
1033 Ga0207651_10153591
1034 Ga0207651_10361047
1035 Ga0207712_10003765
1036 Ga0207712_10004878
1037 Ga0207712_10328732
1038 Ga0207668_10013595
1039 Ga0207668_10066612
1040 Ga0207640_10101833
1041 Ga0207640_10406128
1042 Ga0207640_10561886
1043 Ga0207658_10366959
1044 Ga0207677_10071251
1045 Ga0207677_10088916
1046 Ga0207677_10475087
1047 Ga0207678_10056287
1048 Ga0207678_10197110
1049 Ga0207678_10222378
1050 Ga0207678_10490831
1051 Ga0207708_10004755
1052 Ga0207702_10003702
1053 Ga0207702_10069185
1054 Ga0207702_10297717
1055 Ga0207702_10733873
1056 Ga0207648_10000150
1057 Ga0207648_10027855
1058 Ga0207648_10296658
1059 Ga0207674_10008931
1060 Ga0207674_10059854
1061 Ga0207675_100000664
1062 Ga0207675_100011845
1063 Ga0207675_100054109
1064 Ga0207675_100097748
1065 Ga0207683_10000131
1066 Ga0207683_10000973
1067 Ga0207683_10081814
1068 Ga0207683_10122346
1069 Ga0207698_10121691
1070 Ga0207428_10003178
1071 Ga0207428_10142836
1072 Ga0268265_10219065
1073 Ga0268265_10272334
1074 Ga0268265_10274317
1075 Ga0268264_10163371
1076 Ga0265338_10071361
1077 Ga0265327_10034849
1078 Ga0265327_10114544
1079 Ga0265327_10242439
1080 Ga0307413_10206311
1081 Ga0307409_100087628
1082 Ga0307409_100126628
1083 Ga0307416_100054820
1084 Ga0307416_100075241
1085 Ga0307416_100124970
1086 Ga0307415_100196094
1087 Ga0307415_100261757
1088 Ga0373930_0005529
1089 Ga0373930_0035830
1090 Ga0373948_0006404
1091 Ga0373929_0007869
1092 Ga0373940_0003245
1093 Ga0373940_0003563
1094 Ga0373944_0030842
1095 Ga0373944_0059791
1096 Ga0373949_0016356
1097 Ga0373932_0001300
1098 Ga0373932_0061451
1099 Ga0373941_0022032
1100 Ga0373941_0069535
1101 Ga0373945_0025864
1102 Ga0373960_0000715
1103 Ga0373960_0004146
1104 Ga0373960_0075368
1105 Ga0373943_0008073
1106 Ga0373943_0035190
1107 Ga0373943_0036413
1108 Ga0373946_0011292
1109 Ga0373946_0266605
1110 Ga0373942_0003500
1111 Ga0373961_0002632
1112 Ga0373961_0076326
1113 Ga0373962_0017658
1114 Ga0373931_0005421
1115 Ga0373931_0007806
1116 Ga0373935_0048387
1117 Ga0373927_0015946
1118 Ga0373947_0000749
1119 Ga0373947_0252946
1120 Ga0373925_0007350
1121 Ga0395899_0003797
1122 Ga0395899_0004395
1123 Ga0395899_0005269
1124 Ga0395899_0007077
1125 Ga0395899_0024716
1126 Ga0395899_0051392
1127 Ga0395899_0279527
1128 Ga0395900_0002805
1129 Ga0395900_0005085
1130 Ga0395900_0008280
1131 Ga0395900_0024784
1132 Ga0395900_0026751
1133 Ga0395900_0046996
1134 Ga0395900_0071822
1135 Ga0395900_0074442
1136 Ga0395900_0159202
1137 Ga0395900_0191056
1138 Ga0395900_0210549
1139 Ga0395900_0267091
1140 Ga0395898_0001821
1141 Ga0395898_0002929
1142 Ga0395898_0010435
1143 Ga0395898_0022231
1144 Ga0395898_0030395
1145 Ga0395898_0031689
1146 Ga0395898_0039114
1147 Ga0395898_0062449
1148 Ga0395898_0123803
1149 Ga0395898_0147719
1150 Ga0395898_0330880
1151 Ga0395898_0777068
1152 Ga0395905_0006879
1153 Ga0395905_0008092
1154 Ga0395905_0012742
1155 Ga0395905_0016711
1156 Ga0395905_0017066
1157 Ga0395905_0019582
1158 Ga0395905_0023688
1159 Ga0395905_0077445
1160 Ga0395905_0092557
1161 Ga0395905_0142238
1162 Ga0395905_0159497
1163 Ga0395905_0275654
1164 Ga0395905_0317574
1165 Ga0395905_0412267
1166 Ga0395901_0004120
1167 Ga0395901_0005214
1168 Ga0395901_0009262
1169 Ga0395901_0009857
1170 Ga0395901_0009875
1171 Ga0395901_0016980
1172 Ga0395901_0029310
1173 Ga0395901_0038910
1174 Ga0395901_0053953
1175 Ga0395901_0066248
1176 Ga0395901_0136266
1177 Ga0395901_0162385
1178 Ga0395901_0164928
1179 Ga0395901_0198235
1180 Ga0395901_0205527
1181 Ga0436360_0923120
1182 Ga0451789_1135361
1183 Ga0451791_1677906
1184 Ga0451800_0294813
1185 Ga0451806_195080
1186 Ga0451804_0887536
1187 Ga0451807_2710088
1188 Ga0451835_0532361
1189 Ga0451839_1094689
1190 Ga0451841_1399179
1191 Ga0451849_0734362
1192 Ga0451855_0878391
1193 Ga0451853_0976575
1194 Ga0439455_0017391
1195 Ga0439464_0047626
1196 Ga0466963_0012513
1197 Ga0466963_0092161
1198 Ga0466964_0000074
1199 Ga0466964_0055012
1200 Ga0466964_0066297
1201 Ga0466968_0005495
1202 Ga0466968_0058474
1203 Ga0466960_0038383
1204 Ga0466960_0191160
1205 Ga0451576_0082519
1206 Ga0466958_0073665
1207 Ga0466967_0000085
1208 Ga0466967_0029322
1209 Ga0495603_0004227
1210 Ga0495603_0051830
1211 Ga0495603_0162313
1212 Ga0495629_0087564
1213 Ga0495641_0101545
1214 Ga0495580_0202270
1215 Ga0495582_0014808
1216 Ga0495582_0067798
1217 Ga0495605_0118298
1218 Ga0495639_0031242
1219 Ga0495662_0089718
1220 Ga0495584_0052204
1221 Ga0495584_0062891
1222 Ga0495584_0077091
1223 Ga0495585_0068129
1224 Ga0495594_0007999
1225 Ga0495596_0020418
1226 Ga0495596_0066704
1227 Ga0495583_0107827
1228 Ga0495618_0151592
1229 Ga0495630_0028470
1230 Ga0495631_0037483
1231 Ga0495631_0091480
1232 Ga0495631_0111853
1233 Ga0495644_0016606
1234 Ga0495644_0079581
1235 Ga0495644_0098729
1236 Ga0495663_0041585
1237 Ga0495666_0016966
1238 Ga0495666_0111734
1239 Ga0495642_0089134
1240 Ga0495665_0150664
1241 Ga0495665_0206062
1242 Ga0495598_0042995
1243 Ga0495609_0035990
1244 Ga0495656_0121969
1245 Ga0495668_0045234
1246 Ga0495668_0078718
1247 Ga0495635_0075695
1248 Ga0495635_0242975
1249 Ga0495659_0044845
1250 Ga0495588_0004005
1251 Ga0495588_0047299
1252 Ga0495588_0067246
1253 Ga0495647_0179014
1254 Ga0495658_0260153
1255 Ga0495624_0043738
1256 Ga0495670_0084185
1257 Ga0495670_0091776
1258 Ga0495589_0041606
1259 Ga0495589_0093611
1260 Ga0495589_0139544
1261 Ga0495581_0010820
1262 Ga0495636_0045838
1263 Ga0495674_0305772
1264 Ga0495676_0007215
1265 Ga0495676_0030405
1266 Ga0495676_0036162
1267 Ga0495676_0083785
1268 Ga0495676_0233572
1269 Ga0495680_0006974
1270 Ga0495683_0097204
1271 Ga0495677_0037406
1272 Ga0495684_0023917
1273 Ga0495593_0188062
1274 Ga0495614_0075677
1275 Ga0496100_0004272
1276 Ga0496100_0052824
1277 Ga0496100_0363865
1278 Ga0496100_0425270
1279 Ga0496101_0011585
1280 Ga0496101_0012742
1281 Ga0496101_0119159
1282 Ga0496101_0306482
1283 Ga0496101_0572014
1284 Ga0496102_0013185
1285 Ga0496102_0028507
1286 Ga0496102_0068632
1287 Ga0496102_0156622
1288 Ga0496102_0165177
1289 Ga0496102_0524002
1290 Ga0496103_0010053
1291 Ga0496103_0091345
1292 Ga0496104_0000654
1293 Ga0496104_0001021
1294 Ga0496104_0008731
1295 Ga0496104_0020456
1296 Ga0496104_0615003
1297 Ga0496105_0005089
1298 Ga0496105_0005405
1299 Ga0496105_0006751
1300 Ga0496105_0017361
1301 Ga0496106_0022615
1302 Ga0496106_0294849
1303 Ga0496107_0008894
1304 Ga0496107_0017194
1305 Ga0496107_0022608
1306 Ga0496107_0079380
1307 Ga0496107_0101918
1308 Ga0496108_0001366
1309 Ga0496108_0002313
1310 Ga0496108_0009368
1311 Ga0496108_0065911
1312 Ga0496108_0067431
1313 Ga0496108_0075648
1314 Ga0496108_0428702
1315 Ga0496109_0009592
1316 Ga0496109_0012212
1317 Ga0496109_0020631
1318 Ga0496109_0040143
1319 Ga0496109_0048012
1320 Ga0496109_0050312
1321 Ga0496109_0062509
1322 Ga0496109_0069099
1323 Ga0496109_0204306
1324 Ga0496109_0381137
1325 Ga0496110_0004394
1326 Ga0496110_0008576
1327 Ga0496110_0098067
1328 Ga0496110_0298850
1329 Ga0496110_0390461
1330 Ga0496110_0436688
1331 Ga0496110_0438821
1332 Ga0496111_0000144
1333 Ga0496111_0005146
1334 Ga0496111_0005654
1335 Ga0496111_0091267
1336 Ga0496112_0014729
1337 Ga0496112_0022689
1338 Ga0496112_0055715
1339 Ga0496112_0148877
1340 Ga0496112_0178705
1341 Ga0496112_0220163
1342 Ga0496112_0259474
1343 Ga0496112_0268932
1344 Ga0496112_0569909
1345 Ga0496113_0016601
1346 Ga0496113_0107137
1347 Ga0496113_0346387
1348 Ga0496113_0380168
1349 Ga0496114_0038816
1350 Ga0496114_0044717
1351 Ga0496114_0110449
1352 Ga0496114_0354371
1353 Ga0496115_0008795
1354 Ga0496115_0011570
1355 Ga0496115_0011987
1356 Ga0496115_0085906
1357 Ga0501040_0151104
1358 Ga0501041_0196555
1359 Ga0501042_0251589
1360 Ga0501067_0005975
1361 Ga0501067_0142618
1362 Ga0501069_0013210
1363 Ga0501070_0076846
1364 Ga0501075_0461102
1365 Ga0501079_0173369
1366 Ga0501080_0237148
1367 Ga0501081_0085485
1368 Ga0501045_0478590
1369 nmdc:mga0yw44_45111_c1
1370 nmdc:mga05p37_25240_c1
1371 nmdc:mga05p37_267747_c1
1372 nmdc:mga05p37_308934_c1
1373 nmdc:mga05p37_644494_c1
1374 nmdc:mga05p37_99478_c1
1375 nmdc:mga09592_369187_c1
1376 nmdc:mga0qj67_14604_c1
1377 nmdc:mga06r32_221514_c1
1378 nmdc:mga06r32_463758_c1
1379 nmdc:mga08y16_119539_c1
1380 nmdc:mga08y16_203455_c1
1381 nmdc:mga08y16_413703_c1
1382 nmdc:mga0n895_280209_c1
1383 nmdc:mga0n895_430448_c1
1384 nmdc:mga0n895_57562_c1
1385 nmdc:mga0n895_79791_c1
1386 nmdc:mga0n895_91096_c1
1387 nmdc:mga0rr50_143562_c1
1388 nmdc:mga0rr50_43590_c1
1389 nmdc:mga0rr50_45289_c1
1390 nmdc:mga0rr50_64016_c1
1391 nmdc:mga0rr50_9029_c1
1392 nmdc:mga0rr50_98741_c1
1393 nmdc:mga08x19_153510_c1
1394 nmdc:mga08x19_49972_c1
1395 nmdc:mga0a205_43348_c1
1396 Ga0495601_0476234
1397 Ga0495595_0018078
1398 Ga0495619_0032393
1399 Ga0501084_0255618
1400 Ga0501084_0282538
1401 Ga0587083_0046856
1402 Ga0530510_0011036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14378

PAP2_3

PAP2 superfamily

73

246

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7297 45 237
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7136 45 237
7f17-assembly3.cif.gz_C crystal structure of acid phosphatase 0.6654 58 233
7f18-assembly3.cif.gz_C crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) 0.6461 58 246
7f18-assembly2.cif.gz_B crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) 0.6432 58 233
ID Description Score Start End Superfamily
af_A0A1D8PEJ5_1_514_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7661 57 237 1.20.144.10
af_Q9VNU1_94_287_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6903 111 235 1.20.144.10
af_Q4D544_53_235_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6825 66 232 1.20.144.10
af_Q7KGH1_136_350_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6794 108 239 1.20.144.10
af_Q75HI8_51_243_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.671 65 244 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A1M3BKD4-F1-model_v4 Inositolphosphotransferase Aur1/Ipt1 domain-containing protein 0.9525 25 234 GO:0016020
AF-A0A538AKW2-F1-model_v4 Inositol phosphorylceramide synthase 0.949 10 245 GO:0016020
AF-A0A7V8ZEQ2-F1-model_v4 Phosphatase PAP2 family protein 0.9393 10 233 GO:0016020
AF-A0A7V9GTD5-F1-model_v4 Phosphatase PAP2 family protein 0.9389 12 237 GO:0016020
AF-A0A537XGC1-F1-model_v4 Inositol phosphorylceramide synthase 0.9346 11 233 GO:0016020

Map