F476166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 280 | 1402 | 344 |
Family's Representative Sequence
| Representative Sequence | 3300042014|Ga0439457_019488|Ga0439457_019488_432_1463 |
| Length | 326 |
| Sequence | MARFNRRDSFNLLTKLTLRRGWNGMKVLSSYYISKWTKRPIQWGYPVSISFEPTTSCNLRCPECPSGLRAFTRPTGMLQKDFFSETIDQLYKELLYLVFYFQGEPYLNPSFLDMVKYASSKKIYTAESGLDRLIISIDGTTQDTYQQYRVGGKLEKVIEGAKNIVKWKKELKSKTPFVVFQFLVVKHNEHQIEDVKRLAKEIGVDDVWFKTAQVYDYENDPNNLIPTIDKYSRYRKTENGTEFKGKLANQCWRLWHDPVITWDGLVAPCCFDKDAQHRLGNLKEKSFKEIWKNGEYTKFRTQILKGRKNIDICANCSEGTRVWEQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 193 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 232 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 233 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 234 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 241 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 249 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 250 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 251 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 252 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 253 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 255 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 256 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 258 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 259 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 260 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 262 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 263 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 266 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 267 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 268 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 269 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 270 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 271 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 272 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 273 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 274 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 275 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 276 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 277 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 278 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 279 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 280 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.72 |
| Metatranscriptomes | 0 |
| Isolates | 2.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.99 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 87.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439457_019488 | 3300042014 | Bacteria | 1507 |
| 2 | MRS1b_contig_6702855 | 2162886011 | Bacteria | 1267 |
| 3 | JGI24740J21852_10000831 | 3300001979 | Bacteria | 13614 |
| 4 | JGI24740J21852_10022792 | 3300001979 | Bacteria | 2149 |
| 5 | JGI24739J22299_10000062 | 3300001989 | Bacteria | 29944 |
| 6 | JGI24739J22299_10004648 | 3300001989 | Bacteria | 5250 |
| 7 | JGI25154J39366_1000023 | 3300002738 | Bacteria | 219569 |
| 8 | JGI25157J39369_1004301 | 3300002741 | Bacteria | 2631 |
| 9 | JGI25159J45721_1006767 | 3300002987 | Bacteria | 3375 |
| 10 | JGI25406J46586_10004455 | 3300003203 | Bacteria | 6519 |
| 11 | rootH2_10005170 | 3300003320 | Bacteria | 79894 |
| 12 | rootH2_10048291 | 3300003320 | Bacteria | 12301 |
| 13 | rootH2_10053079 | 3300003320 | Bacteria | 20935 |
| 14 | rootL2_10052422 | 3300003322 | Bacteria | 10016 |
| 15 | rootL2_10055066 | 3300003322 | Bacteria | 6394 |
| 16 | rootL2_10207553 | 3300003322 | Bacteria | 2559 |
| 17 | rootL2_10227712 | 3300003322 | Bacteria | 2797 |
| 18 | rootL2_10230701 | 3300003322 | Bacteria | 1795 |
| 19 | rootH1_10084646 | 3300003323 | Bacteria | 11123 |
| 20 | JGI25160J50197_1009788 | 3300003354 | Bacteria | 3522 |
| 21 | Ga0055542_1003316 | 3300003762 | Bacteria | 4452 |
| 22 | Ga0055528_1001041 | 3300003790 | Bacteria | 18297 |
| 23 | Ga0055530_10000118 | 3300003791 | Bacteria | 68596 |
| 24 | Ga0055531_10000054 | 3300003794 | Bacteria | 123684 |
| 25 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 26 | Ga0065714_10077181 | 3300005288 | Bacteria | 2714 |
| 27 | Ga0065712_10003045 | 3300005290 | Unclassified | 3975 |
| 28 | Ga0065712_10107679 | 3300005290 | Bacteria | 1888 |
| 29 | Ga0070658_10000512 | 3300005327 | Bacteria | 33597 |
| 30 | Ga0070658_10295595 | 3300005327 | Unclassified | 1381 |
| 31 | Ga0070676_10000439 | 3300005328 | Bacteria | 19781 |
| 32 | Ga0070676_10001998 | 3300005328 | Bacteria | 10370 |
| 33 | Ga0070676_10002273 | 3300005328 | Bacteria | 9809 |
| 34 | Ga0070676_10137424 | 3300005328 | Unclassified | 1552 |
| 35 | Ga0070676_10228383 | 3300005328 | Bacteria | 1233 |
| 36 | Ga0070670_100011898 | 3300005331 | Bacteria | 7441 |
| 37 | Ga0070670_100068834 | 3300005331 | Bacteria | 3038 |
| 38 | Ga0070670_100079936 | 3300005331 | Unclassified | 2810 |
| 39 | Ga0070670_100097738 | 3300005331 | Unclassified | 2526 |
| 40 | Ga0070670_100169805 | 3300005331 | Bacteria | 1892 |
| 41 | Ga0070670_100196317 | 3300005331 | Unclassified | 1753 |
| 42 | Ga0070670_100216378 | 3300005331 | Bacteria | 1667 |
| 43 | Ga0070677_10016696 | 3300005333 | Unclassified | 2617 |
| 44 | Ga0068869_100001381 | 3300005334 | Bacteria | 14366 |
| 45 | Ga0068869_100018721 | 3300005334 | Unclassified | 4719 |
| 46 | Ga0068869_100021050 | 3300005334 | Bacteria | 4483 |
| 47 | Ga0068869_100021360 | 3300005334 | Bacteria | 4452 |
| 48 | Ga0068869_100224415 | 3300005334 | Unclassified | 1490 |
| 49 | Ga0070666_10005792 | 3300005335 | Bacteria | 7592 |
| 50 | Ga0070666_10024795 | 3300005335 | Bacteria | 3910 |
| 51 | Ga0070666_10028391 | 3300005335 | Bacteria | 3671 |
| 52 | Ga0070666_10054574 | 3300005335 | Bacteria | 2696 |
| 53 | Ga0070682_100067016 | 3300005337 | Bacteria | 2285 |
| 54 | Ga0070682_100155985 | 3300005337 | Bacteria | 1572 |
| 55 | Ga0068868_100000119 | 3300005338 | Bacteria | 49590 |
| 56 | Ga0068868_100003353 | 3300005338 | Bacteria | 11144 |
| 57 | Ga0068868_100004611 | 3300005338 | Bacteria | 9667 |
| 58 | Ga0070660_100014137 | 3300005339 | Bacteria | 5746 |
| 59 | Ga0070660_100102652 | 3300005339 | Bacteria | 2267 |
| 60 | Ga0070660_100147103 | 3300005339 | Unclassified | 1893 |
| 61 | Ga0070689_100078985 | 3300005340 | Bacteria | 2580 |
| 62 | Ga0070689_100113597 | 3300005340 | Unclassified | 2157 |
| 63 | Ga0070689_100127244 | 3300005340 | Unclassified | 2040 |
| 64 | Ga0070687_100003656 | 3300005343 | Bacteria | 6011 |
| 65 | Ga0070692_10129992 | 3300005345 | Bacteria | 1414 |
| 66 | Ga0070668_100000645 | 3300005347 | Bacteria | 23563 |
| 67 | Ga0070668_100008643 | 3300005347 | Bacteria | 7561 |
| 68 | Ga0070668_100029285 | 3300005347 | Bacteria | 4181 |
| 69 | Ga0070669_100018190 | 3300005353 | Bacteria | 5020 |
| 70 | Ga0070669_100131203 | 3300005353 | Bacteria | 1922 |
| 71 | Ga0070675_100005046 | 3300005354 | Bacteria | 10077 |
| 72 | Ga0070675_100052656 | 3300005354 | Bacteria | 3347 |
| 73 | Ga0070675_100066979 | 3300005354 | Bacteria | 2971 |
| 74 | Ga0070675_100089545 | 3300005354 | Bacteria | 2577 |
| 75 | Ga0070675_100384982 | 3300005354 | Bacteria | 1249 |
| 76 | Ga0070671_100029891 | 3300005355 | Unclassified | 4495 |
| 77 | Ga0070671_100078432 | 3300005355 | Bacteria | 2761 |
| 78 | Ga0070671_100163818 | 3300005355 | Bacteria | 1880 |
| 79 | Ga0070674_100009129 | 3300005356 | Bacteria | 5931 |
| 80 | Ga0070673_100000331 | 3300005364 | Bacteria | 24760 |
| 81 | Ga0070673_100024166 | 3300005364 | Bacteria | 4451 |
| 82 | Ga0070673_100030657 | 3300005364 | Bacteria | 4029 |
| 83 | Ga0070673_100040116 | 3300005364 | Bacteria | 3589 |
| 84 | Ga0070688_100059050 | 3300005365 | Bacteria | 2417 |
| 85 | Ga0070688_100086880 | 3300005365 | Unclassified | 2036 |
| 86 | Ga0070688_100123290 | 3300005365 | Bacteria | 1738 |
| 87 | Ga0070659_100045689 | 3300005366 | Bacteria | 3431 |
| 88 | Ga0070667_100001052 | 3300005367 | Bacteria | 25199 |
| 89 | Ga0070667_100024301 | 3300005367 | Bacteria | 5033 |
| 90 | Ga0070667_100034073 | 3300005367 | Bacteria | 4260 |
| 91 | Ga0070667_100268158 | 3300005367 | Unclassified | 1530 |
| 92 | Ga0070663_100100069 | 3300005455 | Bacteria | 2162 |
| 93 | Ga0070678_100008731 | 3300005456 | Bacteria | 6087 |
| 94 | Ga0070678_100200483 | 3300005456 | Unclassified | 1647 |
| 95 | Ga0070662_100001338 | 3300005457 | Bacteria | 15148 |
| 96 | Ga0070662_100023633 | 3300005457 | Bacteria | 4224 |
| 97 | Ga0070662_100030379 | 3300005457 | Bacteria | 3780 |
| 98 | Ga0070681_10039846 | 3300005458 | Bacteria | 4709 |
| 99 | Ga0070681_10116584 | 3300005458 | Bacteria | 2607 |
| 100 | Ga0068867_100016815 | 3300005459 | Bacteria | 5198 |
| 101 | Ga0068867_100027376 | 3300005459 | Bacteria | 4096 |
| 102 | Ga0068867_100039600 | 3300005459 | Bacteria | 3437 |
| 103 | Ga0068867_100086331 | 3300005459 | Bacteria | 2374 |
| 104 | Ga0070685_10048199 | 3300005466 | Unclassified | 2453 |
| 105 | Ga0070685_10049211 | 3300005466 | Bacteria | 2430 |
| 106 | Ga0070685_10052345 | 3300005466 | Unclassified | 2362 |
| 107 | Ga0070698_100000850 | 3300005471 | Bacteria | 33482 |
| 108 | Ga0070698_100004109 | 3300005471 | Bacteria | 15995 |
| 109 | Ga0070698_100018681 | 3300005471 | Bacteria | 7298 |
| 110 | Ga0070679_100000216 | 3300005530 | Bacteria | 46886 |
| 111 | Ga0070679_100024444 | 3300005530 | Bacteria | 5919 |
| 112 | Ga0070679_100083706 | 3300005530 | Bacteria | 3178 |
| 113 | Ga0070679_100283458 | 3300005530 | Bacteria | 1609 |
| 114 | Ga0070684_100057087 | 3300005535 | Bacteria | 3408 |
| 115 | Ga0068853_100001004 | 3300005539 | Bacteria | 19895 |
| 116 | Ga0068853_100061633 | 3300005539 | Bacteria | 3245 |
| 117 | Ga0068853_100136161 | 3300005539 | Bacteria | 2202 |
| 118 | Ga0068853_100196830 | 3300005539 | Bacteria | 1833 |
| 119 | Ga0068853_100199163 | 3300005539 | Bacteria | 1822 |
| 120 | Ga0070672_100000183 | 3300005543 | Bacteria | 34362 |
| 121 | Ga0070672_100275144 | 3300005543 | Bacteria | 1422 |
| 122 | Ga0070686_100102078 | 3300005544 | Bacteria | 1939 |
| 123 | Ga0070693_100058726 | 3300005547 | Bacteria | 2228 |
| 124 | Ga0070693_100171256 | 3300005547 | Bacteria | 1391 |
| 125 | Ga0070665_100000047 | 3300005548 | Bacteria | 269702 |
| 126 | Ga0070665_100001045 | 3300005548 | Bacteria | 34668 |
| 127 | Ga0070665_100084739 | 3300005548 | Unclassified | 3174 |
| 128 | Ga0068855_100000189 | 3300005563 | Bacteria | 79227 |
| 129 | Ga0068855_100011268 | 3300005563 | Bacteria | 10799 |
| 130 | Ga0068855_100036985 | 3300005563 | Bacteria | 5808 |
| 131 | Ga0068855_100076727 | 3300005563 | Bacteria | 3877 |
| 132 | Ga0068855_100077334 | 3300005563 | Bacteria | 3861 |
| 133 | Ga0068855_100114684 | 3300005563 | Bacteria | 3089 |
| 134 | Ga0070664_100017550 | 3300005564 | Bacteria | 5878 |
| 135 | Ga0070664_100040027 | 3300005564 | Unclassified | 3951 |
| 136 | Ga0070664_100042154 | 3300005564 | Unclassified | 3853 |
| 137 | Ga0070664_100053167 | 3300005564 | Bacteria | 3432 |
| 138 | Ga0070664_100053357 | 3300005564 | Bacteria | 3427 |
| 139 | Ga0068857_100002865 | 3300005577 | Bacteria | 14180 |
| 140 | Ga0068857_100031342 | 3300005577 | Bacteria | 4697 |
| 141 | Ga0068857_100076916 | 3300005577 | Bacteria | 2977 |
| 142 | Ga0068857_100208920 | 3300005577 | Bacteria | 1781 |
| 143 | Ga0068857_100211140 | 3300005577 | Unclassified | 1771 |
| 144 | Ga0068857_100326490 | 3300005577 | Bacteria | 1418 |
| 145 | Ga0068854_100047908 | 3300005578 | Bacteria | 3047 |
| 146 | Ga0068854_100157169 | 3300005578 | Bacteria | 1758 |
| 147 | Ga0068856_100014397 | 3300005614 | Bacteria | 7645 |
| 148 | Ga0068856_100016756 | 3300005614 | Bacteria | 7099 |
| 149 | Ga0068856_100039694 | 3300005614 | Bacteria | 4622 |
| 150 | Ga0068856_100140617 | 3300005614 | Bacteria | 2421 |
| 151 | Ga0070702_100017160 | 3300005615 | Bacteria | 3728 |
| 152 | Ga0068852_100007711 | 3300005616 | Bacteria | 7874 |
| 153 | Ga0068852_100051725 | 3300005616 | Bacteria | 3527 |
| 154 | Ga0068852_100069127 | 3300005616 | Bacteria | 3094 |
| 155 | Ga0068852_100069282 | 3300005616 | Bacteria | 3091 |
| 156 | Ga0068852_100087127 | 3300005616 | Bacteria | 2785 |
| 157 | Ga0068852_100169945 | 3300005616 | Bacteria | 2043 |
| 158 | Ga0068852_100194139 | 3300005616 | Unclassified | 1918 |
| 159 | Ga0068852_100245178 | 3300005616 | Unclassified | 1714 |
| 160 | Ga0068859_100000933 | 3300005617 | Bacteria | 29963 |
| 161 | Ga0068859_100024704 | 3300005617 | Bacteria | 6030 |
| 162 | Ga0068859_100163888 | 3300005617 | Bacteria | 2302 |
| 163 | Ga0068859_100228258 | 3300005617 | Unclassified | 1950 |
| 164 | Ga0068859_100265777 | 3300005617 | Bacteria | 1807 |
| 165 | Ga0068859_100320706 | 3300005617 | Bacteria | 1643 |
| 166 | Ga0068859_100429809 | 3300005617 | Bacteria | 1417 |
| 167 | Ga0068864_100003700 | 3300005618 | Bacteria | 12632 |
| 168 | Ga0068864_100026128 | 3300005618 | Bacteria | 4922 |
| 169 | Ga0068864_100082216 | 3300005618 | Unclassified | 2825 |
| 170 | Ga0068864_100254483 | 3300005618 | Unclassified | 1632 |
| 171 | Ga0068866_10007007 | 3300005718 | Bacteria | 4711 |
| 172 | Ga0068866_10044950 | 3300005718 | Bacteria | 2212 |
| 173 | Ga0068861_100002161 | 3300005719 | Bacteria | 12751 |
| 174 | Ga0068861_100016245 | 3300005719 | Bacteria | 5262 |
| 175 | Ga0068861_100019116 | 3300005719 | Bacteria | 4893 |
| 176 | Ga0068861_100056496 | 3300005719 | Bacteria | 2996 |
| 177 | Ga0068870_10005159 | 3300005840 | Bacteria | 5685 |
| 178 | Ga0068870_10071535 | 3300005840 | Bacteria | 1893 |
| 179 | Ga0068863_100003358 | 3300005841 | Bacteria | 15805 |
| 180 | Ga0068863_100024490 | 3300005841 | Bacteria | 5756 |
| 181 | Ga0068863_100150161 | 3300005841 | Bacteria | 2229 |
| 182 | Ga0068863_100431464 | 3300005841 | Unclassified | 1292 |
| 183 | Ga0068858_100001328 | 3300005842 | Bacteria | 25539 |
| 184 | Ga0068858_100034237 | 3300005842 | Unclassified | 4711 |
| 185 | Ga0068858_100183116 | 3300005842 | Bacteria | 1978 |
| 186 | Ga0068858_100214331 | 3300005842 | Unclassified | 1823 |
| 187 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 188 | Ga0068860_100001860 | 3300005843 | Bacteria | 22460 |
| 189 | Ga0068860_100053218 | 3300005843 | Bacteria | 3850 |
| 190 | Ga0068860_100146996 | 3300005843 | Bacteria | 2268 |
| 191 | Ga0068860_100217032 | 3300005843 | Bacteria | 1857 |
| 192 | Ga0068860_100305907 | 3300005843 | Unclassified | 1558 |
| 193 | Ga0068862_100003950 | 3300005844 | Bacteria | 12602 |
| 194 | Ga0081540_1007577 | 3300005983 | Bacteria | 7712 |
| 195 | Ga0081539_10000874 | 3300005985 | Bacteria | 57737 |
| 196 | Ga0097621_100000681 | 3300006237 | Bacteria | 23791 |
| 197 | Ga0097621_100008757 | 3300006237 | Bacteria | 7310 |
| 198 | Ga0097621_100040168 | 3300006237 | Bacteria | 3761 |
| 199 | Ga0097621_100119409 | 3300006237 | Bacteria | 2235 |
| 200 | Ga0075370_10103196 | 3300006353 | Bacteria | 1652 |
| 201 | Ga0068871_100005362 | 3300006358 | Bacteria | 8984 |
| 202 | Ga0068871_100007800 | 3300006358 | Bacteria | 7664 |
| 203 | Ga0068871_100014023 | 3300006358 | Bacteria | 5963 |
| 204 | Ga0068871_100023974 | 3300006358 | Bacteria | 4728 |
| 205 | Ga0068871_100026146 | 3300006358 | Bacteria | 4551 |
| 206 | Ga0068871_100054418 | 3300006358 | Bacteria | 3247 |
| 207 | Ga0075428_100006044 | 3300006844 | Bacteria | 13447 |
| 208 | Ga0075430_100003052 | 3300006846 | Bacteria | 14002 |
| 209 | Ga0075430_100038623 | 3300006846 | Bacteria | 4043 |
| 210 | Ga0075431_100006268 | 3300006847 | Bacteria | 11815 |
| 211 | Ga0075431_100032020 | 3300006847 | Bacteria | 5418 |
| 212 | Ga0075429_100022294 | 3300006880 | Bacteria | 5493 |
| 213 | Ga0075429_100349030 | 3300006880 | Bacteria | 1295 |
| 214 | Ga0068865_100016453 | 3300006881 | Unclassified | 4733 |
| 215 | Ga0068865_100293032 | 3300006881 | Unclassified | 1300 |
| 216 | Ga0097620_100000933 | 3300006931 | Bacteria | 29963 |
| 217 | Ga0097620_100024706 | 3300006931 | Bacteria | 6030 |
| 218 | Ga0097620_100163886 | 3300006931 | Bacteria | 2302 |
| 219 | Ga0097620_100228270 | 3300006931 | Unclassified | 1950 |
| 220 | Ga0097620_100265783 | 3300006931 | Bacteria | 1807 |
| 221 | Ga0097620_100320718 | 3300006931 | Bacteria | 1643 |
| 222 | Ga0097620_100429806 | 3300006931 | Bacteria | 1417 |
| 223 | Ga0105251_10032084 | 3300009011 | Unclassified | 2621 |
| 224 | Ga0105240_10000356 | 3300009093 | Bacteria | 85978 |
| 225 | Ga0105240_10000401 | 3300009093 | Bacteria | 80500 |
| 226 | Ga0105240_10003287 | 3300009093 | Bacteria | 25283 |
| 227 | Ga0105240_10006383 | 3300009093 | Bacteria | 17357 |
| 228 | Ga0105240_10008136 | 3300009093 | Bacteria | 15045 |
| 229 | Ga0105240_10205108 | 3300009093 | Bacteria | 2308 |
| 230 | Ga0105240_10220438 | 3300009093 | Bacteria | 2210 |
| 231 | Ga0105240_10275120 | 3300009093 | Bacteria | 1937 |
| 232 | Ga0111539_10054765 | 3300009094 | Bacteria | 4744 |
| 233 | Ga0111539_10310107 | 3300009094 | Bacteria | 1836 |
| 234 | Ga0111539_10750448 | 3300009094 | Bacteria | 1136 |
| 235 | Ga0105247_10000408 | 3300009101 | Bacteria | 36396 |
| 236 | Ga0114129_10158510 | 3300009147 | Bacteria | 3094 |
| 237 | Ga0105241_10000507 | 3300009174 | Bacteria | 29349 |
| 238 | Ga0105241_10010017 | 3300009174 | Bacteria | 6960 |
| 239 | Ga0105241_10052115 | 3300009174 | Unclassified | 3123 |
| 240 | Ga0105241_10179230 | 3300009174 | Unclassified | 1756 |
| 241 | Ga0105242_10018955 | 3300009176 | Bacteria | 5389 |
| 242 | Ga0105242_10036758 | 3300009176 | Bacteria | 3930 |
| 243 | Ga0105242_10137277 | 3300009176 | Bacteria | 2118 |
| 244 | Ga0105242_10216912 | 3300009176 | Unclassified | 1708 |
| 245 | Ga0105242_10235045 | 3300009176 | Bacteria | 1645 |
| 246 | Ga0105237_10000284 | 3300009545 | Bacteria | 69955 |
| 247 | Ga0105237_10002285 | 3300009545 | Bacteria | 23813 |
| 248 | Ga0105237_10003014 | 3300009545 | Bacteria | 20313 |
| 249 | Ga0105237_10019243 | 3300009545 | Bacteria | 7054 |
| 250 | Ga0105237_10026467 | 3300009545 | Bacteria | 5929 |
| 251 | Ga0105237_10151262 | 3300009545 | Bacteria | 2317 |
| 252 | Ga0105238_10006282 | 3300009551 | Bacteria | 11809 |
| 253 | Ga0105238_10113189 | 3300009551 | Unclassified | 2693 |
| 254 | Ga0105249_10004239 | 3300009553 | Bacteria | 12401 |
| 255 | Ga0105249_10014866 | 3300009553 | Bacteria | 6884 |
| 256 | Ga0105249_10095012 | 3300009553 | Unclassified | 2795 |
| 257 | Ga0105249_10173631 | 3300009553 | Unclassified | 2092 |
| 258 | Ga0105249_10215857 | 3300009553 | Unclassified | 1885 |
| 259 | Ga0105239_10000129 | 3300010375 | Bacteria | 106549 |
| 260 | Ga0105239_10002123 | 3300010375 | Bacteria | 25586 |
| 261 | Ga0105239_10002968 | 3300010375 | Bacteria | 21146 |
| 262 | Ga0105239_10042844 | 3300010375 | Bacteria | 4960 |
| 263 | Ga0105239_10070704 | 3300010375 | Bacteria | 3834 |
| 264 | Ga0105239_10129966 | 3300010375 | Bacteria | 2800 |
| 265 | Ga0105246_10029461 | 3300011119 | Bacteria | 3616 |
| 266 | Ga0105246_10277979 | 3300011119 | Unclassified | 1342 |
| 267 | Ga0157373_10002973 | 3300013100 | Bacteria | 12837 |
| 268 | Ga0157373_10016986 | 3300013100 | Bacteria | 5301 |
| 269 | Ga0157373_10018702 | 3300013100 | Bacteria | 5043 |
| 270 | Ga0157373_10022100 | 3300013100 | Bacteria | 4617 |
| 271 | Ga0157373_10037297 | 3300013100 | Bacteria | 3485 |
| 272 | Ga0157373_10101178 | 3300013100 | Bacteria | 2028 |
| 273 | Ga0157373_10161206 | 3300013100 | Bacteria | 1578 |
| 274 | Ga0157371_10000518 | 3300013102 | Bacteria | 46197 |
| 275 | Ga0157371_10000650 | 3300013102 | Bacteria | 41165 |
| 276 | Ga0157371_10000898 | 3300013102 | Bacteria | 33500 |
| 277 | Ga0157371_10004152 | 3300013102 | Bacteria | 12772 |
| 278 | Ga0157371_10008191 | 3300013102 | Bacteria | 8356 |
| 279 | Ga0157371_10009544 | 3300013102 | Bacteria | 7632 |
| 280 | Ga0157371_10022979 | 3300013102 | Bacteria | 4560 |
| 281 | Ga0157371_10040523 | 3300013102 | Bacteria | 3326 |
| 282 | Ga0157371_10060396 | 3300013102 | Bacteria | 2688 |
| 283 | Ga0157370_10000313 | 3300013104 | Bacteria | 60838 |
| 284 | Ga0157370_10142926 | 3300013104 | Bacteria | 2229 |
| 285 | Ga0157370_10162826 | 3300013104 | Bacteria | 2075 |
| 286 | Ga0157370_10182673 | 3300013104 | Bacteria | 1948 |
| 287 | Ga0157370_10473724 | 3300013104 | Bacteria | 1151 |
| 288 | Ga0157369_10027407 | 3300013105 | Bacteria | 6316 |
| 289 | Ga0157369_10065806 | 3300013105 | Bacteria | 3900 |
| 290 | Ga0157369_10069548 | 3300013105 | Bacteria | 3782 |
| 291 | Ga0157369_10542493 | 3300013105 | Unclassified | 1202 |
| 292 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 293 | Ga0157374_10001463 | 3300013296 | Bacteria | 19961 |
| 294 | Ga0157374_10005799 | 3300013296 | Bacteria | 10431 |
| 295 | Ga0157374_10041025 | 3300013296 | Bacteria | 4262 |
| 296 | Ga0157374_10061170 | 3300013296 | Unclassified | 3526 |
| 297 | Ga0157374_10094509 | 3300013296 | Bacteria | 2857 |
| 298 | Ga0157374_10269875 | 3300013296 | Bacteria | 1677 |
| 299 | Ga0157378_10009448 | 3300013297 | Bacteria | 8499 |
| 300 | Ga0157378_10044156 | 3300013297 | Bacteria | 3957 |
| 301 | Ga0157378_10065461 | 3300013297 | Bacteria | 3253 |
| 302 | Ga0163162_10004876 | 3300013306 | Bacteria | 12940 |
| 303 | Ga0163162_10008896 | 3300013306 | Bacteria | 9765 |
| 304 | Ga0163162_10009462 | 3300013306 | Bacteria | 9474 |
| 305 | Ga0163162_10015856 | 3300013306 | Bacteria | 7363 |
| 306 | Ga0163162_10029743 | 3300013306 | Bacteria | 5406 |
| 307 | Ga0163162_10042818 | 3300013306 | Unclassified | 4533 |
| 308 | Ga0163162_10249719 | 3300013306 | Bacteria | 1906 |
| 309 | Ga0157372_10001911 | 3300013307 | Bacteria | 22615 |
| 310 | Ga0157372_10004775 | 3300013307 | Bacteria | 14396 |
| 311 | Ga0157372_10005645 | 3300013307 | Bacteria | 13304 |
| 312 | Ga0157372_10007248 | 3300013307 | Bacteria | 11812 |
| 313 | Ga0157372_10011038 | 3300013307 | Bacteria | 9614 |
| 314 | Ga0157372_10026618 | 3300013307 | Bacteria | 6294 |
| 315 | Ga0157372_10043707 | 3300013307 | Bacteria | 4962 |
| 316 | Ga0157372_10086269 | 3300013307 | Bacteria | 3561 |
| 317 | Ga0157372_10097571 | 3300013307 | Bacteria | 3352 |
| 318 | Ga0157372_10100987 | 3300013307 | Unclassified | 3293 |
| 319 | Ga0157372_10376416 | 3300013307 | Bacteria | 1654 |
| 320 | Ga0157372_10425119 | 3300013307 | Bacteria | 1548 |
| 321 | Ga0157372_10566550 | 3300013307 | Bacteria | 1324 |
| 322 | Ga0157375_10090861 | 3300013308 | Bacteria | 3113 |
| 323 | Ga0157375_10183408 | 3300013308 | Unclassified | 2245 |
| 324 | Ga0157375_10196886 | 3300013308 | Bacteria | 2170 |
| 325 | Ga0157375_10455481 | 3300013308 | Bacteria | 1445 |
| 326 | Ga0163163_10000343 | 3300014325 | Bacteria | 44866 |
| 327 | Ga0163163_10066492 | 3300014325 | Unclassified | 3580 |
| 328 | Ga0157380_10001360 | 3300014326 | Bacteria | 15918 |
| 329 | Ga0157377_10001764 | 3300014745 | Bacteria | 9426 |
| 330 | Ga0157377_10032743 | 3300014745 | Bacteria | 2833 |
| 331 | Ga0157377_10043884 | 3300014745 | Bacteria | 2491 |
| 332 | Ga0157377_10150607 | 3300014745 | Bacteria | 1438 |
| 333 | Ga0157379_10009096 | 3300014968 | Bacteria | 8656 |
| 334 | Ga0157379_10038921 | 3300014968 | Unclassified | 4242 |
| 335 | Ga0157379_10087295 | 3300014968 | Unclassified | 2797 |
| 336 | Ga0157376_10001725 | 3300014969 | Bacteria | 14540 |
| 337 | Ga0163161_10002608 | 3300017792 | Bacteria | 12848 |
| 338 | Ga0163161_10030313 | 3300017792 | Bacteria | 3848 |
| 339 | Ga0163161_10075255 | 3300017792 | Bacteria | 2477 |
| 340 | Ga0163161_10131147 | 3300017792 | Bacteria | 1891 |
| 341 | Ga0213876_10023605 | 3300021384 | Bacteria | 3248 |
| 342 | Ga0209436_100675 | 3300025208 | Bacteria | 14517 |
| 343 | Ga0209436_101411 | 3300025208 | Bacteria | 8449 |
| 344 | Ga0209258_100302 | 3300025242 | Bacteria | 79794 |
| 345 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 346 | Ga0209026_1000095 | 3300025250 | Bacteria | 164309 |
| 347 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 348 | Ga0209673_1000078 | 3300025273 | Bacteria | 227727 |
| 349 | Ga0209130_1000611 | 3300025284 | Bacteria | 34241 |
| 350 | Ga0209564_1003616 | 3300025295 | Bacteria | 10288 |
| 351 | Ga0209564_1004884 | 3300025295 | Bacteria | 7950 |
| 352 | Ga0209758_1005348 | 3300025297 | Bacteria | 9961 |
| 353 | Ga0209758_1008401 | 3300025297 | Bacteria | 6703 |
| 354 | Ga0209758_1010271 | 3300025297 | Bacteria | 5636 |
| 355 | Ga0209050_1000097 | 3300025298 | Bacteria | 239919 |
| 356 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 357 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 358 | Ga0207426_1000313 | 3300025302 | Bacteria | 94934 |
| 359 | Ga0207426_1000541 | 3300025302 | Bacteria | 54110 |
| 360 | Ga0207426_1004062 | 3300025302 | Bacteria | 7389 |
| 361 | Ga0209051_1017678 | 3300025303 | Bacteria | 3180 |
| 362 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 363 | Ga0209257_1004414 | 3300025304 | Bacteria | 10921 |
| 364 | Ga0207682_10027539 | 3300025893 | Bacteria | 2264 |
| 365 | Ga0207682_10058378 | 3300025893 | Unclassified | 1610 |
| 366 | Ga0207642_10006375 | 3300025899 | Bacteria | 3918 |
| 367 | Ga0207710_10003686 | 3300025900 | Bacteria | 6791 |
| 368 | Ga0207688_10018716 | 3300025901 | Bacteria | 3766 |
| 369 | Ga0207680_10000223 | 3300025903 | Bacteria | 27399 |
| 370 | Ga0207680_10025902 | 3300025903 | Bacteria | 3242 |
| 371 | Ga0207680_10030610 | 3300025903 | Bacteria | 3038 |
| 372 | Ga0207680_10039114 | 3300025903 | Bacteria | 2750 |
| 373 | Ga0207647_10000360 | 3300025904 | Bacteria | 37076 |
| 374 | Ga0207647_10023593 | 3300025904 | Bacteria | 4068 |
| 375 | Ga0207647_10043801 | 3300025904 | Bacteria | 2798 |
| 376 | Ga0207647_10047652 | 3300025904 | Unclassified | 2665 |
| 377 | Ga0207645_10000748 | 3300025907 | Bacteria | 27039 |
| 378 | Ga0207645_10002708 | 3300025907 | Bacteria | 13802 |
| 379 | Ga0207645_10018693 | 3300025907 | Bacteria | 4551 |
| 380 | Ga0207645_10069824 | 3300025907 | Bacteria | 2247 |
| 381 | Ga0207643_10003520 | 3300025908 | Bacteria | 8423 |
| 382 | Ga0207643_10008799 | 3300025908 | Bacteria | 5416 |
| 383 | Ga0207643_10128199 | 3300025908 | Bacteria | 1507 |
| 384 | Ga0207705_10014693 | 3300025909 | Bacteria | 5631 |
| 385 | Ga0207705_10060093 | 3300025909 | Bacteria | 2744 |
| 386 | Ga0207654_10001931 | 3300025911 | Bacteria | 10741 |
| 387 | Ga0207707_10051286 | 3300025912 | Bacteria | 3593 |
| 388 | Ga0207707_10059131 | 3300025912 | Bacteria | 3335 |
| 389 | Ga0207707_10111925 | 3300025912 | Bacteria | 2387 |
| 390 | Ga0207695_10000209 | 3300025913 | Bacteria | 157802 |
| 391 | Ga0207695_10000300 | 3300025913 | Bacteria | 122104 |
| 392 | Ga0207695_10000365 | 3300025913 | Bacteria | 103398 |
| 393 | Ga0207695_10000483 | 3300025913 | Bacteria | 85395 |
| 394 | Ga0207695_10011556 | 3300025913 | Bacteria | 10681 |
| 395 | Ga0207695_10124210 | 3300025913 | Bacteria | 2545 |
| 396 | Ga0207671_10000650 | 3300025914 | Bacteria | 45400 |
| 397 | Ga0207671_10001292 | 3300025914 | Bacteria | 29407 |
| 398 | Ga0207671_10006095 | 3300025914 | Bacteria | 10856 |
| 399 | Ga0207671_10020019 | 3300025914 | Bacteria | 5104 |
| 400 | Ga0207671_10100364 | 3300025914 | Bacteria | 2191 |
| 401 | Ga0207671_10246416 | 3300025914 | Bacteria | 1404 |
| 402 | Ga0207662_10057317 | 3300025918 | Bacteria | 2328 |
| 403 | Ga0207657_10063618 | 3300025919 | Bacteria | 3153 |
| 404 | Ga0207657_10075396 | 3300025919 | Bacteria | 2847 |
| 405 | Ga0207657_10077598 | 3300025919 | Bacteria | 2799 |
| 406 | Ga0207657_10114199 | 3300025919 | Bacteria | 2227 |
| 407 | Ga0207657_10244742 | 3300025919 | Bacteria | 1431 |
| 408 | Ga0207652_10000090 | 3300025921 | Bacteria | 99245 |
| 409 | Ga0207652_10000154 | 3300025921 | Bacteria | 74554 |
| 410 | Ga0207681_10020629 | 3300025923 | Bacteria | 4179 |
| 411 | Ga0207681_10024008 | 3300025923 | Bacteria | 3907 |
| 412 | Ga0207694_10072544 | 3300025924 | Unclassified | 2692 |
| 413 | Ga0207694_10227684 | 3300025924 | Bacteria | 1522 |
| 414 | Ga0207650_10000813 | 3300025925 | Bacteria | 23983 |
| 415 | Ga0207650_10095373 | 3300025925 | Unclassified | 2280 |
| 416 | Ga0207650_10169240 | 3300025925 | Bacteria | 1736 |
| 417 | Ga0207650_10183377 | 3300025925 | Unclassified | 1669 |
| 418 | Ga0207659_10059684 | 3300025926 | Unclassified | 2743 |
| 419 | Ga0207659_10108990 | 3300025926 | Bacteria | 2101 |
| 420 | Ga0207644_10067295 | 3300025931 | Bacteria | 2611 |
| 421 | Ga0207644_10168194 | 3300025931 | Unclassified | 1709 |
| 422 | Ga0207644_10298844 | 3300025931 | Unclassified | 1297 |
| 423 | Ga0207690_10171820 | 3300025932 | Unclassified | 1624 |
| 424 | Ga0207706_10003423 | 3300025933 | Bacteria | 15150 |
| 425 | Ga0207706_10004381 | 3300025933 | Bacteria | 13267 |
| 426 | Ga0207706_10023769 | 3300025933 | Bacteria | 5499 |
| 427 | Ga0207706_10047636 | 3300025933 | Bacteria | 3792 |
| 428 | Ga0207706_10067978 | 3300025933 | Bacteria | 3136 |
| 429 | Ga0207686_10008363 | 3300025934 | Bacteria | 5586 |
| 430 | Ga0207686_10100932 | 3300025934 | Unclassified | 1926 |
| 431 | Ga0207709_10102964 | 3300025935 | Unclassified | 1891 |
| 432 | Ga0207670_10025416 | 3300025936 | Bacteria | 3717 |
| 433 | Ga0207670_10062443 | 3300025936 | Unclassified | 2546 |
| 434 | Ga0207670_10125089 | 3300025936 | Unclassified | 1875 |
| 435 | Ga0207704_10139369 | 3300025938 | Unclassified | 1694 |
| 436 | Ga0207691_10000057 | 3300025940 | Bacteria | 89823 |
| 437 | Ga0207691_10106459 | 3300025940 | Bacteria | 2498 |
| 438 | Ga0207691_10172708 | 3300025940 | Bacteria | 1892 |
| 439 | Ga0207689_10000628 | 3300025942 | Bacteria | 33617 |
| 440 | Ga0207689_10001062 | 3300025942 | Bacteria | 26443 |
| 441 | Ga0207689_10001418 | 3300025942 | Bacteria | 22893 |
| 442 | Ga0207689_10026149 | 3300025942 | Bacteria | 4887 |
| 443 | Ga0207689_10068850 | 3300025942 | Bacteria | 2908 |
| 444 | Ga0207689_10114339 | 3300025942 | Bacteria | 2218 |
| 445 | Ga0207689_10134827 | 3300025942 | Bacteria | 2033 |
| 446 | Ga0207661_10065670 | 3300025944 | Bacteria | 2946 |
| 447 | Ga0207661_10247500 | 3300025944 | Unclassified | 1583 |
| 448 | Ga0207679_10028829 | 3300025945 | Bacteria | 3858 |
| 449 | Ga0207679_10042210 | 3300025945 | Unclassified | 3276 |
| 450 | Ga0207679_10339641 | 3300025945 | Bacteria | 1306 |
| 451 | Ga0207667_10000902 | 3300025949 | Bacteria | 37879 |
| 452 | Ga0207667_10002948 | 3300025949 | Bacteria | 21118 |
| 453 | Ga0207667_10018691 | 3300025949 | Bacteria | 7764 |
| 454 | Ga0207667_10029002 | 3300025949 | Bacteria | 6007 |
| 455 | Ga0207667_10138204 | 3300025949 | Bacteria | 2509 |
| 456 | Ga0207667_10194964 | 3300025949 | Bacteria | 2078 |
| 457 | Ga0207667_10195669 | 3300025949 | Bacteria | 2074 |
| 458 | Ga0207651_10000330 | 3300025960 | Bacteria | 20100 |
| 459 | Ga0207712_10001226 | 3300025961 | Bacteria | 17716 |
| 460 | Ga0207712_10011611 | 3300025961 | Bacteria | 5616 |
| 461 | Ga0207712_10088962 | 3300025961 | Bacteria | 2269 |
| 462 | Ga0207712_10113822 | 3300025961 | Unclassified | 2034 |
| 463 | Ga0207712_10160056 | 3300025961 | Bacteria | 1749 |
| 464 | Ga0207712_10193392 | 3300025961 | Unclassified | 1607 |
| 465 | Ga0207668_10000170 | 3300025972 | Bacteria | 45140 |
| 466 | Ga0207668_10057529 | 3300025972 | Bacteria | 2713 |
| 467 | Ga0207668_10121629 | 3300025972 | Unclassified | 1977 |
| 468 | Ga0207640_10040381 | 3300025981 | Bacteria | 2959 |
| 469 | Ga0207640_10102980 | 3300025981 | Bacteria | 2006 |
| 470 | Ga0207658_10080355 | 3300025986 | Unclassified | 2497 |
| 471 | Ga0207658_10328230 | 3300025986 | Unclassified | 1326 |
| 472 | Ga0207677_10001046 | 3300026023 | Bacteria | 15188 |
| 473 | Ga0207677_10011966 | 3300026023 | Bacteria | 4969 |
| 474 | Ga0207677_10016754 | 3300026023 | Bacteria | 4350 |
| 475 | Ga0207677_10037340 | 3300026023 | Bacteria | 3175 |
| 476 | Ga0207677_10207244 | 3300026023 | Bacteria | 1563 |
| 477 | Ga0207703_10087622 | 3300026035 | Unclassified | 2611 |
| 478 | Ga0207703_10248689 | 3300026035 | Bacteria | 1601 |
| 479 | Ga0207639_10010315 | 3300026041 | Bacteria | 6468 |
| 480 | Ga0207639_10021680 | 3300026041 | Bacteria | 4618 |
| 481 | Ga0207639_10230488 | 3300026041 | Bacteria | 1605 |
| 482 | Ga0207639_10501510 | 3300026041 | Bacteria | 1109 |
| 483 | Ga0207678_10017885 | 3300026067 | Bacteria | 6227 |
| 484 | Ga0207702_10242182 | 3300026078 | Bacteria | 1690 |
| 485 | Ga0207641_10009509 | 3300026088 | Bacteria | 8013 |
| 486 | Ga0207641_10011229 | 3300026088 | Bacteria | 7347 |
| 487 | Ga0207641_10130714 | 3300026088 | Bacteria | 2254 |
| 488 | Ga0207641_10219428 | 3300026088 | Bacteria | 1762 |
| 489 | Ga0207641_10373373 | 3300026088 | Bacteria | 1364 |
| 490 | Ga0207648_10000372 | 3300026089 | Bacteria | 49262 |
| 491 | Ga0207648_10010287 | 3300026089 | Bacteria | 8882 |
| 492 | Ga0207648_10015759 | 3300026089 | Bacteria | 6934 |
| 493 | Ga0207648_10025791 | 3300026089 | Bacteria | 5231 |
| 494 | Ga0207676_10000768 | 3300026095 | Bacteria | 25093 |
| 495 | Ga0207676_10009647 | 3300026095 | Bacteria | 6869 |
| 496 | Ga0207676_10024603 | 3300026095 | Bacteria | 4458 |
| 497 | Ga0207676_10046670 | 3300026095 | Bacteria | 3353 |
| 498 | Ga0207676_10097524 | 3300026095 | Bacteria | 2429 |
| 499 | Ga0207674_10003427 | 3300026116 | Bacteria | 19412 |
| 500 | Ga0207674_10012617 | 3300026116 | Bacteria | 9444 |
| 501 | Ga0207674_10021791 | 3300026116 | Bacteria | 6896 |
| 502 | Ga0207674_10114723 | 3300026116 | Bacteria | 2666 |
| 503 | Ga0207674_10170252 | 3300026116 | Bacteria | 2131 |
| 504 | Ga0207675_100005048 | 3300026118 | Bacteria | 12708 |
| 505 | Ga0207675_100019278 | 3300026118 | Bacteria | 6363 |
| 506 | Ga0207675_100034513 | 3300026118 | Bacteria | 4717 |
| 507 | Ga0207675_100034829 | 3300026118 | Bacteria | 4696 |
| 508 | Ga0207675_100038027 | 3300026118 | Unclassified | 4491 |
| 509 | Ga0207683_10001617 | 3300026121 | Bacteria | 20205 |
| 510 | Ga0207683_10020692 | 3300026121 | Bacteria | 5629 |
| 511 | Ga0207683_10172327 | 3300026121 | Bacteria | 1960 |
| 512 | Ga0207683_10328448 | 3300026121 | Bacteria | 1402 |
| 513 | Ga0207698_10005431 | 3300026142 | Bacteria | 7879 |
| 514 | Ga0207698_10013439 | 3300026142 | Bacteria | 5401 |
| 515 | Ga0207698_10015963 | 3300026142 | Bacteria | 5049 |
| 516 | Ga0207698_10069679 | 3300026142 | Bacteria | 2782 |
| 517 | Ga0207698_10247154 | 3300026142 | Bacteria | 1630 |
| 518 | Ga0207428_10053619 | 3300027907 | Bacteria | 3215 |
| 519 | Ga0268266_10000104 | 3300028379 | Bacteria | 178320 |
| 520 | Ga0268266_10014894 | 3300028379 | Bacteria | 6677 |
| 521 | Ga0268266_10076916 | 3300028379 | Unclassified | 2901 |
| 522 | Ga0268266_10477167 | 3300028379 | Bacteria | 1188 |
| 523 | Ga0268265_10011344 | 3300028380 | Bacteria | 6027 |
| 524 | Ga0268265_10082175 | 3300028380 | Bacteria | 2547 |
| 525 | Ga0268265_10154119 | 3300028380 | Unclassified | 1942 |
| 526 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 527 | Ga0268264_10003990 | 3300028381 | Bacteria | 12636 |
| 528 | Ga0268264_10007340 | 3300028381 | Bacteria | 9212 |
| 529 | Ga0268264_10033960 | 3300028381 | Bacteria | 4194 |
| 530 | Ga0268264_10059527 | 3300028381 | Bacteria | 3200 |
| 531 | Ga0268264_10277144 | 3300028381 | Unclassified | 1569 |
| 532 | Ga0307517_10001269 | 3300028786 | Bacteria | 42402 |
| 533 | Ga0307517_10116554 | 3300028786 | Bacteria | 1999 |
| 534 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 535 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 536 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 537 | Ga0265327_10000199 | 3300031251 | Bacteria | 125838 |
| 538 | Ga0265327_10027088 | 3300031251 | Bacteria | 3305 |
| 539 | Ga0307513_10159302 | 3300031456 | Unclassified | 2152 |
| 540 | Ga0307513_10269466 | 3300031456 | Bacteria | 1487 |
| 541 | Ga0307516_10003475 | 3300031730 | Bacteria | 20196 |
| 542 | Ga0307516_10123536 | 3300031730 | Bacteria | 2376 |
| 543 | Ga0307406_10084274 | 3300031901 | Bacteria | 2122 |
| 544 | Ga0307510_10000141 | 3300033180 | Bacteria | 59562 |
| 545 | Ga0373935_0187274 | 3300035692 | Bacteria | 1424 |
| 546 | Ga0373937_0302809 | 3300036401 | Unclassified | 1511 |
| 547 | Ga0395899_0004373 | 3300037312 | Bacteria | 11019 |
| 548 | Ga0395899_0005666 | 3300037312 | Bacteria | 9697 |
| 549 | Ga0395899_0012016 | 3300037312 | Bacteria | 6634 |
| 550 | Ga0395899_0013648 | 3300037312 | Bacteria | 6210 |
| 551 | Ga0395899_0054945 | 3300037312 | Bacteria | 2945 |
| 552 | Ga0395899_0100865 | 3300037312 | Bacteria | 2084 |
| 553 | Ga0395900_0000927 | 3300037418 | Bacteria | 38470 |
| 554 | Ga0395900_0022173 | 3300037418 | Bacteria | 6496 |
| 555 | Ga0395900_0023636 | 3300037418 | Bacteria | 6287 |
| 556 | Ga0395900_0040131 | 3300037418 | Bacteria | 4823 |
| 557 | Ga0395900_0096788 | 3300037418 | Unclassified | 3032 |
| 558 | Ga0395900_0120624 | 3300037418 | Bacteria | 2690 |
| 559 | Ga0395898_0004030 | 3300037466 | Bacteria | 16151 |
| 560 | Ga0395898_0041634 | 3300037466 | Bacteria | 4536 |
| 561 | Ga0395898_0074862 | 3300037466 | Bacteria | 3270 |
| 562 | Ga0395898_0126198 | 3300037466 | Bacteria | 2451 |
| 563 | Ga0395905_0001629 | 3300037471 | Bacteria | 26648 |
| 564 | Ga0395905_0051538 | 3300037471 | Bacteria | 3855 |
| 565 | Ga0395905_0311499 | 3300037471 | Bacteria | 1463 |
| 566 | Ga0395901_0001347 | 3300038443 | Bacteria | 25756 |
| 567 | Ga0395901_0020835 | 3300038443 | Bacteria | 6712 |
| 568 | Ga0395901_0200019 | 3300038443 | Bacteria | 2094 |
| 569 | Ga0395901_0387943 | 3300038443 | Bacteria | 1436 |
| 570 | Ga0436365_1144486 | 3300039437 | Bacteria | 19138 |
| 571 | Ga0439442_002360 | 3300042002 | Bacteria | 3703 |
| 572 | Ga0439449_0005922 | 3300042007 | Bacteria | 4670 |
| 573 | Ga0439449_0041880 | 3300042007 | Bacteria | 1703 |
| 574 | Ga0439449_0066127 | 3300042007 | Bacteria | 1333 |
| 575 | Ga0466969_0001216 | 3300044656 | Bacteria | 13901 |
| 576 | Ga0466969_0040508 | 3300044656 | Bacteria | 2334 |
| 577 | Ga0466972_0000069 | 3300044658 | Bacteria | 100746 |
| 578 | Ga0466965_0009580 | 3300044683 | Bacteria | 4503 |
| 579 | Ga0466966_0000184 | 3300044684 | Bacteria | 41499 |
| 580 | Ga0466966_0111671 | 3300044684 | Bacteria | 1685 |
| 581 | Ga0466961_0098970 | 3300044693 | Bacteria | 1838 |
| 582 | Ga0466968_0029714 | 3300044735 | Bacteria | 2261 |
| 583 | Ga0466970_0002827 | 3300044765 | Bacteria | 8383 |
| 584 | Ga0466970_0016279 | 3300044765 | Bacteria | 3831 |
| 585 | Ga0466957_0001692 | 3300044842 | Bacteria | 11593 |
| 586 | Ga0466959_0000097 | 3300045049 | Bacteria | 55620 |
| 587 | Ga0466959_0000330 | 3300045049 | Bacteria | 27908 |
| 588 | Ga0466959_0011869 | 3300045049 | Bacteria | 6275 |
| 589 | Ga0466967_0018192 | 3300045976 | Bacteria | 5607 |
| 590 | Ga0495638_0037642 | 3300046460 | Bacteria | 3077 |
| 591 | Ga0495606_0004246 | 3300046507 | Bacteria | 14488 |
| 592 | Ga0495643_0058511 | 3300046522 | Bacteria | 2051 |
| 593 | Ga0495621_0069260 | 3300046539 | Bacteria | 1296 |
| 594 | Ga0495668_0000339 | 3300046616 | Bacteria | 62659 |
| 595 | Ga0495668_0001044 | 3300046616 | Bacteria | 29358 |
| 596 | Ga0495611_0000030 | 3300046648 | Bacteria | 111786 |
| 597 | Ga0495687_000726 | 3300047443 | Bacteria | 36440 |
| 598 | Ga0496100_0035934 | 3300048903 | Bacteria | 3121 |
| 599 | Ga0496101_0259047 | 3300048904 | Bacteria | 1356 |
| 600 | Ga0496104_0142954 | 3300048907 | Unclassified | 2299 |
| 601 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 602 | Ga0501031_0050483 | 3300049568 | Bacteria | 2710 |
| 603 | Ga0501032_0007417 | 3300049569 | Bacteria | 8011 |
| 604 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 605 | Ga0501034_0005631 | 3300049571 | Bacteria | 13642 |
| 606 | Ga0501034_0033462 | 3300049571 | Bacteria | 5214 |
| 607 | Ga0501034_0039450 | 3300049571 | Bacteria | 4783 |
| 608 | Ga0501034_0207852 | 3300049571 | Bacteria | 1913 |
| 609 | Ga0501034_0257647 | 3300049571 | Bacteria | 1688 |
| 610 | Ga0501034_0519449 | 3300049571 | Bacteria | 1103 |
| 611 | Ga0501036_0185942 | 3300049572 | Unclassified | 1748 |
| 612 | Ga0501037_0005310 | 3300049573 | Bacteria | 9372 |
| 613 | Ga0501038_0034705 | 3300049574 | Bacteria | 4434 |
| 614 | Ga0501038_0171550 | 3300049574 | Bacteria | 1756 |
| 615 | Ga0501039_0014887 | 3300049575 | Bacteria | 5948 |
| 616 | Ga0501039_0025156 | 3300049575 | Bacteria | 4573 |
| 617 | Ga0501039_0031852 | 3300049575 | Bacteria | 4065 |
| 618 | Ga0501043_0004690 | 3300049579 | Bacteria | 11081 |
| 619 | Ga0501043_0011471 | 3300049579 | Bacteria | 6937 |
| 620 | Ga0501043_0035278 | 3300049579 | Bacteria | 3934 |
| 621 | Ga0501043_0036442 | 3300049579 | Bacteria | 3869 |
| 622 | Ga0501046_0008975 | 3300049580 | Bacteria | 8680 |
| 623 | Ga0501046_0053501 | 3300049580 | Bacteria | 3179 |
| 624 | Ga0501047_0005232 | 3300049581 | Bacteria | 12180 |
| 625 | Ga0501047_0081192 | 3300049581 | Bacteria | 3117 |
| 626 | Ga0501047_0094448 | 3300049581 | Bacteria | 2869 |
| 627 | Ga0501048_0001472 | 3300049582 | Bacteria | 17846 |
| 628 | Ga0501070_0010616 | 3300049586 | Bacteria | 7786 |
| 629 | Ga0501070_0309460 | 3300049586 | Bacteria | 1286 |
| 630 | Ga0501071_0287338 | 3300049587 | Bacteria | 1245 |
| 631 | Ga0501072_0047281 | 3300049588 | Bacteria | 3389 |
| 632 | Ga0501073_0302466 | 3300049589 | Bacteria | 1103 |
| 633 | Ga0501074_0004892 | 3300049590 | Bacteria | 9607 |
| 634 | Ga0501074_0038714 | 3300049590 | Bacteria | 3454 |
| 635 | Ga0501217_015630 | 3300049661 | Bacteria | 1731 |
| 636 | Ga0501217_025909 | 3300049661 | Bacteria | 1414 |
| 637 | Ga0501257_003588 | 3300049686 | Bacteria | 3343 |
| 638 | Ga0501257_013964 | 3300049686 | Bacteria | 1842 |
| 639 | Ga0501259_001424 | 3300049688 | Bacteria | 3977 |
| 640 | Ga0501219_000564 | 3300049703 | Bacteria | 5408 |
| 641 | Ga0501079_0138704 | 3300049741 | Unclassified | 1894 |
| 642 | Ga0501080_0198946 | 3300049742 | Bacteria | 1840 |
| 643 | Ga0501080_0221785 | 3300049742 | Bacteria | 1730 |
| 644 | Ga0501280_009089 | 3300049776 | Bacteria | 1383 |
| 645 | Ga0501035_0007031 | 3300049822 | Bacteria | 10516 |
| 646 | Ga0501035_0012647 | 3300049822 | Bacteria | 7799 |
| 647 | Ga0501035_0212949 | 3300049822 | Bacteria | 1653 |
| 648 | Ga0501035_0363932 | 3300049822 | Bacteria | 1208 |
| 649 | Ga0501044_0010112 | 3300049823 | Bacteria | 10251 |
| 650 | Ga0501044_0012014 | 3300049823 | Bacteria | 9381 |
| 651 | Ga0501044_0016865 | 3300049823 | Bacteria | 7836 |
| 652 | Ga0501044_0097232 | 3300049823 | Bacteria | 2966 |
| 653 | Ga0501044_0106037 | 3300049823 | Bacteria | 2822 |
| 654 | Ga0501044_0278403 | 3300049823 | Bacteria | 1607 |
| 655 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 656 | nmdc:mga0k408_158794_c1 | 3300050493 | Bacteria | 1347 |
| 657 | nmdc:mga0k408_83189_c1 | 3300050493 | Bacteria | 1876 |
| 658 | nmdc:mga05p37_128627_c1 | 3300050507 | Bacteria | 3109 |
| 659 | nmdc:mga09592_2275_c1 | 3300050508 | Bacteria | 15469 |
| 660 | nmdc:mga0qj67_20468_c1 | 3300050509 | Bacteria | 5065 |
| 661 | nmdc:mga0qj67_57913_c1 | 3300050509 | Bacteria | 3072 |
| 662 | nmdc:mga06r32_49237_c1 | 3300050510 | Bacteria | 4029 |
| 663 | nmdc:mga08y16_42040_c1 | 3300050511 | Bacteria | 4787 |
| 664 | nmdc:mga08y16_42139_c1 | 3300050511 | Bacteria | 4781 |
| 665 | nmdc:mga08y16_657107_c1 | 3300050511 | Bacteria | 1052 |
| 666 | Ga0500644_0000026 | 3300053088 | Bacteria | 93328 |
| 667 | Ga0500646_0016206 | 3300053090 | Bacteria | 1945 |
| 668 | Ga0500651_0042928 | 3300053093 | Bacteria | 2849 |
| 669 | Ga0500562_000012 | 3300053108 | Bacteria | 168210 |
| 670 | Ga0500569_001103 | 3300053109 | Bacteria | 4939 |
| 671 | Ga0500607_040229 | 3300053121 | Bacteria | 2535 |
| 672 | Ga0500568_0000532 | 3300053139 | Bacteria | 28130 |
| 673 | Ga0500577_0006372 | 3300053142 | Bacteria | 3251 |
| 674 | Ga0500604_0008698 | 3300053151 | Bacteria | 2697 |
| 675 | Ga0500616_0003687 | 3300053153 | Bacteria | 11479 |
| 676 | Ga0500622_0000404 | 3300053156 | Bacteria | 41279 |
| 677 | Ga0500622_0000692 | 3300053156 | Bacteria | 29667 |
| 678 | Ga0500633_0000727 | 3300053160 | Bacteria | 5590 |
| 679 | Ga0500634_0038663 | 3300053161 | Bacteria | 2594 |
| 680 | Ga0500636_0078750 | 3300053177 | Bacteria | 1902 |
| 681 | Ga0500637_0040578 | 3300053178 | Bacteria | 2630 |
| 682 | Ga0500645_003066 | 3300053730 | Bacteria | 7018 |
| 683 | Ga0500661_001980 | 3300055283 | Bacteria | 3866 |
| 684 | Ga0500661_004886 | 3300055283 | Bacteria | 2507 |
| 685 | Ga0501082_0346033 | 3300060353 | Bacteria | 1296 |
| 686 | 2738725234 | 2738541278 | Bacteria | 9755573 |
| 687 | 2819574903 | 2818991442 | Bacteria | 8318214 |
| 688 | 2819586178 | 2818991444 | Bacteria | 6968812 |
| 689 | 2819676847 | 2818991460 | Bacteria | 7595395 |
| 690 | 2821141003 | 2821136567 | Bacteria | 8080116 |
| 691 | 2883070514 | 2883068021 | Bacteria | 6192739 |
| 692 | 2884796703 | 2884791551 | Bacteria | 8511252 |
| 693 | 2896113077 | 2896109856 | Bacteria | 7140722 |
| 694 | 2904471503 | 2904467357 | Bacteria | 8057758 |
| 695 | 2929158907 | 2929154850 | Bacteria | 6753285 |
| 696 | 2929177781 | 2929177148 | Bacteria | 7883697 |
| 697 | 2929240144 | 2929239360 | Bacteria | 7745570 |
| 698 | 2929921837 | 2929921140 | Bacteria | 8649150 |
| 699 | 2945980128 | 2945977869 | Bacteria | 7777518 |
| 700 | 2946014010 | 2946013367 | Bacteria | 7766675 |
| 701 | 8003154094 | 8003151029 | Bacteria | 8187759 |
| 702 | Ga0439457_019488 | |||
| 703 | MRS1b_contig_6702855 | |||
| 704 | JGI24740J21852_10000831 | |||
| 705 | JGI24740J21852_10022792 | |||
| 706 | JGI24739J22299_10000062 | |||
| 707 | JGI24739J22299_10004648 | |||
| 708 | JGI25154J39366_1000023 | |||
| 709 | JGI25157J39369_1004301 | |||
| 710 | JGI25159J45721_1006767 | |||
| 711 | JGI25406J46586_10004455 | |||
| 712 | rootH2_10005170 | |||
| 713 | rootH2_10048291 | |||
| 714 | rootH2_10053079 | |||
| 715 | rootL2_10052422 | |||
| 716 | rootL2_10055066 | |||
| 717 | rootL2_10207553 | |||
| 718 | rootL2_10227712 | |||
| 719 | rootL2_10230701 | |||
| 720 | rootH1_10084646 | |||
| 721 | JGI25160J50197_1009788 | |||
| 722 | Ga0055542_1003316 | |||
| 723 | Ga0055528_1001041 | |||
| 724 | Ga0055530_10000118 | |||
| 725 | Ga0055531_10000054 | |||
| 726 | Ga0065165_1000027 | |||
| 727 | Ga0065714_10077181 | |||
| 728 | Ga0065712_10003045 | |||
| 729 | Ga0065712_10107679 | |||
| 730 | Ga0070658_10000512 | |||
| 731 | Ga0070658_10295595 | |||
| 732 | Ga0070676_10000439 | |||
| 733 | Ga0070676_10001998 | |||
| 734 | Ga0070676_10002273 | |||
| 735 | Ga0070676_10137424 | |||
| 736 | Ga0070676_10228383 | |||
| 737 | Ga0070670_100011898 | |||
| 738 | Ga0070670_100068834 | |||
| 739 | Ga0070670_100079936 | |||
| 740 | Ga0070670_100097738 | |||
| 741 | Ga0070670_100169805 | |||
| 742 | Ga0070670_100196317 | |||
| 743 | Ga0070670_100216378 | |||
| 744 | Ga0070677_10016696 | |||
| 745 | Ga0068869_100001381 | |||
| 746 | Ga0068869_100018721 | |||
| 747 | Ga0068869_100021050 | |||
| 748 | Ga0068869_100021360 | |||
| 749 | Ga0068869_100224415 | |||
| 750 | Ga0070666_10005792 | |||
| 751 | Ga0070666_10024795 | |||
| 752 | Ga0070666_10028391 | |||
| 753 | Ga0070666_10054574 | |||
| 754 | Ga0070682_100067016 | |||
| 755 | Ga0070682_100155985 | |||
| 756 | Ga0068868_100000119 | |||
| 757 | Ga0068868_100003353 | |||
| 758 | Ga0068868_100004611 | |||
| 759 | Ga0070660_100014137 | |||
| 760 | Ga0070660_100102652 | |||
| 761 | Ga0070660_100147103 | |||
| 762 | Ga0070689_100078985 | |||
| 763 | Ga0070689_100113597 | |||
| 764 | Ga0070689_100127244 | |||
| 765 | Ga0070687_100003656 | |||
| 766 | Ga0070692_10129992 | |||
| 767 | Ga0070668_100000645 | |||
| 768 | Ga0070668_100008643 | |||
| 769 | Ga0070668_100029285 | |||
| 770 | Ga0070669_100018190 | |||
| 771 | Ga0070669_100131203 | |||
| 772 | Ga0070675_100005046 | |||
| 773 | Ga0070675_100052656 | |||
| 774 | Ga0070675_100066979 | |||
| 775 | Ga0070675_100089545 | |||
| 776 | Ga0070675_100384982 | |||
| 777 | Ga0070671_100029891 | |||
| 778 | Ga0070671_100078432 | |||
| 779 | Ga0070671_100163818 | |||
| 780 | Ga0070674_100009129 | |||
| 781 | Ga0070673_100000331 | |||
| 782 | Ga0070673_100024166 | |||
| 783 | Ga0070673_100030657 | |||
| 784 | Ga0070673_100040116 | |||
| 785 | Ga0070688_100059050 | |||
| 786 | Ga0070688_100086880 | |||
| 787 | Ga0070688_100123290 | |||
| 788 | Ga0070659_100045689 | |||
| 789 | Ga0070667_100001052 | |||
| 790 | Ga0070667_100024301 | |||
| 791 | Ga0070667_100034073 | |||
| 792 | Ga0070667_100268158 | |||
| 793 | Ga0070663_100100069 | |||
| 794 | Ga0070678_100008731 | |||
| 795 | Ga0070678_100200483 | |||
| 796 | Ga0070662_100001338 | |||
| 797 | Ga0070662_100023633 | |||
| 798 | Ga0070662_100030379 | |||
| 799 | Ga0070681_10039846 | |||
| 800 | Ga0070681_10116584 | |||
| 801 | Ga0068867_100016815 | |||
| 802 | Ga0068867_100027376 | |||
| 803 | Ga0068867_100039600 | |||
| 804 | Ga0068867_100086331 | |||
| 805 | Ga0070685_10048199 | |||
| 806 | Ga0070685_10049211 | |||
| 807 | Ga0070685_10052345 | |||
| 808 | Ga0070698_100000850 | |||
| 809 | Ga0070698_100004109 | |||
| 810 | Ga0070698_100018681 | |||
| 811 | Ga0070679_100000216 | |||
| 812 | Ga0070679_100024444 | |||
| 813 | Ga0070679_100083706 | |||
| 814 | Ga0070679_100283458 | |||
| 815 | Ga0070684_100057087 | |||
| 816 | Ga0068853_100001004 | |||
| 817 | Ga0068853_100061633 | |||
| 818 | Ga0068853_100136161 | |||
| 819 | Ga0068853_100196830 | |||
| 820 | Ga0068853_100199163 | |||
| 821 | Ga0070672_100000183 | |||
| 822 | Ga0070672_100275144 | |||
| 823 | Ga0070686_100102078 | |||
| 824 | Ga0070693_100058726 | |||
| 825 | Ga0070693_100171256 | |||
| 826 | Ga0070665_100000047 | |||
| 827 | Ga0070665_100001045 | |||
| 828 | Ga0070665_100084739 | |||
| 829 | Ga0068855_100000189 | |||
| 830 | Ga0068855_100011268 | |||
| 831 | Ga0068855_100036985 | |||
| 832 | Ga0068855_100076727 | |||
| 833 | Ga0068855_100077334 | |||
| 834 | Ga0068855_100114684 | |||
| 835 | Ga0070664_100017550 | |||
| 836 | Ga0070664_100040027 | |||
| 837 | Ga0070664_100042154 | |||
| 838 | Ga0070664_100053167 | |||
| 839 | Ga0070664_100053357 | |||
| 840 | Ga0068857_100002865 | |||
| 841 | Ga0068857_100031342 | |||
| 842 | Ga0068857_100076916 | |||
| 843 | Ga0068857_100208920 | |||
| 844 | Ga0068857_100211140 | |||
| 845 | Ga0068857_100326490 | |||
| 846 | Ga0068854_100047908 | |||
| 847 | Ga0068854_100157169 | |||
| 848 | Ga0068856_100014397 | |||
| 849 | Ga0068856_100016756 | |||
| 850 | Ga0068856_100039694 | |||
| 851 | Ga0068856_100140617 | |||
| 852 | Ga0070702_100017160 | |||
| 853 | Ga0068852_100007711 | |||
| 854 | Ga0068852_100051725 | |||
| 855 | Ga0068852_100069127 | |||
| 856 | Ga0068852_100069282 | |||
| 857 | Ga0068852_100087127 | |||
| 858 | Ga0068852_100169945 | |||
| 859 | Ga0068852_100194139 | |||
| 860 | Ga0068852_100245178 | |||
| 861 | Ga0068859_100000933 | |||
| 862 | Ga0068859_100024704 | |||
| 863 | Ga0068859_100163888 | |||
| 864 | Ga0068859_100228258 | |||
| 865 | Ga0068859_100265777 | |||
| 866 | Ga0068859_100320706 | |||
| 867 | Ga0068859_100429809 | |||
| 868 | Ga0068864_100003700 | |||
| 869 | Ga0068864_100026128 | |||
| 870 | Ga0068864_100082216 | |||
| 871 | Ga0068864_100254483 | |||
| 872 | Ga0068866_10007007 | |||
| 873 | Ga0068866_10044950 | |||
| 874 | Ga0068861_100002161 | |||
| 875 | Ga0068861_100016245 | |||
| 876 | Ga0068861_100019116 | |||
| 877 | Ga0068861_100056496 | |||
| 878 | Ga0068870_10005159 | |||
| 879 | Ga0068870_10071535 | |||
| 880 | Ga0068863_100003358 | |||
| 881 | Ga0068863_100024490 | |||
| 882 | Ga0068863_100150161 | |||
| 883 | Ga0068863_100431464 | |||
| 884 | Ga0068858_100001328 | |||
| 885 | Ga0068858_100034237 | |||
| 886 | Ga0068858_100183116 | |||
| 887 | Ga0068858_100214331 | |||
| 888 | Ga0068860_100000003 | |||
| 889 | Ga0068860_100001860 | |||
| 890 | Ga0068860_100053218 | |||
| 891 | Ga0068860_100146996 | |||
| 892 | Ga0068860_100217032 | |||
| 893 | Ga0068860_100305907 | |||
| 894 | Ga0068862_100003950 | |||
| 895 | Ga0081540_1007577 | |||
| 896 | Ga0081539_10000874 | |||
| 897 | Ga0097621_100000681 | |||
| 898 | Ga0097621_100008757 | |||
| 899 | Ga0097621_100040168 | |||
| 900 | Ga0097621_100119409 | |||
| 901 | Ga0075370_10103196 | |||
| 902 | Ga0068871_100005362 | |||
| 903 | Ga0068871_100007800 | |||
| 904 | Ga0068871_100014023 | |||
| 905 | Ga0068871_100023974 | |||
| 906 | Ga0068871_100026146 | |||
| 907 | Ga0068871_100054418 | |||
| 908 | Ga0075428_100006044 | |||
| 909 | Ga0075430_100003052 | |||
| 910 | Ga0075430_100038623 | |||
| 911 | Ga0075431_100006268 | |||
| 912 | Ga0075431_100032020 | |||
| 913 | Ga0075429_100022294 | |||
| 914 | Ga0075429_100349030 | |||
| 915 | Ga0068865_100016453 | |||
| 916 | Ga0068865_100293032 | |||
| 917 | Ga0097620_100000933 | |||
| 918 | Ga0097620_100024706 | |||
| 919 | Ga0097620_100163886 | |||
| 920 | Ga0097620_100228270 | |||
| 921 | Ga0097620_100265783 | |||
| 922 | Ga0097620_100320718 | |||
| 923 | Ga0097620_100429806 | |||
| 924 | Ga0105251_10032084 | |||
| 925 | Ga0105240_10000356 | |||
| 926 | Ga0105240_10000401 | |||
| 927 | Ga0105240_10003287 | |||
| 928 | Ga0105240_10006383 | |||
| 929 | Ga0105240_10008136 | |||
| 930 | Ga0105240_10205108 | |||
| 931 | Ga0105240_10220438 | |||
| 932 | Ga0105240_10275120 | |||
| 933 | Ga0111539_10054765 | |||
| 934 | Ga0111539_10310107 | |||
| 935 | Ga0111539_10750448 | |||
| 936 | Ga0105247_10000408 | |||
| 937 | Ga0114129_10158510 | |||
| 938 | Ga0105241_10000507 | |||
| 939 | Ga0105241_10010017 | |||
| 940 | Ga0105241_10052115 | |||
| 941 | Ga0105241_10179230 | |||
| 942 | Ga0105242_10018955 | |||
| 943 | Ga0105242_10036758 | |||
| 944 | Ga0105242_10137277 | |||
| 945 | Ga0105242_10216912 | |||
| 946 | Ga0105242_10235045 | |||
| 947 | Ga0105237_10000284 | |||
| 948 | Ga0105237_10002285 | |||
| 949 | Ga0105237_10003014 | |||
| 950 | Ga0105237_10019243 | |||
| 951 | Ga0105237_10026467 | |||
| 952 | Ga0105237_10151262 | |||
| 953 | Ga0105238_10006282 | |||
| 954 | Ga0105238_10113189 | |||
| 955 | Ga0105249_10004239 | |||
| 956 | Ga0105249_10014866 | |||
| 957 | Ga0105249_10095012 | |||
| 958 | Ga0105249_10173631 | |||
| 959 | Ga0105249_10215857 | |||
| 960 | Ga0105239_10000129 | |||
| 961 | Ga0105239_10002123 | |||
| 962 | Ga0105239_10002968 | |||
| 963 | Ga0105239_10042844 | |||
| 964 | Ga0105239_10070704 | |||
| 965 | Ga0105239_10129966 | |||
| 966 | Ga0105246_10029461 | |||
| 967 | Ga0105246_10277979 | |||
| 968 | Ga0157373_10002973 | |||
| 969 | Ga0157373_10016986 | |||
| 970 | Ga0157373_10018702 | |||
| 971 | Ga0157373_10022100 | |||
| 972 | Ga0157373_10037297 | |||
| 973 | Ga0157373_10101178 | |||
| 974 | Ga0157373_10161206 | |||
| 975 | Ga0157371_10000518 | |||
| 976 | Ga0157371_10000650 | |||
| 977 | Ga0157371_10000898 | |||
| 978 | Ga0157371_10004152 | |||
| 979 | Ga0157371_10008191 | |||
| 980 | Ga0157371_10009544 | |||
| 981 | Ga0157371_10022979 | |||
| 982 | Ga0157371_10040523 | |||
| 983 | Ga0157371_10060396 | |||
| 984 | Ga0157370_10000313 | |||
| 985 | Ga0157370_10142926 | |||
| 986 | Ga0157370_10162826 | |||
| 987 | Ga0157370_10182673 | |||
| 988 | Ga0157370_10473724 | |||
| 989 | Ga0157369_10027407 | |||
| 990 | Ga0157369_10065806 | |||
| 991 | Ga0157369_10069548 | |||
| 992 | Ga0157369_10542493 | |||
| 993 | Ga0157374_10000027 | |||
| 994 | Ga0157374_10001463 | |||
| 995 | Ga0157374_10005799 | |||
| 996 | Ga0157374_10041025 | |||
| 997 | Ga0157374_10061170 | |||
| 998 | Ga0157374_10094509 | |||
| 999 | Ga0157374_10269875 | |||
| 1000 | Ga0157378_10009448 | |||
| 1001 | Ga0157378_10044156 | |||
| 1002 | Ga0157378_10065461 | |||
| 1003 | Ga0163162_10004876 | |||
| 1004 | Ga0163162_10008896 | |||
| 1005 | Ga0163162_10009462 | |||
| 1006 | Ga0163162_10015856 | |||
| 1007 | Ga0163162_10029743 | |||
| 1008 | Ga0163162_10042818 | |||
| 1009 | Ga0163162_10249719 | |||
| 1010 | Ga0157372_10001911 | |||
| 1011 | Ga0157372_10004775 | |||
| 1012 | Ga0157372_10005645 | |||
| 1013 | Ga0157372_10007248 | |||
| 1014 | Ga0157372_10011038 | |||
| 1015 | Ga0157372_10026618 | |||
| 1016 | Ga0157372_10043707 | |||
| 1017 | Ga0157372_10086269 | |||
| 1018 | Ga0157372_10097571 | |||
| 1019 | Ga0157372_10100987 | |||
| 1020 | Ga0157372_10376416 | |||
| 1021 | Ga0157372_10425119 | |||
| 1022 | Ga0157372_10566550 | |||
| 1023 | Ga0157375_10090861 | |||
| 1024 | Ga0157375_10183408 | |||
| 1025 | Ga0157375_10196886 | |||
| 1026 | Ga0157375_10455481 | |||
| 1027 | Ga0163163_10000343 | |||
| 1028 | Ga0163163_10066492 | |||
| 1029 | Ga0157380_10001360 | |||
| 1030 | Ga0157377_10001764 | |||
| 1031 | Ga0157377_10032743 | |||
| 1032 | Ga0157377_10043884 | |||
| 1033 | Ga0157377_10150607 | |||
| 1034 | Ga0157379_10009096 | |||
| 1035 | Ga0157379_10038921 | |||
| 1036 | Ga0157379_10087295 | |||
| 1037 | Ga0157376_10001725 | |||
| 1038 | Ga0163161_10002608 | |||
| 1039 | Ga0163161_10030313 | |||
| 1040 | Ga0163161_10075255 | |||
| 1041 | Ga0163161_10131147 | |||
| 1042 | Ga0213876_10023605 | |||
| 1043 | Ga0209436_100675 | |||
| 1044 | Ga0209436_101411 | |||
| 1045 | Ga0209258_100302 | |||
| 1046 | Ga0209646_1000004 | |||
| 1047 | Ga0209026_1000095 | |||
| 1048 | Ga0209148_1000131 | |||
| 1049 | Ga0209673_1000078 | |||
| 1050 | Ga0209130_1000611 | |||
| 1051 | Ga0209564_1003616 | |||
| 1052 | Ga0209564_1004884 | |||
| 1053 | Ga0209758_1005348 | |||
| 1054 | Ga0209758_1008401 | |||
| 1055 | Ga0209758_1010271 | |||
| 1056 | Ga0209050_1000097 | |||
| 1057 | Ga0207426_1000026 | |||
| 1058 | Ga0207426_1000033 | |||
| 1059 | Ga0207426_1000313 | |||
| 1060 | Ga0207426_1000541 | |||
| 1061 | Ga0207426_1004062 | |||
| 1062 | Ga0209051_1017678 | |||
| 1063 | Ga0209257_1000070 | |||
| 1064 | Ga0209257_1004414 | |||
| 1065 | Ga0207682_10027539 | |||
| 1066 | Ga0207682_10058378 | |||
| 1067 | Ga0207642_10006375 | |||
| 1068 | Ga0207710_10003686 | |||
| 1069 | Ga0207688_10018716 | |||
| 1070 | Ga0207680_10000223 | |||
| 1071 | Ga0207680_10025902 | |||
| 1072 | Ga0207680_10030610 | |||
| 1073 | Ga0207680_10039114 | |||
| 1074 | Ga0207647_10000360 | |||
| 1075 | Ga0207647_10023593 | |||
| 1076 | Ga0207647_10043801 | |||
| 1077 | Ga0207647_10047652 | |||
| 1078 | Ga0207645_10000748 | |||
| 1079 | Ga0207645_10002708 | |||
| 1080 | Ga0207645_10018693 | |||
| 1081 | Ga0207645_10069824 | |||
| 1082 | Ga0207643_10003520 | |||
| 1083 | Ga0207643_10008799 | |||
| 1084 | Ga0207643_10128199 | |||
| 1085 | Ga0207705_10014693 | |||
| 1086 | Ga0207705_10060093 | |||
| 1087 | Ga0207654_10001931 | |||
| 1088 | Ga0207707_10051286 | |||
| 1089 | Ga0207707_10059131 | |||
| 1090 | Ga0207707_10111925 | |||
| 1091 | Ga0207695_10000209 | |||
| 1092 | Ga0207695_10000300 | |||
| 1093 | Ga0207695_10000365 | |||
| 1094 | Ga0207695_10000483 | |||
| 1095 | Ga0207695_10011556 | |||
| 1096 | Ga0207695_10124210 | |||
| 1097 | Ga0207671_10000650 | |||
| 1098 | Ga0207671_10001292 | |||
| 1099 | Ga0207671_10006095 | |||
| 1100 | Ga0207671_10020019 | |||
| 1101 | Ga0207671_10100364 | |||
| 1102 | Ga0207671_10246416 | |||
| 1103 | Ga0207662_10057317 | |||
| 1104 | Ga0207657_10063618 | |||
| 1105 | Ga0207657_10075396 | |||
| 1106 | Ga0207657_10077598 | |||
| 1107 | Ga0207657_10114199 | |||
| 1108 | Ga0207657_10244742 | |||
| 1109 | Ga0207652_10000090 | |||
| 1110 | Ga0207652_10000154 | |||
| 1111 | Ga0207681_10020629 | |||
| 1112 | Ga0207681_10024008 | |||
| 1113 | Ga0207694_10072544 | |||
| 1114 | Ga0207694_10227684 | |||
| 1115 | Ga0207650_10000813 | |||
| 1116 | Ga0207650_10095373 | |||
| 1117 | Ga0207650_10169240 | |||
| 1118 | Ga0207650_10183377 | |||
| 1119 | Ga0207659_10059684 | |||
| 1120 | Ga0207659_10108990 | |||
| 1121 | Ga0207644_10067295 | |||
| 1122 | Ga0207644_10168194 | |||
| 1123 | Ga0207644_10298844 | |||
| 1124 | Ga0207690_10171820 | |||
| 1125 | Ga0207706_10003423 | |||
| 1126 | Ga0207706_10004381 | |||
| 1127 | Ga0207706_10023769 | |||
| 1128 | Ga0207706_10047636 | |||
| 1129 | Ga0207706_10067978 | |||
| 1130 | Ga0207686_10008363 | |||
| 1131 | Ga0207686_10100932 | |||
| 1132 | Ga0207709_10102964 | |||
| 1133 | Ga0207670_10025416 | |||
| 1134 | Ga0207670_10062443 | |||
| 1135 | Ga0207670_10125089 | |||
| 1136 | Ga0207704_10139369 | |||
| 1137 | Ga0207691_10000057 | |||
| 1138 | Ga0207691_10106459 | |||
| 1139 | Ga0207691_10172708 | |||
| 1140 | Ga0207689_10000628 | |||
| 1141 | Ga0207689_10001062 | |||
| 1142 | Ga0207689_10001418 | |||
| 1143 | Ga0207689_10026149 | |||
| 1144 | Ga0207689_10068850 | |||
| 1145 | Ga0207689_10114339 | |||
| 1146 | Ga0207689_10134827 | |||
| 1147 | Ga0207661_10065670 | |||
| 1148 | Ga0207661_10247500 | |||
| 1149 | Ga0207679_10028829 | |||
| 1150 | Ga0207679_10042210 | |||
| 1151 | Ga0207679_10339641 | |||
| 1152 | Ga0207667_10000902 | |||
| 1153 | Ga0207667_10002948 | |||
| 1154 | Ga0207667_10018691 | |||
| 1155 | Ga0207667_10029002 | |||
| 1156 | Ga0207667_10138204 | |||
| 1157 | Ga0207667_10194964 | |||
| 1158 | Ga0207667_10195669 | |||
| 1159 | Ga0207651_10000330 | |||
| 1160 | Ga0207712_10001226 | |||
| 1161 | Ga0207712_10011611 | |||
| 1162 | Ga0207712_10088962 | |||
| 1163 | Ga0207712_10113822 | |||
| 1164 | Ga0207712_10160056 | |||
| 1165 | Ga0207712_10193392 | |||
| 1166 | Ga0207668_10000170 | |||
| 1167 | Ga0207668_10057529 | |||
| 1168 | Ga0207668_10121629 | |||
| 1169 | Ga0207640_10040381 | |||
| 1170 | Ga0207640_10102980 | |||
| 1171 | Ga0207658_10080355 | |||
| 1172 | Ga0207658_10328230 | |||
| 1173 | Ga0207677_10001046 | |||
| 1174 | Ga0207677_10011966 | |||
| 1175 | Ga0207677_10016754 | |||
| 1176 | Ga0207677_10037340 | |||
| 1177 | Ga0207677_10207244 | |||
| 1178 | Ga0207703_10087622 | |||
| 1179 | Ga0207703_10248689 | |||
| 1180 | Ga0207639_10010315 | |||
| 1181 | Ga0207639_10021680 | |||
| 1182 | Ga0207639_10230488 | |||
| 1183 | Ga0207639_10501510 | |||
| 1184 | Ga0207678_10017885 | |||
| 1185 | Ga0207702_10242182 | |||
| 1186 | Ga0207641_10009509 | |||
| 1187 | Ga0207641_10011229 | |||
| 1188 | Ga0207641_10130714 | |||
| 1189 | Ga0207641_10219428 | |||
| 1190 | Ga0207641_10373373 | |||
| 1191 | Ga0207648_10000372 | |||
| 1192 | Ga0207648_10010287 | |||
| 1193 | Ga0207648_10015759 | |||
| 1194 | Ga0207648_10025791 | |||
| 1195 | Ga0207676_10000768 | |||
| 1196 | Ga0207676_10009647 | |||
| 1197 | Ga0207676_10024603 | |||
| 1198 | Ga0207676_10046670 | |||
| 1199 | Ga0207676_10097524 | |||
| 1200 | Ga0207674_10003427 | |||
| 1201 | Ga0207674_10012617 | |||
| 1202 | Ga0207674_10021791 | |||
| 1203 | Ga0207674_10114723 | |||
| 1204 | Ga0207674_10170252 | |||
| 1205 | Ga0207675_100005048 | |||
| 1206 | Ga0207675_100019278 | |||
| 1207 | Ga0207675_100034513 | |||
| 1208 | Ga0207675_100034829 | |||
| 1209 | Ga0207675_100038027 | |||
| 1210 | Ga0207683_10001617 | |||
| 1211 | Ga0207683_10020692 | |||
| 1212 | Ga0207683_10172327 | |||
| 1213 | Ga0207683_10328448 | |||
| 1214 | Ga0207698_10005431 | |||
| 1215 | Ga0207698_10013439 | |||
| 1216 | Ga0207698_10015963 | |||
| 1217 | Ga0207698_10069679 | |||
| 1218 | Ga0207698_10247154 | |||
| 1219 | Ga0207428_10053619 | |||
| 1220 | Ga0268266_10000104 | |||
| 1221 | Ga0268266_10014894 | |||
| 1222 | Ga0268266_10076916 | |||
| 1223 | Ga0268266_10477167 | |||
| 1224 | Ga0268265_10011344 | |||
| 1225 | Ga0268265_10082175 | |||
| 1226 | Ga0268265_10154119 | |||
| 1227 | Ga0268264_10000028 | |||
| 1228 | Ga0268264_10003990 | |||
| 1229 | Ga0268264_10007340 | |||
| 1230 | Ga0268264_10033960 | |||
| 1231 | Ga0268264_10059527 | |||
| 1232 | Ga0268264_10277144 | |||
| 1233 | Ga0307517_10001269 | |||
| 1234 | Ga0307517_10116554 | |||
| 1235 | Ga0307515_10000001 | |||
| 1236 | Ga0307511_10000002 | |||
| 1237 | Ga0265327_10000024 | |||
| 1238 | Ga0265327_10000199 | |||
| 1239 | Ga0265327_10027088 | |||
| 1240 | Ga0307513_10159302 | |||
| 1241 | Ga0307513_10269466 | |||
| 1242 | Ga0307516_10003475 | |||
| 1243 | Ga0307516_10123536 | |||
| 1244 | Ga0307406_10084274 | |||
| 1245 | Ga0307510_10000141 | |||
| 1246 | Ga0373935_0187274 | |||
| 1247 | Ga0373937_0302809 | |||
| 1248 | Ga0395899_0004373 | |||
| 1249 | Ga0395899_0005666 | |||
| 1250 | Ga0395899_0012016 | |||
| 1251 | Ga0395899_0013648 | |||
| 1252 | Ga0395899_0054945 | |||
| 1253 | Ga0395899_0100865 | |||
| 1254 | Ga0395900_0000927 | |||
| 1255 | Ga0395900_0022173 | |||
| 1256 | Ga0395900_0023636 | |||
| 1257 | Ga0395900_0040131 | |||
| 1258 | Ga0395900_0096788 | |||
| 1259 | Ga0395900_0120624 | |||
| 1260 | Ga0395898_0004030 | |||
| 1261 | Ga0395898_0041634 | |||
| 1262 | Ga0395898_0074862 | |||
| 1263 | Ga0395898_0126198 | |||
| 1264 | Ga0395905_0001629 | |||
| 1265 | Ga0395905_0051538 | |||
| 1266 | Ga0395905_0311499 | |||
| 1267 | Ga0395901_0001347 | |||
| 1268 | Ga0395901_0020835 | |||
| 1269 | Ga0395901_0200019 | |||
| 1270 | Ga0395901_0387943 | |||
| 1271 | Ga0436365_1144486 | |||
| 1272 | Ga0439442_002360 | |||
| 1273 | Ga0439449_0005922 | |||
| 1274 | Ga0439449_0041880 | |||
| 1275 | Ga0439449_0066127 | |||
| 1276 | Ga0466969_0001216 | |||
| 1277 | Ga0466969_0040508 | |||
| 1278 | Ga0466972_0000069 | |||
| 1279 | Ga0466965_0009580 | |||
| 1280 | Ga0466966_0000184 | |||
| 1281 | Ga0466966_0111671 | |||
| 1282 | Ga0466961_0098970 | |||
| 1283 | Ga0466968_0029714 | |||
| 1284 | Ga0466970_0002827 | |||
| 1285 | Ga0466970_0016279 | |||
| 1286 | Ga0466957_0001692 | |||
| 1287 | Ga0466959_0000097 | |||
| 1288 | Ga0466959_0000330 | |||
| 1289 | Ga0466959_0011869 | |||
| 1290 | Ga0466967_0018192 | |||
| 1291 | Ga0495638_0037642 | |||
| 1292 | Ga0495606_0004246 | |||
| 1293 | Ga0495643_0058511 | |||
| 1294 | Ga0495621_0069260 | |||
| 1295 | Ga0495668_0000339 | |||
| 1296 | Ga0495668_0001044 | |||
| 1297 | Ga0495611_0000030 | |||
| 1298 | Ga0495687_000726 | |||
| 1299 | Ga0496100_0035934 | |||
| 1300 | Ga0496101_0259047 | |||
| 1301 | Ga0496104_0142954 | |||
| 1302 | Ga0496121_0000081 | |||
| 1303 | Ga0501031_0050483 | |||
| 1304 | Ga0501032_0007417 | |||
| 1305 | Ga0501034_0000004 | |||
| 1306 | Ga0501034_0005631 | |||
| 1307 | Ga0501034_0033462 | |||
| 1308 | Ga0501034_0039450 | |||
| 1309 | Ga0501034_0207852 | |||
| 1310 | Ga0501034_0257647 | |||
| 1311 | Ga0501034_0519449 | |||
| 1312 | Ga0501036_0185942 | |||
| 1313 | Ga0501037_0005310 | |||
| 1314 | Ga0501038_0034705 | |||
| 1315 | Ga0501038_0171550 | |||
| 1316 | Ga0501039_0014887 | |||
| 1317 | Ga0501039_0025156 | |||
| 1318 | Ga0501039_0031852 | |||
| 1319 | Ga0501043_0004690 | |||
| 1320 | Ga0501043_0011471 | |||
| 1321 | Ga0501043_0035278 | |||
| 1322 | Ga0501043_0036442 | |||
| 1323 | Ga0501046_0008975 | |||
| 1324 | Ga0501046_0053501 | |||
| 1325 | Ga0501047_0005232 | |||
| 1326 | Ga0501047_0081192 | |||
| 1327 | Ga0501047_0094448 | |||
| 1328 | Ga0501048_0001472 | |||
| 1329 | Ga0501070_0010616 | |||
| 1330 | Ga0501070_0309460 | |||
| 1331 | Ga0501071_0287338 | |||
| 1332 | Ga0501072_0047281 | |||
| 1333 | Ga0501073_0302466 | |||
| 1334 | Ga0501074_0004892 | |||
| 1335 | Ga0501074_0038714 | |||
| 1336 | Ga0501217_015630 | |||
| 1337 | Ga0501217_025909 | |||
| 1338 | Ga0501257_003588 | |||
| 1339 | Ga0501257_013964 | |||
| 1340 | Ga0501259_001424 | |||
| 1341 | Ga0501219_000564 | |||
| 1342 | Ga0501079_0138704 | |||
| 1343 | Ga0501080_0198946 | |||
| 1344 | Ga0501080_0221785 | |||
| 1345 | Ga0501280_009089 | |||
| 1346 | Ga0501035_0007031 | |||
| 1347 | Ga0501035_0012647 | |||
| 1348 | Ga0501035_0212949 | |||
| 1349 | Ga0501035_0363932 | |||
| 1350 | Ga0501044_0010112 | |||
| 1351 | Ga0501044_0012014 | |||
| 1352 | Ga0501044_0016865 | |||
| 1353 | Ga0501044_0097232 | |||
| 1354 | Ga0501044_0106037 | |||
| 1355 | Ga0501044_0278403 | |||
| 1356 | Ga0501284_00002 | |||
| 1357 | nmdc:mga0k408_158794_c1 | |||
| 1358 | nmdc:mga0k408_83189_c1 | |||
| 1359 | nmdc:mga05p37_128627_c1 | |||
| 1360 | nmdc:mga09592_2275_c1 | |||
| 1361 | nmdc:mga0qj67_20468_c1 | |||
| 1362 | nmdc:mga0qj67_57913_c1 | |||
| 1363 | nmdc:mga06r32_49237_c1 | |||
| 1364 | nmdc:mga08y16_42040_c1 | |||
| 1365 | nmdc:mga08y16_42139_c1 | |||
| 1366 | nmdc:mga08y16_657107_c1 | |||
| 1367 | Ga0500644_0000026 | |||
| 1368 | Ga0500646_0016206 | |||
| 1369 | Ga0500651_0042928 | |||
| 1370 | Ga0500562_000012 | |||
| 1371 | Ga0500569_001103 | |||
| 1372 | Ga0500607_040229 | |||
| 1373 | Ga0500568_0000532 | |||
| 1374 | Ga0500577_0006372 | |||
| 1375 | Ga0500604_0008698 | |||
| 1376 | Ga0500616_0003687 | |||
| 1377 | Ga0500622_0000404 | |||
| 1378 | Ga0500622_0000692 | |||
| 1379 | Ga0500633_0000727 | |||
| 1380 | Ga0500634_0038663 | |||
| 1381 | Ga0500636_0078750 | |||
| 1382 | Ga0500637_0040578 | |||
| 1383 | Ga0500645_003066 | |||
| 1384 | Ga0500661_001980 | |||
| 1385 | Ga0500661_004886 | |||
| 1386 | Ga0501082_0346033 | |||
| 1387 | 2738725234 | |||
| 1388 | 2819574903 | |||
| 1389 | 2819586178 | |||
| 1390 | 2819676847 | |||
| 1391 | 2821141003 | |||
| 1392 | 2883070514 | |||
| 1393 | 2884796703 | |||
| 1394 | 2896113077 | |||
| 1395 | 2904471503 | |||
| 1396 | 2929158907 | |||
| 1397 | 2929177781 | |||
| 1398 | 2929240144 | |||
| 1399 | 2929921837 | |||
| 1400 | 2945980128 | |||
| 1401 | 2946014010 | |||
| 1402 | 8003154094 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yx0-assembly1.cif.gz_A | crystal structure of p. horikoshii tyw1 | 0.7808 | 126 | 259 |
| 7tol-assembly1.cif.gz_A | x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound | 0.7723 | 83 | 271 |
| 5exk-assembly6.cif.gz_K | crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate | 0.7667 | 99 | 271 |
| 5exi-assembly1.cif.gz_A | crystal structure of m. tuberculosis lipoyl synthase at 2.28 a resolution | 0.7584 | 84 | 268 |
| 4m7s-assembly1.cif.gz_A | crystal structure of semet btrn in an open conformation | 0.7442 | 80 | 380 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58214_34_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7954 | 80 | 271 | 3.20.20.70 |
| af_O33183_77_264_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.79 | 85 | 268 | 3.20.20.70 |
| 2yx0A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7808 | 126 | 259 | 3.20.20.70 |
| af_P9WJ79_7_303_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7656 | 83 | 356 | 3.20.20.70 |
| af_Q57567_110_367_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7636 | 85 | 271 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1HWT2-F1-model_v4 | Radical SAM core domain-containing protein | 0.9643 | 116 | 210 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-M7XWR7-F1-model_v4 | Putative Fe-S oxidoreductase, SAM radical superfamily | 0.9509 | 57 | 373 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A661Z8Z5-F1-model_v4 | Radical SAM protein | 0.9465 | 46 | 347 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-M7XWR7-F1-model_v4 | Putative Fe-S oxidoreductase, SAM radical superfamily | 0.9451 | 57 | 373 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A382VJD0-F1-model_v4 | Radical SAM core domain-containing protein | 0.9443 | 109 | 293 |
GO:0003824
GO:0046872 GO:0051536 |