F476166

General Info

Members Datasets Scaffolds Average Seq Length
701 280 1402 344

Family's Representative Sequence

Representative Sequence 3300042014|Ga0439457_019488|Ga0439457_019488_432_1463
Length 326
Sequence MARFNRRDSFNLLTKLTLRRGWNGMKVLSSYYISKWTKRPIQWGYPVSISFEPTTSCNLRCPECPSGLRAFTRPTGMLQKDFFSETIDQLYKELLYLVFYFQGEPYLNPSFLDMVKYASSKKIYTAESGLDRLIISIDGTTQDTYQQYRVGGKLEKVIEGAKNIVKWKKELKSKTPFVVFQFLVVKHNEHQIEDVKRLAKEIGVDDVWFKTAQVYDYENDPNNLIPTIDKYSRYRKTENGTEFKGKLANQCWRLWHDPVITWDGLVAPCCFDKDAQHRLGNLKEKSFKEIWKNGEYTKFRTQILKGRKNIDICANCSEGTRVWEQG

Samples

Sample ID Description Type Environment
1 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
234 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
248 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
252 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
259 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 2738541278 Niastella sp. CF465 Isolate Unclassified
266 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
267 2818991444 Filimonas endophytica 3197 Isolate Unclassified
268 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
269 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
270 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
271 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
272 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
273 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
274 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
275 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
276 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
277 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
278 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
279 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
280 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.99
Nodule 0
Rhizoplane 0.43
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 11.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439457_019488 3300042014 Bacteria 1507
2 MRS1b_contig_6702855 2162886011 Bacteria 1267
3 JGI24740J21852_10000831 3300001979 Bacteria 13614
4 JGI24740J21852_10022792 3300001979 Bacteria 2149
5 JGI24739J22299_10000062 3300001989 Bacteria 29944
6 JGI24739J22299_10004648 3300001989 Bacteria 5250
7 JGI25154J39366_1000023 3300002738 Bacteria 219569
8 JGI25157J39369_1004301 3300002741 Bacteria 2631
9 JGI25159J45721_1006767 3300002987 Bacteria 3375
10 JGI25406J46586_10004455 3300003203 Bacteria 6519
11 rootH2_10005170 3300003320 Bacteria 79894
12 rootH2_10048291 3300003320 Bacteria 12301
13 rootH2_10053079 3300003320 Bacteria 20935
14 rootL2_10052422 3300003322 Bacteria 10016
15 rootL2_10055066 3300003322 Bacteria 6394
16 rootL2_10207553 3300003322 Bacteria 2559
17 rootL2_10227712 3300003322 Bacteria 2797
18 rootL2_10230701 3300003322 Bacteria 1795
19 rootH1_10084646 3300003323 Bacteria 11123
20 JGI25160J50197_1009788 3300003354 Bacteria 3522
21 Ga0055542_1003316 3300003762 Bacteria 4452
22 Ga0055528_1001041 3300003790 Bacteria 18297
23 Ga0055530_10000118 3300003791 Bacteria 68596
24 Ga0055531_10000054 3300003794 Bacteria 123684
25 Ga0065165_1000027 3300005262 Bacteria 228507
26 Ga0065714_10077181 3300005288 Bacteria 2714
27 Ga0065712_10003045 3300005290 Unclassified 3975
28 Ga0065712_10107679 3300005290 Bacteria 1888
29 Ga0070658_10000512 3300005327 Bacteria 33597
30 Ga0070658_10295595 3300005327 Unclassified 1381
31 Ga0070676_10000439 3300005328 Bacteria 19781
32 Ga0070676_10001998 3300005328 Bacteria 10370
33 Ga0070676_10002273 3300005328 Bacteria 9809
34 Ga0070676_10137424 3300005328 Unclassified 1552
35 Ga0070676_10228383 3300005328 Bacteria 1233
36 Ga0070670_100011898 3300005331 Bacteria 7441
37 Ga0070670_100068834 3300005331 Bacteria 3038
38 Ga0070670_100079936 3300005331 Unclassified 2810
39 Ga0070670_100097738 3300005331 Unclassified 2526
40 Ga0070670_100169805 3300005331 Bacteria 1892
41 Ga0070670_100196317 3300005331 Unclassified 1753
42 Ga0070670_100216378 3300005331 Bacteria 1667
43 Ga0070677_10016696 3300005333 Unclassified 2617
44 Ga0068869_100001381 3300005334 Bacteria 14366
45 Ga0068869_100018721 3300005334 Unclassified 4719
46 Ga0068869_100021050 3300005334 Bacteria 4483
47 Ga0068869_100021360 3300005334 Bacteria 4452
48 Ga0068869_100224415 3300005334 Unclassified 1490
49 Ga0070666_10005792 3300005335 Bacteria 7592
50 Ga0070666_10024795 3300005335 Bacteria 3910
51 Ga0070666_10028391 3300005335 Bacteria 3671
52 Ga0070666_10054574 3300005335 Bacteria 2696
53 Ga0070682_100067016 3300005337 Bacteria 2285
54 Ga0070682_100155985 3300005337 Bacteria 1572
55 Ga0068868_100000119 3300005338 Bacteria 49590
56 Ga0068868_100003353 3300005338 Bacteria 11144
57 Ga0068868_100004611 3300005338 Bacteria 9667
58 Ga0070660_100014137 3300005339 Bacteria 5746
59 Ga0070660_100102652 3300005339 Bacteria 2267
60 Ga0070660_100147103 3300005339 Unclassified 1893
61 Ga0070689_100078985 3300005340 Bacteria 2580
62 Ga0070689_100113597 3300005340 Unclassified 2157
63 Ga0070689_100127244 3300005340 Unclassified 2040
64 Ga0070687_100003656 3300005343 Bacteria 6011
65 Ga0070692_10129992 3300005345 Bacteria 1414
66 Ga0070668_100000645 3300005347 Bacteria 23563
67 Ga0070668_100008643 3300005347 Bacteria 7561
68 Ga0070668_100029285 3300005347 Bacteria 4181
69 Ga0070669_100018190 3300005353 Bacteria 5020
70 Ga0070669_100131203 3300005353 Bacteria 1922
71 Ga0070675_100005046 3300005354 Bacteria 10077
72 Ga0070675_100052656 3300005354 Bacteria 3347
73 Ga0070675_100066979 3300005354 Bacteria 2971
74 Ga0070675_100089545 3300005354 Bacteria 2577
75 Ga0070675_100384982 3300005354 Bacteria 1249
76 Ga0070671_100029891 3300005355 Unclassified 4495
77 Ga0070671_100078432 3300005355 Bacteria 2761
78 Ga0070671_100163818 3300005355 Bacteria 1880
79 Ga0070674_100009129 3300005356 Bacteria 5931
80 Ga0070673_100000331 3300005364 Bacteria 24760
81 Ga0070673_100024166 3300005364 Bacteria 4451
82 Ga0070673_100030657 3300005364 Bacteria 4029
83 Ga0070673_100040116 3300005364 Bacteria 3589
84 Ga0070688_100059050 3300005365 Bacteria 2417
85 Ga0070688_100086880 3300005365 Unclassified 2036
86 Ga0070688_100123290 3300005365 Bacteria 1738
87 Ga0070659_100045689 3300005366 Bacteria 3431
88 Ga0070667_100001052 3300005367 Bacteria 25199
89 Ga0070667_100024301 3300005367 Bacteria 5033
90 Ga0070667_100034073 3300005367 Bacteria 4260
91 Ga0070667_100268158 3300005367 Unclassified 1530
92 Ga0070663_100100069 3300005455 Bacteria 2162
93 Ga0070678_100008731 3300005456 Bacteria 6087
94 Ga0070678_100200483 3300005456 Unclassified 1647
95 Ga0070662_100001338 3300005457 Bacteria 15148
96 Ga0070662_100023633 3300005457 Bacteria 4224
97 Ga0070662_100030379 3300005457 Bacteria 3780
98 Ga0070681_10039846 3300005458 Bacteria 4709
99 Ga0070681_10116584 3300005458 Bacteria 2607
100 Ga0068867_100016815 3300005459 Bacteria 5198
101 Ga0068867_100027376 3300005459 Bacteria 4096
102 Ga0068867_100039600 3300005459 Bacteria 3437
103 Ga0068867_100086331 3300005459 Bacteria 2374
104 Ga0070685_10048199 3300005466 Unclassified 2453
105 Ga0070685_10049211 3300005466 Bacteria 2430
106 Ga0070685_10052345 3300005466 Unclassified 2362
107 Ga0070698_100000850 3300005471 Bacteria 33482
108 Ga0070698_100004109 3300005471 Bacteria 15995
109 Ga0070698_100018681 3300005471 Bacteria 7298
110 Ga0070679_100000216 3300005530 Bacteria 46886
111 Ga0070679_100024444 3300005530 Bacteria 5919
112 Ga0070679_100083706 3300005530 Bacteria 3178
113 Ga0070679_100283458 3300005530 Bacteria 1609
114 Ga0070684_100057087 3300005535 Bacteria 3408
115 Ga0068853_100001004 3300005539 Bacteria 19895
116 Ga0068853_100061633 3300005539 Bacteria 3245
117 Ga0068853_100136161 3300005539 Bacteria 2202
118 Ga0068853_100196830 3300005539 Bacteria 1833
119 Ga0068853_100199163 3300005539 Bacteria 1822
120 Ga0070672_100000183 3300005543 Bacteria 34362
121 Ga0070672_100275144 3300005543 Bacteria 1422
122 Ga0070686_100102078 3300005544 Bacteria 1939
123 Ga0070693_100058726 3300005547 Bacteria 2228
124 Ga0070693_100171256 3300005547 Bacteria 1391
125 Ga0070665_100000047 3300005548 Bacteria 269702
126 Ga0070665_100001045 3300005548 Bacteria 34668
127 Ga0070665_100084739 3300005548 Unclassified 3174
128 Ga0068855_100000189 3300005563 Bacteria 79227
129 Ga0068855_100011268 3300005563 Bacteria 10799
130 Ga0068855_100036985 3300005563 Bacteria 5808
131 Ga0068855_100076727 3300005563 Bacteria 3877
132 Ga0068855_100077334 3300005563 Bacteria 3861
133 Ga0068855_100114684 3300005563 Bacteria 3089
134 Ga0070664_100017550 3300005564 Bacteria 5878
135 Ga0070664_100040027 3300005564 Unclassified 3951
136 Ga0070664_100042154 3300005564 Unclassified 3853
137 Ga0070664_100053167 3300005564 Bacteria 3432
138 Ga0070664_100053357 3300005564 Bacteria 3427
139 Ga0068857_100002865 3300005577 Bacteria 14180
140 Ga0068857_100031342 3300005577 Bacteria 4697
141 Ga0068857_100076916 3300005577 Bacteria 2977
142 Ga0068857_100208920 3300005577 Bacteria 1781
143 Ga0068857_100211140 3300005577 Unclassified 1771
144 Ga0068857_100326490 3300005577 Bacteria 1418
145 Ga0068854_100047908 3300005578 Bacteria 3047
146 Ga0068854_100157169 3300005578 Bacteria 1758
147 Ga0068856_100014397 3300005614 Bacteria 7645
148 Ga0068856_100016756 3300005614 Bacteria 7099
149 Ga0068856_100039694 3300005614 Bacteria 4622
150 Ga0068856_100140617 3300005614 Bacteria 2421
151 Ga0070702_100017160 3300005615 Bacteria 3728
152 Ga0068852_100007711 3300005616 Bacteria 7874
153 Ga0068852_100051725 3300005616 Bacteria 3527
154 Ga0068852_100069127 3300005616 Bacteria 3094
155 Ga0068852_100069282 3300005616 Bacteria 3091
156 Ga0068852_100087127 3300005616 Bacteria 2785
157 Ga0068852_100169945 3300005616 Bacteria 2043
158 Ga0068852_100194139 3300005616 Unclassified 1918
159 Ga0068852_100245178 3300005616 Unclassified 1714
160 Ga0068859_100000933 3300005617 Bacteria 29963
161 Ga0068859_100024704 3300005617 Bacteria 6030
162 Ga0068859_100163888 3300005617 Bacteria 2302
163 Ga0068859_100228258 3300005617 Unclassified 1950
164 Ga0068859_100265777 3300005617 Bacteria 1807
165 Ga0068859_100320706 3300005617 Bacteria 1643
166 Ga0068859_100429809 3300005617 Bacteria 1417
167 Ga0068864_100003700 3300005618 Bacteria 12632
168 Ga0068864_100026128 3300005618 Bacteria 4922
169 Ga0068864_100082216 3300005618 Unclassified 2825
170 Ga0068864_100254483 3300005618 Unclassified 1632
171 Ga0068866_10007007 3300005718 Bacteria 4711
172 Ga0068866_10044950 3300005718 Bacteria 2212
173 Ga0068861_100002161 3300005719 Bacteria 12751
174 Ga0068861_100016245 3300005719 Bacteria 5262
175 Ga0068861_100019116 3300005719 Bacteria 4893
176 Ga0068861_100056496 3300005719 Bacteria 2996
177 Ga0068870_10005159 3300005840 Bacteria 5685
178 Ga0068870_10071535 3300005840 Bacteria 1893
179 Ga0068863_100003358 3300005841 Bacteria 15805
180 Ga0068863_100024490 3300005841 Bacteria 5756
181 Ga0068863_100150161 3300005841 Bacteria 2229
182 Ga0068863_100431464 3300005841 Unclassified 1292
183 Ga0068858_100001328 3300005842 Bacteria 25539
184 Ga0068858_100034237 3300005842 Unclassified 4711
185 Ga0068858_100183116 3300005842 Bacteria 1978
186 Ga0068858_100214331 3300005842 Unclassified 1823
187 Ga0068860_100000003 3300005843 Bacteria 575741
188 Ga0068860_100001860 3300005843 Bacteria 22460
189 Ga0068860_100053218 3300005843 Bacteria 3850
190 Ga0068860_100146996 3300005843 Bacteria 2268
191 Ga0068860_100217032 3300005843 Bacteria 1857
192 Ga0068860_100305907 3300005843 Unclassified 1558
193 Ga0068862_100003950 3300005844 Bacteria 12602
194 Ga0081540_1007577 3300005983 Bacteria 7712
195 Ga0081539_10000874 3300005985 Bacteria 57737
196 Ga0097621_100000681 3300006237 Bacteria 23791
197 Ga0097621_100008757 3300006237 Bacteria 7310
198 Ga0097621_100040168 3300006237 Bacteria 3761
199 Ga0097621_100119409 3300006237 Bacteria 2235
200 Ga0075370_10103196 3300006353 Bacteria 1652
201 Ga0068871_100005362 3300006358 Bacteria 8984
202 Ga0068871_100007800 3300006358 Bacteria 7664
203 Ga0068871_100014023 3300006358 Bacteria 5963
204 Ga0068871_100023974 3300006358 Bacteria 4728
205 Ga0068871_100026146 3300006358 Bacteria 4551
206 Ga0068871_100054418 3300006358 Bacteria 3247
207 Ga0075428_100006044 3300006844 Bacteria 13447
208 Ga0075430_100003052 3300006846 Bacteria 14002
209 Ga0075430_100038623 3300006846 Bacteria 4043
210 Ga0075431_100006268 3300006847 Bacteria 11815
211 Ga0075431_100032020 3300006847 Bacteria 5418
212 Ga0075429_100022294 3300006880 Bacteria 5493
213 Ga0075429_100349030 3300006880 Bacteria 1295
214 Ga0068865_100016453 3300006881 Unclassified 4733
215 Ga0068865_100293032 3300006881 Unclassified 1300
216 Ga0097620_100000933 3300006931 Bacteria 29963
217 Ga0097620_100024706 3300006931 Bacteria 6030
218 Ga0097620_100163886 3300006931 Bacteria 2302
219 Ga0097620_100228270 3300006931 Unclassified 1950
220 Ga0097620_100265783 3300006931 Bacteria 1807
221 Ga0097620_100320718 3300006931 Bacteria 1643
222 Ga0097620_100429806 3300006931 Bacteria 1417
223 Ga0105251_10032084 3300009011 Unclassified 2621
224 Ga0105240_10000356 3300009093 Bacteria 85978
225 Ga0105240_10000401 3300009093 Bacteria 80500
226 Ga0105240_10003287 3300009093 Bacteria 25283
227 Ga0105240_10006383 3300009093 Bacteria 17357
228 Ga0105240_10008136 3300009093 Bacteria 15045
229 Ga0105240_10205108 3300009093 Bacteria 2308
230 Ga0105240_10220438 3300009093 Bacteria 2210
231 Ga0105240_10275120 3300009093 Bacteria 1937
232 Ga0111539_10054765 3300009094 Bacteria 4744
233 Ga0111539_10310107 3300009094 Bacteria 1836
234 Ga0111539_10750448 3300009094 Bacteria 1136
235 Ga0105247_10000408 3300009101 Bacteria 36396
236 Ga0114129_10158510 3300009147 Bacteria 3094
237 Ga0105241_10000507 3300009174 Bacteria 29349
238 Ga0105241_10010017 3300009174 Bacteria 6960
239 Ga0105241_10052115 3300009174 Unclassified 3123
240 Ga0105241_10179230 3300009174 Unclassified 1756
241 Ga0105242_10018955 3300009176 Bacteria 5389
242 Ga0105242_10036758 3300009176 Bacteria 3930
243 Ga0105242_10137277 3300009176 Bacteria 2118
244 Ga0105242_10216912 3300009176 Unclassified 1708
245 Ga0105242_10235045 3300009176 Bacteria 1645
246 Ga0105237_10000284 3300009545 Bacteria 69955
247 Ga0105237_10002285 3300009545 Bacteria 23813
248 Ga0105237_10003014 3300009545 Bacteria 20313
249 Ga0105237_10019243 3300009545 Bacteria 7054
250 Ga0105237_10026467 3300009545 Bacteria 5929
251 Ga0105237_10151262 3300009545 Bacteria 2317
252 Ga0105238_10006282 3300009551 Bacteria 11809
253 Ga0105238_10113189 3300009551 Unclassified 2693
254 Ga0105249_10004239 3300009553 Bacteria 12401
255 Ga0105249_10014866 3300009553 Bacteria 6884
256 Ga0105249_10095012 3300009553 Unclassified 2795
257 Ga0105249_10173631 3300009553 Unclassified 2092
258 Ga0105249_10215857 3300009553 Unclassified 1885
259 Ga0105239_10000129 3300010375 Bacteria 106549
260 Ga0105239_10002123 3300010375 Bacteria 25586
261 Ga0105239_10002968 3300010375 Bacteria 21146
262 Ga0105239_10042844 3300010375 Bacteria 4960
263 Ga0105239_10070704 3300010375 Bacteria 3834
264 Ga0105239_10129966 3300010375 Bacteria 2800
265 Ga0105246_10029461 3300011119 Bacteria 3616
266 Ga0105246_10277979 3300011119 Unclassified 1342
267 Ga0157373_10002973 3300013100 Bacteria 12837
268 Ga0157373_10016986 3300013100 Bacteria 5301
269 Ga0157373_10018702 3300013100 Bacteria 5043
270 Ga0157373_10022100 3300013100 Bacteria 4617
271 Ga0157373_10037297 3300013100 Bacteria 3485
272 Ga0157373_10101178 3300013100 Bacteria 2028
273 Ga0157373_10161206 3300013100 Bacteria 1578
274 Ga0157371_10000518 3300013102 Bacteria 46197
275 Ga0157371_10000650 3300013102 Bacteria 41165
276 Ga0157371_10000898 3300013102 Bacteria 33500
277 Ga0157371_10004152 3300013102 Bacteria 12772
278 Ga0157371_10008191 3300013102 Bacteria 8356
279 Ga0157371_10009544 3300013102 Bacteria 7632
280 Ga0157371_10022979 3300013102 Bacteria 4560
281 Ga0157371_10040523 3300013102 Bacteria 3326
282 Ga0157371_10060396 3300013102 Bacteria 2688
283 Ga0157370_10000313 3300013104 Bacteria 60838
284 Ga0157370_10142926 3300013104 Bacteria 2229
285 Ga0157370_10162826 3300013104 Bacteria 2075
286 Ga0157370_10182673 3300013104 Bacteria 1948
287 Ga0157370_10473724 3300013104 Bacteria 1151
288 Ga0157369_10027407 3300013105 Bacteria 6316
289 Ga0157369_10065806 3300013105 Bacteria 3900
290 Ga0157369_10069548 3300013105 Bacteria 3782
291 Ga0157369_10542493 3300013105 Unclassified 1202
292 Ga0157374_10000027 3300013296 Bacteria 233444
293 Ga0157374_10001463 3300013296 Bacteria 19961
294 Ga0157374_10005799 3300013296 Bacteria 10431
295 Ga0157374_10041025 3300013296 Bacteria 4262
296 Ga0157374_10061170 3300013296 Unclassified 3526
297 Ga0157374_10094509 3300013296 Bacteria 2857
298 Ga0157374_10269875 3300013296 Bacteria 1677
299 Ga0157378_10009448 3300013297 Bacteria 8499
300 Ga0157378_10044156 3300013297 Bacteria 3957
301 Ga0157378_10065461 3300013297 Bacteria 3253
302 Ga0163162_10004876 3300013306 Bacteria 12940
303 Ga0163162_10008896 3300013306 Bacteria 9765
304 Ga0163162_10009462 3300013306 Bacteria 9474
305 Ga0163162_10015856 3300013306 Bacteria 7363
306 Ga0163162_10029743 3300013306 Bacteria 5406
307 Ga0163162_10042818 3300013306 Unclassified 4533
308 Ga0163162_10249719 3300013306 Bacteria 1906
309 Ga0157372_10001911 3300013307 Bacteria 22615
310 Ga0157372_10004775 3300013307 Bacteria 14396
311 Ga0157372_10005645 3300013307 Bacteria 13304
312 Ga0157372_10007248 3300013307 Bacteria 11812
313 Ga0157372_10011038 3300013307 Bacteria 9614
314 Ga0157372_10026618 3300013307 Bacteria 6294
315 Ga0157372_10043707 3300013307 Bacteria 4962
316 Ga0157372_10086269 3300013307 Bacteria 3561
317 Ga0157372_10097571 3300013307 Bacteria 3352
318 Ga0157372_10100987 3300013307 Unclassified 3293
319 Ga0157372_10376416 3300013307 Bacteria 1654
320 Ga0157372_10425119 3300013307 Bacteria 1548
321 Ga0157372_10566550 3300013307 Bacteria 1324
322 Ga0157375_10090861 3300013308 Bacteria 3113
323 Ga0157375_10183408 3300013308 Unclassified 2245
324 Ga0157375_10196886 3300013308 Bacteria 2170
325 Ga0157375_10455481 3300013308 Bacteria 1445
326 Ga0163163_10000343 3300014325 Bacteria 44866
327 Ga0163163_10066492 3300014325 Unclassified 3580
328 Ga0157380_10001360 3300014326 Bacteria 15918
329 Ga0157377_10001764 3300014745 Bacteria 9426
330 Ga0157377_10032743 3300014745 Bacteria 2833
331 Ga0157377_10043884 3300014745 Bacteria 2491
332 Ga0157377_10150607 3300014745 Bacteria 1438
333 Ga0157379_10009096 3300014968 Bacteria 8656
334 Ga0157379_10038921 3300014968 Unclassified 4242
335 Ga0157379_10087295 3300014968 Unclassified 2797
336 Ga0157376_10001725 3300014969 Bacteria 14540
337 Ga0163161_10002608 3300017792 Bacteria 12848
338 Ga0163161_10030313 3300017792 Bacteria 3848
339 Ga0163161_10075255 3300017792 Bacteria 2477
340 Ga0163161_10131147 3300017792 Bacteria 1891
341 Ga0213876_10023605 3300021384 Bacteria 3248
342 Ga0209436_100675 3300025208 Bacteria 14517
343 Ga0209436_101411 3300025208 Bacteria 8449
344 Ga0209258_100302 3300025242 Bacteria 79794
345 Ga0209646_1000004 3300025246 Bacteria 786587
346 Ga0209026_1000095 3300025250 Bacteria 164309
347 Ga0209148_1000131 3300025254 Bacteria 174079
348 Ga0209673_1000078 3300025273 Bacteria 227727
349 Ga0209130_1000611 3300025284 Bacteria 34241
350 Ga0209564_1003616 3300025295 Bacteria 10288
351 Ga0209564_1004884 3300025295 Bacteria 7950
352 Ga0209758_1005348 3300025297 Bacteria 9961
353 Ga0209758_1008401 3300025297 Bacteria 6703
354 Ga0209758_1010271 3300025297 Bacteria 5636
355 Ga0209050_1000097 3300025298 Bacteria 239919
356 Ga0207426_1000026 3300025302 Bacteria 515228
357 Ga0207426_1000033 3300025302 Bacteria 455976
358 Ga0207426_1000313 3300025302 Bacteria 94934
359 Ga0207426_1000541 3300025302 Bacteria 54110
360 Ga0207426_1004062 3300025302 Bacteria 7389
361 Ga0209051_1017678 3300025303 Bacteria 3180
362 Ga0209257_1000070 3300025304 Bacteria 336454
363 Ga0209257_1004414 3300025304 Bacteria 10921
364 Ga0207682_10027539 3300025893 Bacteria 2264
365 Ga0207682_10058378 3300025893 Unclassified 1610
366 Ga0207642_10006375 3300025899 Bacteria 3918
367 Ga0207710_10003686 3300025900 Bacteria 6791
368 Ga0207688_10018716 3300025901 Bacteria 3766
369 Ga0207680_10000223 3300025903 Bacteria 27399
370 Ga0207680_10025902 3300025903 Bacteria 3242
371 Ga0207680_10030610 3300025903 Bacteria 3038
372 Ga0207680_10039114 3300025903 Bacteria 2750
373 Ga0207647_10000360 3300025904 Bacteria 37076
374 Ga0207647_10023593 3300025904 Bacteria 4068
375 Ga0207647_10043801 3300025904 Bacteria 2798
376 Ga0207647_10047652 3300025904 Unclassified 2665
377 Ga0207645_10000748 3300025907 Bacteria 27039
378 Ga0207645_10002708 3300025907 Bacteria 13802
379 Ga0207645_10018693 3300025907 Bacteria 4551
380 Ga0207645_10069824 3300025907 Bacteria 2247
381 Ga0207643_10003520 3300025908 Bacteria 8423
382 Ga0207643_10008799 3300025908 Bacteria 5416
383 Ga0207643_10128199 3300025908 Bacteria 1507
384 Ga0207705_10014693 3300025909 Bacteria 5631
385 Ga0207705_10060093 3300025909 Bacteria 2744
386 Ga0207654_10001931 3300025911 Bacteria 10741
387 Ga0207707_10051286 3300025912 Bacteria 3593
388 Ga0207707_10059131 3300025912 Bacteria 3335
389 Ga0207707_10111925 3300025912 Bacteria 2387
390 Ga0207695_10000209 3300025913 Bacteria 157802
391 Ga0207695_10000300 3300025913 Bacteria 122104
392 Ga0207695_10000365 3300025913 Bacteria 103398
393 Ga0207695_10000483 3300025913 Bacteria 85395
394 Ga0207695_10011556 3300025913 Bacteria 10681
395 Ga0207695_10124210 3300025913 Bacteria 2545
396 Ga0207671_10000650 3300025914 Bacteria 45400
397 Ga0207671_10001292 3300025914 Bacteria 29407
398 Ga0207671_10006095 3300025914 Bacteria 10856
399 Ga0207671_10020019 3300025914 Bacteria 5104
400 Ga0207671_10100364 3300025914 Bacteria 2191
401 Ga0207671_10246416 3300025914 Bacteria 1404
402 Ga0207662_10057317 3300025918 Bacteria 2328
403 Ga0207657_10063618 3300025919 Bacteria 3153
404 Ga0207657_10075396 3300025919 Bacteria 2847
405 Ga0207657_10077598 3300025919 Bacteria 2799
406 Ga0207657_10114199 3300025919 Bacteria 2227
407 Ga0207657_10244742 3300025919 Bacteria 1431
408 Ga0207652_10000090 3300025921 Bacteria 99245
409 Ga0207652_10000154 3300025921 Bacteria 74554
410 Ga0207681_10020629 3300025923 Bacteria 4179
411 Ga0207681_10024008 3300025923 Bacteria 3907
412 Ga0207694_10072544 3300025924 Unclassified 2692
413 Ga0207694_10227684 3300025924 Bacteria 1522
414 Ga0207650_10000813 3300025925 Bacteria 23983
415 Ga0207650_10095373 3300025925 Unclassified 2280
416 Ga0207650_10169240 3300025925 Bacteria 1736
417 Ga0207650_10183377 3300025925 Unclassified 1669
418 Ga0207659_10059684 3300025926 Unclassified 2743
419 Ga0207659_10108990 3300025926 Bacteria 2101
420 Ga0207644_10067295 3300025931 Bacteria 2611
421 Ga0207644_10168194 3300025931 Unclassified 1709
422 Ga0207644_10298844 3300025931 Unclassified 1297
423 Ga0207690_10171820 3300025932 Unclassified 1624
424 Ga0207706_10003423 3300025933 Bacteria 15150
425 Ga0207706_10004381 3300025933 Bacteria 13267
426 Ga0207706_10023769 3300025933 Bacteria 5499
427 Ga0207706_10047636 3300025933 Bacteria 3792
428 Ga0207706_10067978 3300025933 Bacteria 3136
429 Ga0207686_10008363 3300025934 Bacteria 5586
430 Ga0207686_10100932 3300025934 Unclassified 1926
431 Ga0207709_10102964 3300025935 Unclassified 1891
432 Ga0207670_10025416 3300025936 Bacteria 3717
433 Ga0207670_10062443 3300025936 Unclassified 2546
434 Ga0207670_10125089 3300025936 Unclassified 1875
435 Ga0207704_10139369 3300025938 Unclassified 1694
436 Ga0207691_10000057 3300025940 Bacteria 89823
437 Ga0207691_10106459 3300025940 Bacteria 2498
438 Ga0207691_10172708 3300025940 Bacteria 1892
439 Ga0207689_10000628 3300025942 Bacteria 33617
440 Ga0207689_10001062 3300025942 Bacteria 26443
441 Ga0207689_10001418 3300025942 Bacteria 22893
442 Ga0207689_10026149 3300025942 Bacteria 4887
443 Ga0207689_10068850 3300025942 Bacteria 2908
444 Ga0207689_10114339 3300025942 Bacteria 2218
445 Ga0207689_10134827 3300025942 Bacteria 2033
446 Ga0207661_10065670 3300025944 Bacteria 2946
447 Ga0207661_10247500 3300025944 Unclassified 1583
448 Ga0207679_10028829 3300025945 Bacteria 3858
449 Ga0207679_10042210 3300025945 Unclassified 3276
450 Ga0207679_10339641 3300025945 Bacteria 1306
451 Ga0207667_10000902 3300025949 Bacteria 37879
452 Ga0207667_10002948 3300025949 Bacteria 21118
453 Ga0207667_10018691 3300025949 Bacteria 7764
454 Ga0207667_10029002 3300025949 Bacteria 6007
455 Ga0207667_10138204 3300025949 Bacteria 2509
456 Ga0207667_10194964 3300025949 Bacteria 2078
457 Ga0207667_10195669 3300025949 Bacteria 2074
458 Ga0207651_10000330 3300025960 Bacteria 20100
459 Ga0207712_10001226 3300025961 Bacteria 17716
460 Ga0207712_10011611 3300025961 Bacteria 5616
461 Ga0207712_10088962 3300025961 Bacteria 2269
462 Ga0207712_10113822 3300025961 Unclassified 2034
463 Ga0207712_10160056 3300025961 Bacteria 1749
464 Ga0207712_10193392 3300025961 Unclassified 1607
465 Ga0207668_10000170 3300025972 Bacteria 45140
466 Ga0207668_10057529 3300025972 Bacteria 2713
467 Ga0207668_10121629 3300025972 Unclassified 1977
468 Ga0207640_10040381 3300025981 Bacteria 2959
469 Ga0207640_10102980 3300025981 Bacteria 2006
470 Ga0207658_10080355 3300025986 Unclassified 2497
471 Ga0207658_10328230 3300025986 Unclassified 1326
472 Ga0207677_10001046 3300026023 Bacteria 15188
473 Ga0207677_10011966 3300026023 Bacteria 4969
474 Ga0207677_10016754 3300026023 Bacteria 4350
475 Ga0207677_10037340 3300026023 Bacteria 3175
476 Ga0207677_10207244 3300026023 Bacteria 1563
477 Ga0207703_10087622 3300026035 Unclassified 2611
478 Ga0207703_10248689 3300026035 Bacteria 1601
479 Ga0207639_10010315 3300026041 Bacteria 6468
480 Ga0207639_10021680 3300026041 Bacteria 4618
481 Ga0207639_10230488 3300026041 Bacteria 1605
482 Ga0207639_10501510 3300026041 Bacteria 1109
483 Ga0207678_10017885 3300026067 Bacteria 6227
484 Ga0207702_10242182 3300026078 Bacteria 1690
485 Ga0207641_10009509 3300026088 Bacteria 8013
486 Ga0207641_10011229 3300026088 Bacteria 7347
487 Ga0207641_10130714 3300026088 Bacteria 2254
488 Ga0207641_10219428 3300026088 Bacteria 1762
489 Ga0207641_10373373 3300026088 Bacteria 1364
490 Ga0207648_10000372 3300026089 Bacteria 49262
491 Ga0207648_10010287 3300026089 Bacteria 8882
492 Ga0207648_10015759 3300026089 Bacteria 6934
493 Ga0207648_10025791 3300026089 Bacteria 5231
494 Ga0207676_10000768 3300026095 Bacteria 25093
495 Ga0207676_10009647 3300026095 Bacteria 6869
496 Ga0207676_10024603 3300026095 Bacteria 4458
497 Ga0207676_10046670 3300026095 Bacteria 3353
498 Ga0207676_10097524 3300026095 Bacteria 2429
499 Ga0207674_10003427 3300026116 Bacteria 19412
500 Ga0207674_10012617 3300026116 Bacteria 9444
501 Ga0207674_10021791 3300026116 Bacteria 6896
502 Ga0207674_10114723 3300026116 Bacteria 2666
503 Ga0207674_10170252 3300026116 Bacteria 2131
504 Ga0207675_100005048 3300026118 Bacteria 12708
505 Ga0207675_100019278 3300026118 Bacteria 6363
506 Ga0207675_100034513 3300026118 Bacteria 4717
507 Ga0207675_100034829 3300026118 Bacteria 4696
508 Ga0207675_100038027 3300026118 Unclassified 4491
509 Ga0207683_10001617 3300026121 Bacteria 20205
510 Ga0207683_10020692 3300026121 Bacteria 5629
511 Ga0207683_10172327 3300026121 Bacteria 1960
512 Ga0207683_10328448 3300026121 Bacteria 1402
513 Ga0207698_10005431 3300026142 Bacteria 7879
514 Ga0207698_10013439 3300026142 Bacteria 5401
515 Ga0207698_10015963 3300026142 Bacteria 5049
516 Ga0207698_10069679 3300026142 Bacteria 2782
517 Ga0207698_10247154 3300026142 Bacteria 1630
518 Ga0207428_10053619 3300027907 Bacteria 3215
519 Ga0268266_10000104 3300028379 Bacteria 178320
520 Ga0268266_10014894 3300028379 Bacteria 6677
521 Ga0268266_10076916 3300028379 Unclassified 2901
522 Ga0268266_10477167 3300028379 Bacteria 1188
523 Ga0268265_10011344 3300028380 Bacteria 6027
524 Ga0268265_10082175 3300028380 Bacteria 2547
525 Ga0268265_10154119 3300028380 Unclassified 1942
526 Ga0268264_10000028 3300028381 Bacteria 426662
527 Ga0268264_10003990 3300028381 Bacteria 12636
528 Ga0268264_10007340 3300028381 Bacteria 9212
529 Ga0268264_10033960 3300028381 Bacteria 4194
530 Ga0268264_10059527 3300028381 Bacteria 3200
531 Ga0268264_10277144 3300028381 Unclassified 1569
532 Ga0307517_10001269 3300028786 Bacteria 42402
533 Ga0307517_10116554 3300028786 Bacteria 1999
534 Ga0307515_10000001 3300028794 Bacteria 4259510
535 Ga0307511_10000002 3300030521 Bacteria 199923
536 Ga0265327_10000024 3300031251 Bacteria 382499
537 Ga0265327_10000199 3300031251 Bacteria 125838
538 Ga0265327_10027088 3300031251 Bacteria 3305
539 Ga0307513_10159302 3300031456 Unclassified 2152
540 Ga0307513_10269466 3300031456 Bacteria 1487
541 Ga0307516_10003475 3300031730 Bacteria 20196
542 Ga0307516_10123536 3300031730 Bacteria 2376
543 Ga0307406_10084274 3300031901 Bacteria 2122
544 Ga0307510_10000141 3300033180 Bacteria 59562
545 Ga0373935_0187274 3300035692 Bacteria 1424
546 Ga0373937_0302809 3300036401 Unclassified 1511
547 Ga0395899_0004373 3300037312 Bacteria 11019
548 Ga0395899_0005666 3300037312 Bacteria 9697
549 Ga0395899_0012016 3300037312 Bacteria 6634
550 Ga0395899_0013648 3300037312 Bacteria 6210
551 Ga0395899_0054945 3300037312 Bacteria 2945
552 Ga0395899_0100865 3300037312 Bacteria 2084
553 Ga0395900_0000927 3300037418 Bacteria 38470
554 Ga0395900_0022173 3300037418 Bacteria 6496
555 Ga0395900_0023636 3300037418 Bacteria 6287
556 Ga0395900_0040131 3300037418 Bacteria 4823
557 Ga0395900_0096788 3300037418 Unclassified 3032
558 Ga0395900_0120624 3300037418 Bacteria 2690
559 Ga0395898_0004030 3300037466 Bacteria 16151
560 Ga0395898_0041634 3300037466 Bacteria 4536
561 Ga0395898_0074862 3300037466 Bacteria 3270
562 Ga0395898_0126198 3300037466 Bacteria 2451
563 Ga0395905_0001629 3300037471 Bacteria 26648
564 Ga0395905_0051538 3300037471 Bacteria 3855
565 Ga0395905_0311499 3300037471 Bacteria 1463
566 Ga0395901_0001347 3300038443 Bacteria 25756
567 Ga0395901_0020835 3300038443 Bacteria 6712
568 Ga0395901_0200019 3300038443 Bacteria 2094
569 Ga0395901_0387943 3300038443 Bacteria 1436
570 Ga0436365_1144486 3300039437 Bacteria 19138
571 Ga0439442_002360 3300042002 Bacteria 3703
572 Ga0439449_0005922 3300042007 Bacteria 4670
573 Ga0439449_0041880 3300042007 Bacteria 1703
574 Ga0439449_0066127 3300042007 Bacteria 1333
575 Ga0466969_0001216 3300044656 Bacteria 13901
576 Ga0466969_0040508 3300044656 Bacteria 2334
577 Ga0466972_0000069 3300044658 Bacteria 100746
578 Ga0466965_0009580 3300044683 Bacteria 4503
579 Ga0466966_0000184 3300044684 Bacteria 41499
580 Ga0466966_0111671 3300044684 Bacteria 1685
581 Ga0466961_0098970 3300044693 Bacteria 1838
582 Ga0466968_0029714 3300044735 Bacteria 2261
583 Ga0466970_0002827 3300044765 Bacteria 8383
584 Ga0466970_0016279 3300044765 Bacteria 3831
585 Ga0466957_0001692 3300044842 Bacteria 11593
586 Ga0466959_0000097 3300045049 Bacteria 55620
587 Ga0466959_0000330 3300045049 Bacteria 27908
588 Ga0466959_0011869 3300045049 Bacteria 6275
589 Ga0466967_0018192 3300045976 Bacteria 5607
590 Ga0495638_0037642 3300046460 Bacteria 3077
591 Ga0495606_0004246 3300046507 Bacteria 14488
592 Ga0495643_0058511 3300046522 Bacteria 2051
593 Ga0495621_0069260 3300046539 Bacteria 1296
594 Ga0495668_0000339 3300046616 Bacteria 62659
595 Ga0495668_0001044 3300046616 Bacteria 29358
596 Ga0495611_0000030 3300046648 Bacteria 111786
597 Ga0495687_000726 3300047443 Bacteria 36440
598 Ga0496100_0035934 3300048903 Bacteria 3121
599 Ga0496101_0259047 3300048904 Bacteria 1356
600 Ga0496104_0142954 3300048907 Unclassified 2299
601 Ga0496121_0000081 3300048924 Bacteria 229506
602 Ga0501031_0050483 3300049568 Bacteria 2710
603 Ga0501032_0007417 3300049569 Bacteria 8011
604 Ga0501034_0000004 3300049571 Bacteria 382255
605 Ga0501034_0005631 3300049571 Bacteria 13642
606 Ga0501034_0033462 3300049571 Bacteria 5214
607 Ga0501034_0039450 3300049571 Bacteria 4783
608 Ga0501034_0207852 3300049571 Bacteria 1913
609 Ga0501034_0257647 3300049571 Bacteria 1688
610 Ga0501034_0519449 3300049571 Bacteria 1103
611 Ga0501036_0185942 3300049572 Unclassified 1748
612 Ga0501037_0005310 3300049573 Bacteria 9372
613 Ga0501038_0034705 3300049574 Bacteria 4434
614 Ga0501038_0171550 3300049574 Bacteria 1756
615 Ga0501039_0014887 3300049575 Bacteria 5948
616 Ga0501039_0025156 3300049575 Bacteria 4573
617 Ga0501039_0031852 3300049575 Bacteria 4065
618 Ga0501043_0004690 3300049579 Bacteria 11081
619 Ga0501043_0011471 3300049579 Bacteria 6937
620 Ga0501043_0035278 3300049579 Bacteria 3934
621 Ga0501043_0036442 3300049579 Bacteria 3869
622 Ga0501046_0008975 3300049580 Bacteria 8680
623 Ga0501046_0053501 3300049580 Bacteria 3179
624 Ga0501047_0005232 3300049581 Bacteria 12180
625 Ga0501047_0081192 3300049581 Bacteria 3117
626 Ga0501047_0094448 3300049581 Bacteria 2869
627 Ga0501048_0001472 3300049582 Bacteria 17846
628 Ga0501070_0010616 3300049586 Bacteria 7786
629 Ga0501070_0309460 3300049586 Bacteria 1286
630 Ga0501071_0287338 3300049587 Bacteria 1245
631 Ga0501072_0047281 3300049588 Bacteria 3389
632 Ga0501073_0302466 3300049589 Bacteria 1103
633 Ga0501074_0004892 3300049590 Bacteria 9607
634 Ga0501074_0038714 3300049590 Bacteria 3454
635 Ga0501217_015630 3300049661 Bacteria 1731
636 Ga0501217_025909 3300049661 Bacteria 1414
637 Ga0501257_003588 3300049686 Bacteria 3343
638 Ga0501257_013964 3300049686 Bacteria 1842
639 Ga0501259_001424 3300049688 Bacteria 3977
640 Ga0501219_000564 3300049703 Bacteria 5408
641 Ga0501079_0138704 3300049741 Unclassified 1894
642 Ga0501080_0198946 3300049742 Bacteria 1840
643 Ga0501080_0221785 3300049742 Bacteria 1730
644 Ga0501280_009089 3300049776 Bacteria 1383
645 Ga0501035_0007031 3300049822 Bacteria 10516
646 Ga0501035_0012647 3300049822 Bacteria 7799
647 Ga0501035_0212949 3300049822 Bacteria 1653
648 Ga0501035_0363932 3300049822 Bacteria 1208
649 Ga0501044_0010112 3300049823 Bacteria 10251
650 Ga0501044_0012014 3300049823 Bacteria 9381
651 Ga0501044_0016865 3300049823 Bacteria 7836
652 Ga0501044_0097232 3300049823 Bacteria 2966
653 Ga0501044_0106037 3300049823 Bacteria 2822
654 Ga0501044_0278403 3300049823 Bacteria 1607
655 Ga0501284_00002 3300050005 Bacteria 220402
656 nmdc:mga0k408_158794_c1 3300050493 Bacteria 1347
657 nmdc:mga0k408_83189_c1 3300050493 Bacteria 1876
658 nmdc:mga05p37_128627_c1 3300050507 Bacteria 3109
659 nmdc:mga09592_2275_c1 3300050508 Bacteria 15469
660 nmdc:mga0qj67_20468_c1 3300050509 Bacteria 5065
661 nmdc:mga0qj67_57913_c1 3300050509 Bacteria 3072
662 nmdc:mga06r32_49237_c1 3300050510 Bacteria 4029
663 nmdc:mga08y16_42040_c1 3300050511 Bacteria 4787
664 nmdc:mga08y16_42139_c1 3300050511 Bacteria 4781
665 nmdc:mga08y16_657107_c1 3300050511 Bacteria 1052
666 Ga0500644_0000026 3300053088 Bacteria 93328
667 Ga0500646_0016206 3300053090 Bacteria 1945
668 Ga0500651_0042928 3300053093 Bacteria 2849
669 Ga0500562_000012 3300053108 Bacteria 168210
670 Ga0500569_001103 3300053109 Bacteria 4939
671 Ga0500607_040229 3300053121 Bacteria 2535
672 Ga0500568_0000532 3300053139 Bacteria 28130
673 Ga0500577_0006372 3300053142 Bacteria 3251
674 Ga0500604_0008698 3300053151 Bacteria 2697
675 Ga0500616_0003687 3300053153 Bacteria 11479
676 Ga0500622_0000404 3300053156 Bacteria 41279
677 Ga0500622_0000692 3300053156 Bacteria 29667
678 Ga0500633_0000727 3300053160 Bacteria 5590
679 Ga0500634_0038663 3300053161 Bacteria 2594
680 Ga0500636_0078750 3300053177 Bacteria 1902
681 Ga0500637_0040578 3300053178 Bacteria 2630
682 Ga0500645_003066 3300053730 Bacteria 7018
683 Ga0500661_001980 3300055283 Bacteria 3866
684 Ga0500661_004886 3300055283 Bacteria 2507
685 Ga0501082_0346033 3300060353 Bacteria 1296
686 2738725234 2738541278 Bacteria 9755573
687 2819574903 2818991442 Bacteria 8318214
688 2819586178 2818991444 Bacteria 6968812
689 2819676847 2818991460 Bacteria 7595395
690 2821141003 2821136567 Bacteria 8080116
691 2883070514 2883068021 Bacteria 6192739
692 2884796703 2884791551 Bacteria 8511252
693 2896113077 2896109856 Bacteria 7140722
694 2904471503 2904467357 Bacteria 8057758
695 2929158907 2929154850 Bacteria 6753285
696 2929177781 2929177148 Bacteria 7883697
697 2929240144 2929239360 Bacteria 7745570
698 2929921837 2929921140 Bacteria 8649150
699 2945980128 2945977869 Bacteria 7777518
700 2946014010 2946013367 Bacteria 7766675
701 8003154094 8003151029 Bacteria 8187759
702 Ga0439457_019488
703 MRS1b_contig_6702855
704 JGI24740J21852_10000831
705 JGI24740J21852_10022792
706 JGI24739J22299_10000062
707 JGI24739J22299_10004648
708 JGI25154J39366_1000023
709 JGI25157J39369_1004301
710 JGI25159J45721_1006767
711 JGI25406J46586_10004455
712 rootH2_10005170
713 rootH2_10048291
714 rootH2_10053079
715 rootL2_10052422
716 rootL2_10055066
717 rootL2_10207553
718 rootL2_10227712
719 rootL2_10230701
720 rootH1_10084646
721 JGI25160J50197_1009788
722 Ga0055542_1003316
723 Ga0055528_1001041
724 Ga0055530_10000118
725 Ga0055531_10000054
726 Ga0065165_1000027
727 Ga0065714_10077181
728 Ga0065712_10003045
729 Ga0065712_10107679
730 Ga0070658_10000512
731 Ga0070658_10295595
732 Ga0070676_10000439
733 Ga0070676_10001998
734 Ga0070676_10002273
735 Ga0070676_10137424
736 Ga0070676_10228383
737 Ga0070670_100011898
738 Ga0070670_100068834
739 Ga0070670_100079936
740 Ga0070670_100097738
741 Ga0070670_100169805
742 Ga0070670_100196317
743 Ga0070670_100216378
744 Ga0070677_10016696
745 Ga0068869_100001381
746 Ga0068869_100018721
747 Ga0068869_100021050
748 Ga0068869_100021360
749 Ga0068869_100224415
750 Ga0070666_10005792
751 Ga0070666_10024795
752 Ga0070666_10028391
753 Ga0070666_10054574
754 Ga0070682_100067016
755 Ga0070682_100155985
756 Ga0068868_100000119
757 Ga0068868_100003353
758 Ga0068868_100004611
759 Ga0070660_100014137
760 Ga0070660_100102652
761 Ga0070660_100147103
762 Ga0070689_100078985
763 Ga0070689_100113597
764 Ga0070689_100127244
765 Ga0070687_100003656
766 Ga0070692_10129992
767 Ga0070668_100000645
768 Ga0070668_100008643
769 Ga0070668_100029285
770 Ga0070669_100018190
771 Ga0070669_100131203
772 Ga0070675_100005046
773 Ga0070675_100052656
774 Ga0070675_100066979
775 Ga0070675_100089545
776 Ga0070675_100384982
777 Ga0070671_100029891
778 Ga0070671_100078432
779 Ga0070671_100163818
780 Ga0070674_100009129
781 Ga0070673_100000331
782 Ga0070673_100024166
783 Ga0070673_100030657
784 Ga0070673_100040116
785 Ga0070688_100059050
786 Ga0070688_100086880
787 Ga0070688_100123290
788 Ga0070659_100045689
789 Ga0070667_100001052
790 Ga0070667_100024301
791 Ga0070667_100034073
792 Ga0070667_100268158
793 Ga0070663_100100069
794 Ga0070678_100008731
795 Ga0070678_100200483
796 Ga0070662_100001338
797 Ga0070662_100023633
798 Ga0070662_100030379
799 Ga0070681_10039846
800 Ga0070681_10116584
801 Ga0068867_100016815
802 Ga0068867_100027376
803 Ga0068867_100039600
804 Ga0068867_100086331
805 Ga0070685_10048199
806 Ga0070685_10049211
807 Ga0070685_10052345
808 Ga0070698_100000850
809 Ga0070698_100004109
810 Ga0070698_100018681
811 Ga0070679_100000216
812 Ga0070679_100024444
813 Ga0070679_100083706
814 Ga0070679_100283458
815 Ga0070684_100057087
816 Ga0068853_100001004
817 Ga0068853_100061633
818 Ga0068853_100136161
819 Ga0068853_100196830
820 Ga0068853_100199163
821 Ga0070672_100000183
822 Ga0070672_100275144
823 Ga0070686_100102078
824 Ga0070693_100058726
825 Ga0070693_100171256
826 Ga0070665_100000047
827 Ga0070665_100001045
828 Ga0070665_100084739
829 Ga0068855_100000189
830 Ga0068855_100011268
831 Ga0068855_100036985
832 Ga0068855_100076727
833 Ga0068855_100077334
834 Ga0068855_100114684
835 Ga0070664_100017550
836 Ga0070664_100040027
837 Ga0070664_100042154
838 Ga0070664_100053167
839 Ga0070664_100053357
840 Ga0068857_100002865
841 Ga0068857_100031342
842 Ga0068857_100076916
843 Ga0068857_100208920
844 Ga0068857_100211140
845 Ga0068857_100326490
846 Ga0068854_100047908
847 Ga0068854_100157169
848 Ga0068856_100014397
849 Ga0068856_100016756
850 Ga0068856_100039694
851 Ga0068856_100140617
852 Ga0070702_100017160
853 Ga0068852_100007711
854 Ga0068852_100051725
855 Ga0068852_100069127
856 Ga0068852_100069282
857 Ga0068852_100087127
858 Ga0068852_100169945
859 Ga0068852_100194139
860 Ga0068852_100245178
861 Ga0068859_100000933
862 Ga0068859_100024704
863 Ga0068859_100163888
864 Ga0068859_100228258
865 Ga0068859_100265777
866 Ga0068859_100320706
867 Ga0068859_100429809
868 Ga0068864_100003700
869 Ga0068864_100026128
870 Ga0068864_100082216
871 Ga0068864_100254483
872 Ga0068866_10007007
873 Ga0068866_10044950
874 Ga0068861_100002161
875 Ga0068861_100016245
876 Ga0068861_100019116
877 Ga0068861_100056496
878 Ga0068870_10005159
879 Ga0068870_10071535
880 Ga0068863_100003358
881 Ga0068863_100024490
882 Ga0068863_100150161
883 Ga0068863_100431464
884 Ga0068858_100001328
885 Ga0068858_100034237
886 Ga0068858_100183116
887 Ga0068858_100214331
888 Ga0068860_100000003
889 Ga0068860_100001860
890 Ga0068860_100053218
891 Ga0068860_100146996
892 Ga0068860_100217032
893 Ga0068860_100305907
894 Ga0068862_100003950
895 Ga0081540_1007577
896 Ga0081539_10000874
897 Ga0097621_100000681
898 Ga0097621_100008757
899 Ga0097621_100040168
900 Ga0097621_100119409
901 Ga0075370_10103196
902 Ga0068871_100005362
903 Ga0068871_100007800
904 Ga0068871_100014023
905 Ga0068871_100023974
906 Ga0068871_100026146
907 Ga0068871_100054418
908 Ga0075428_100006044
909 Ga0075430_100003052
910 Ga0075430_100038623
911 Ga0075431_100006268
912 Ga0075431_100032020
913 Ga0075429_100022294
914 Ga0075429_100349030
915 Ga0068865_100016453
916 Ga0068865_100293032
917 Ga0097620_100000933
918 Ga0097620_100024706
919 Ga0097620_100163886
920 Ga0097620_100228270
921 Ga0097620_100265783
922 Ga0097620_100320718
923 Ga0097620_100429806
924 Ga0105251_10032084
925 Ga0105240_10000356
926 Ga0105240_10000401
927 Ga0105240_10003287
928 Ga0105240_10006383
929 Ga0105240_10008136
930 Ga0105240_10205108
931 Ga0105240_10220438
932 Ga0105240_10275120
933 Ga0111539_10054765
934 Ga0111539_10310107
935 Ga0111539_10750448
936 Ga0105247_10000408
937 Ga0114129_10158510
938 Ga0105241_10000507
939 Ga0105241_10010017
940 Ga0105241_10052115
941 Ga0105241_10179230
942 Ga0105242_10018955
943 Ga0105242_10036758
944 Ga0105242_10137277
945 Ga0105242_10216912
946 Ga0105242_10235045
947 Ga0105237_10000284
948 Ga0105237_10002285
949 Ga0105237_10003014
950 Ga0105237_10019243
951 Ga0105237_10026467
952 Ga0105237_10151262
953 Ga0105238_10006282
954 Ga0105238_10113189
955 Ga0105249_10004239
956 Ga0105249_10014866
957 Ga0105249_10095012
958 Ga0105249_10173631
959 Ga0105249_10215857
960 Ga0105239_10000129
961 Ga0105239_10002123
962 Ga0105239_10002968
963 Ga0105239_10042844
964 Ga0105239_10070704
965 Ga0105239_10129966
966 Ga0105246_10029461
967 Ga0105246_10277979
968 Ga0157373_10002973
969 Ga0157373_10016986
970 Ga0157373_10018702
971 Ga0157373_10022100
972 Ga0157373_10037297
973 Ga0157373_10101178
974 Ga0157373_10161206
975 Ga0157371_10000518
976 Ga0157371_10000650
977 Ga0157371_10000898
978 Ga0157371_10004152
979 Ga0157371_10008191
980 Ga0157371_10009544
981 Ga0157371_10022979
982 Ga0157371_10040523
983 Ga0157371_10060396
984 Ga0157370_10000313
985 Ga0157370_10142926
986 Ga0157370_10162826
987 Ga0157370_10182673
988 Ga0157370_10473724
989 Ga0157369_10027407
990 Ga0157369_10065806
991 Ga0157369_10069548
992 Ga0157369_10542493
993 Ga0157374_10000027
994 Ga0157374_10001463
995 Ga0157374_10005799
996 Ga0157374_10041025
997 Ga0157374_10061170
998 Ga0157374_10094509
999 Ga0157374_10269875
1000 Ga0157378_10009448
1001 Ga0157378_10044156
1002 Ga0157378_10065461
1003 Ga0163162_10004876
1004 Ga0163162_10008896
1005 Ga0163162_10009462
1006 Ga0163162_10015856
1007 Ga0163162_10029743
1008 Ga0163162_10042818
1009 Ga0163162_10249719
1010 Ga0157372_10001911
1011 Ga0157372_10004775
1012 Ga0157372_10005645
1013 Ga0157372_10007248
1014 Ga0157372_10011038
1015 Ga0157372_10026618
1016 Ga0157372_10043707
1017 Ga0157372_10086269
1018 Ga0157372_10097571
1019 Ga0157372_10100987
1020 Ga0157372_10376416
1021 Ga0157372_10425119
1022 Ga0157372_10566550
1023 Ga0157375_10090861
1024 Ga0157375_10183408
1025 Ga0157375_10196886
1026 Ga0157375_10455481
1027 Ga0163163_10000343
1028 Ga0163163_10066492
1029 Ga0157380_10001360
1030 Ga0157377_10001764
1031 Ga0157377_10032743
1032 Ga0157377_10043884
1033 Ga0157377_10150607
1034 Ga0157379_10009096
1035 Ga0157379_10038921
1036 Ga0157379_10087295
1037 Ga0157376_10001725
1038 Ga0163161_10002608
1039 Ga0163161_10030313
1040 Ga0163161_10075255
1041 Ga0163161_10131147
1042 Ga0213876_10023605
1043 Ga0209436_100675
1044 Ga0209436_101411
1045 Ga0209258_100302
1046 Ga0209646_1000004
1047 Ga0209026_1000095
1048 Ga0209148_1000131
1049 Ga0209673_1000078
1050 Ga0209130_1000611
1051 Ga0209564_1003616
1052 Ga0209564_1004884
1053 Ga0209758_1005348
1054 Ga0209758_1008401
1055 Ga0209758_1010271
1056 Ga0209050_1000097
1057 Ga0207426_1000026
1058 Ga0207426_1000033
1059 Ga0207426_1000313
1060 Ga0207426_1000541
1061 Ga0207426_1004062
1062 Ga0209051_1017678
1063 Ga0209257_1000070
1064 Ga0209257_1004414
1065 Ga0207682_10027539
1066 Ga0207682_10058378
1067 Ga0207642_10006375
1068 Ga0207710_10003686
1069 Ga0207688_10018716
1070 Ga0207680_10000223
1071 Ga0207680_10025902
1072 Ga0207680_10030610
1073 Ga0207680_10039114
1074 Ga0207647_10000360
1075 Ga0207647_10023593
1076 Ga0207647_10043801
1077 Ga0207647_10047652
1078 Ga0207645_10000748
1079 Ga0207645_10002708
1080 Ga0207645_10018693
1081 Ga0207645_10069824
1082 Ga0207643_10003520
1083 Ga0207643_10008799
1084 Ga0207643_10128199
1085 Ga0207705_10014693
1086 Ga0207705_10060093
1087 Ga0207654_10001931
1088 Ga0207707_10051286
1089 Ga0207707_10059131
1090 Ga0207707_10111925
1091 Ga0207695_10000209
1092 Ga0207695_10000300
1093 Ga0207695_10000365
1094 Ga0207695_10000483
1095 Ga0207695_10011556
1096 Ga0207695_10124210
1097 Ga0207671_10000650
1098 Ga0207671_10001292
1099 Ga0207671_10006095
1100 Ga0207671_10020019
1101 Ga0207671_10100364
1102 Ga0207671_10246416
1103 Ga0207662_10057317
1104 Ga0207657_10063618
1105 Ga0207657_10075396
1106 Ga0207657_10077598
1107 Ga0207657_10114199
1108 Ga0207657_10244742
1109 Ga0207652_10000090
1110 Ga0207652_10000154
1111 Ga0207681_10020629
1112 Ga0207681_10024008
1113 Ga0207694_10072544
1114 Ga0207694_10227684
1115 Ga0207650_10000813
1116 Ga0207650_10095373
1117 Ga0207650_10169240
1118 Ga0207650_10183377
1119 Ga0207659_10059684
1120 Ga0207659_10108990
1121 Ga0207644_10067295
1122 Ga0207644_10168194
1123 Ga0207644_10298844
1124 Ga0207690_10171820
1125 Ga0207706_10003423
1126 Ga0207706_10004381
1127 Ga0207706_10023769
1128 Ga0207706_10047636
1129 Ga0207706_10067978
1130 Ga0207686_10008363
1131 Ga0207686_10100932
1132 Ga0207709_10102964
1133 Ga0207670_10025416
1134 Ga0207670_10062443
1135 Ga0207670_10125089
1136 Ga0207704_10139369
1137 Ga0207691_10000057
1138 Ga0207691_10106459
1139 Ga0207691_10172708
1140 Ga0207689_10000628
1141 Ga0207689_10001062
1142 Ga0207689_10001418
1143 Ga0207689_10026149
1144 Ga0207689_10068850
1145 Ga0207689_10114339
1146 Ga0207689_10134827
1147 Ga0207661_10065670
1148 Ga0207661_10247500
1149 Ga0207679_10028829
1150 Ga0207679_10042210
1151 Ga0207679_10339641
1152 Ga0207667_10000902
1153 Ga0207667_10002948
1154 Ga0207667_10018691
1155 Ga0207667_10029002
1156 Ga0207667_10138204
1157 Ga0207667_10194964
1158 Ga0207667_10195669
1159 Ga0207651_10000330
1160 Ga0207712_10001226
1161 Ga0207712_10011611
1162 Ga0207712_10088962
1163 Ga0207712_10113822
1164 Ga0207712_10160056
1165 Ga0207712_10193392
1166 Ga0207668_10000170
1167 Ga0207668_10057529
1168 Ga0207668_10121629
1169 Ga0207640_10040381
1170 Ga0207640_10102980
1171 Ga0207658_10080355
1172 Ga0207658_10328230
1173 Ga0207677_10001046
1174 Ga0207677_10011966
1175 Ga0207677_10016754
1176 Ga0207677_10037340
1177 Ga0207677_10207244
1178 Ga0207703_10087622
1179 Ga0207703_10248689
1180 Ga0207639_10010315
1181 Ga0207639_10021680
1182 Ga0207639_10230488
1183 Ga0207639_10501510
1184 Ga0207678_10017885
1185 Ga0207702_10242182
1186 Ga0207641_10009509
1187 Ga0207641_10011229
1188 Ga0207641_10130714
1189 Ga0207641_10219428
1190 Ga0207641_10373373
1191 Ga0207648_10000372
1192 Ga0207648_10010287
1193 Ga0207648_10015759
1194 Ga0207648_10025791
1195 Ga0207676_10000768
1196 Ga0207676_10009647
1197 Ga0207676_10024603
1198 Ga0207676_10046670
1199 Ga0207676_10097524
1200 Ga0207674_10003427
1201 Ga0207674_10012617
1202 Ga0207674_10021791
1203 Ga0207674_10114723
1204 Ga0207674_10170252
1205 Ga0207675_100005048
1206 Ga0207675_100019278
1207 Ga0207675_100034513
1208 Ga0207675_100034829
1209 Ga0207675_100038027
1210 Ga0207683_10001617
1211 Ga0207683_10020692
1212 Ga0207683_10172327
1213 Ga0207683_10328448
1214 Ga0207698_10005431
1215 Ga0207698_10013439
1216 Ga0207698_10015963
1217 Ga0207698_10069679
1218 Ga0207698_10247154
1219 Ga0207428_10053619
1220 Ga0268266_10000104
1221 Ga0268266_10014894
1222 Ga0268266_10076916
1223 Ga0268266_10477167
1224 Ga0268265_10011344
1225 Ga0268265_10082175
1226 Ga0268265_10154119
1227 Ga0268264_10000028
1228 Ga0268264_10003990
1229 Ga0268264_10007340
1230 Ga0268264_10033960
1231 Ga0268264_10059527
1232 Ga0268264_10277144
1233 Ga0307517_10001269
1234 Ga0307517_10116554
1235 Ga0307515_10000001
1236 Ga0307511_10000002
1237 Ga0265327_10000024
1238 Ga0265327_10000199
1239 Ga0265327_10027088
1240 Ga0307513_10159302
1241 Ga0307513_10269466
1242 Ga0307516_10003475
1243 Ga0307516_10123536
1244 Ga0307406_10084274
1245 Ga0307510_10000141
1246 Ga0373935_0187274
1247 Ga0373937_0302809
1248 Ga0395899_0004373
1249 Ga0395899_0005666
1250 Ga0395899_0012016
1251 Ga0395899_0013648
1252 Ga0395899_0054945
1253 Ga0395899_0100865
1254 Ga0395900_0000927
1255 Ga0395900_0022173
1256 Ga0395900_0023636
1257 Ga0395900_0040131
1258 Ga0395900_0096788
1259 Ga0395900_0120624
1260 Ga0395898_0004030
1261 Ga0395898_0041634
1262 Ga0395898_0074862
1263 Ga0395898_0126198
1264 Ga0395905_0001629
1265 Ga0395905_0051538
1266 Ga0395905_0311499
1267 Ga0395901_0001347
1268 Ga0395901_0020835
1269 Ga0395901_0200019
1270 Ga0395901_0387943
1271 Ga0436365_1144486
1272 Ga0439442_002360
1273 Ga0439449_0005922
1274 Ga0439449_0041880
1275 Ga0439449_0066127
1276 Ga0466969_0001216
1277 Ga0466969_0040508
1278 Ga0466972_0000069
1279 Ga0466965_0009580
1280 Ga0466966_0000184
1281 Ga0466966_0111671
1282 Ga0466961_0098970
1283 Ga0466968_0029714
1284 Ga0466970_0002827
1285 Ga0466970_0016279
1286 Ga0466957_0001692
1287 Ga0466959_0000097
1288 Ga0466959_0000330
1289 Ga0466959_0011869
1290 Ga0466967_0018192
1291 Ga0495638_0037642
1292 Ga0495606_0004246
1293 Ga0495643_0058511
1294 Ga0495621_0069260
1295 Ga0495668_0000339
1296 Ga0495668_0001044
1297 Ga0495611_0000030
1298 Ga0495687_000726
1299 Ga0496100_0035934
1300 Ga0496101_0259047
1301 Ga0496104_0142954
1302 Ga0496121_0000081
1303 Ga0501031_0050483
1304 Ga0501032_0007417
1305 Ga0501034_0000004
1306 Ga0501034_0005631
1307 Ga0501034_0033462
1308 Ga0501034_0039450
1309 Ga0501034_0207852
1310 Ga0501034_0257647
1311 Ga0501034_0519449
1312 Ga0501036_0185942
1313 Ga0501037_0005310
1314 Ga0501038_0034705
1315 Ga0501038_0171550
1316 Ga0501039_0014887
1317 Ga0501039_0025156
1318 Ga0501039_0031852
1319 Ga0501043_0004690
1320 Ga0501043_0011471
1321 Ga0501043_0035278
1322 Ga0501043_0036442
1323 Ga0501046_0008975
1324 Ga0501046_0053501
1325 Ga0501047_0005232
1326 Ga0501047_0081192
1327 Ga0501047_0094448
1328 Ga0501048_0001472
1329 Ga0501070_0010616
1330 Ga0501070_0309460
1331 Ga0501071_0287338
1332 Ga0501072_0047281
1333 Ga0501073_0302466
1334 Ga0501074_0004892
1335 Ga0501074_0038714
1336 Ga0501217_015630
1337 Ga0501217_025909
1338 Ga0501257_003588
1339 Ga0501257_013964
1340 Ga0501259_001424
1341 Ga0501219_000564
1342 Ga0501079_0138704
1343 Ga0501080_0198946
1344 Ga0501080_0221785
1345 Ga0501280_009089
1346 Ga0501035_0007031
1347 Ga0501035_0012647
1348 Ga0501035_0212949
1349 Ga0501035_0363932
1350 Ga0501044_0010112
1351 Ga0501044_0012014
1352 Ga0501044_0016865
1353 Ga0501044_0097232
1354 Ga0501044_0106037
1355 Ga0501044_0278403
1356 Ga0501284_00002
1357 nmdc:mga0k408_158794_c1
1358 nmdc:mga0k408_83189_c1
1359 nmdc:mga05p37_128627_c1
1360 nmdc:mga09592_2275_c1
1361 nmdc:mga0qj67_20468_c1
1362 nmdc:mga0qj67_57913_c1
1363 nmdc:mga06r32_49237_c1
1364 nmdc:mga08y16_42040_c1
1365 nmdc:mga08y16_42139_c1
1366 nmdc:mga08y16_657107_c1
1367 Ga0500644_0000026
1368 Ga0500646_0016206
1369 Ga0500651_0042928
1370 Ga0500562_000012
1371 Ga0500569_001103
1372 Ga0500607_040229
1373 Ga0500568_0000532
1374 Ga0500577_0006372
1375 Ga0500604_0008698
1376 Ga0500616_0003687
1377 Ga0500622_0000404
1378 Ga0500622_0000692
1379 Ga0500633_0000727
1380 Ga0500634_0038663
1381 Ga0500636_0078750
1382 Ga0500637_0040578
1383 Ga0500645_003066
1384 Ga0500661_001980
1385 Ga0500661_004886
1386 Ga0501082_0346033
1387 2738725234
1388 2819574903
1389 2819586178
1390 2819676847
1391 2821141003
1392 2883070514
1393 2884796703
1394 2896113077
1395 2904471503
1396 2929158907
1397 2929177781
1398 2929240144
1399 2929921837
1400 2945980128
1401 2946014010
1402 8003154094

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13186

SPASM

Iron-sulfur cluster-binding domain

251

317

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yx0-assembly1.cif.gz_A crystal structure of p. horikoshii tyw1 0.7808 126 259
7tol-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound 0.7723 83 271
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.7667 99 271
5exi-assembly1.cif.gz_A crystal structure of m. tuberculosis lipoyl synthase at 2.28 a resolution 0.7584 84 268
4m7s-assembly1.cif.gz_A crystal structure of semet btrn in an open conformation 0.7442 80 380
ID Description Score Start End Superfamily
af_Q58214_34_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7954 80 271 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.79 85 268 3.20.20.70
2yx0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7808 126 259 3.20.20.70
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7656 83 356 3.20.20.70
af_Q57567_110_367_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7636 85 271 3.20.20.70
ID Description Score Start End GO Terms
AF-X1HWT2-F1-model_v4 Radical SAM core domain-containing protein 0.9643 116 210 GO:0003824
GO:0046872
GO:0051536
AF-M7XWR7-F1-model_v4 Putative Fe-S oxidoreductase, SAM radical superfamily 0.9509 57 373 GO:0003824
GO:0046872
GO:0051536
AF-A0A661Z8Z5-F1-model_v4 Radical SAM protein 0.9465 46 347 GO:0003824
GO:0046872
GO:0051536
AF-M7XWR7-F1-model_v4 Putative Fe-S oxidoreductase, SAM radical superfamily 0.9451 57 373 GO:0003824
GO:0046872
GO:0051536
AF-A0A382VJD0-F1-model_v4 Radical SAM core domain-containing protein 0.9443 109 293 GO:0003824
GO:0046872
GO:0051536

Map