F476183

General Info

Members Datasets Scaffolds Average Seq Length
701 325 701 105

Family's Representative Sequence

Representative Sequence 3300049541|Ga0501325_046257|Ga0501325_046257_194_526
Length 110
Sequence MRTNQMTYAIIRTGGMQFRAEPGKTLRVPTIEGDVGASITFDEVLLGSDGTNVQTGTPLVSGAKVSGEIVRHGKGDKIIVFKFKRRKNYARKQGHRQPFTEVKINDITLG

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
95 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
221 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
222 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
223 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
267 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
290 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
293 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
294 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
295 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
296 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
297 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
298 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
305 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
306 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
307 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 7.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.71
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11979178 3300004800 Bacteria 815
2 Ga0058860_12185004 3300004801 Bacteria 587
3 Ga0058862_12385096 3300004803 Bacteria 701
4 Ga0065714_10290611 3300005288 Bacteria 709
5 Ga0065712_10509946 3300005290 Bacteria 643
6 Ga0065715_10742786 3300005293 Bacteria 634
7 Ga0065707_10105958 3300005295 Bacteria 2621
8 Ga0065707_10187658 3300005295 Bacteria 1379
9 Ga0065707_10502070 3300005295 Bacteria 756
10 Ga0070658_10185468 3300005327 Bacteria 1752
11 Ga0070658_11061393 3300005327 Bacteria 705
12 Ga0070676_10000666 3300005328 Bacteria 16721
13 Ga0070676_10441942 3300005328 Bacteria 913
14 Ga0070683_100100136 3300005329 Bacteria 2728
15 Ga0070683_100324044 3300005329 Bacteria 1466
16 Ga0070683_100673603 3300005329 Bacteria 990
17 Ga0070683_101514691 3300005329 Bacteria 645
18 Ga0070670_100004241 3300005331 Bacteria 11994
19 Ga0070670_100034433 3300005331 Bacteria 4358
20 Ga0068869_100003748 3300005334 Bacteria 9353
21 Ga0068869_100274889 3300005334 Bacteria 1353
22 Ga0070666_10844697 3300005335 Bacteria 675
23 Ga0070680_100116536 3300005336 Bacteria 2227
24 Ga0070680_100504342 3300005336 Bacteria 1035
25 Ga0070680_100670910 3300005336 Bacteria 891
26 Ga0070680_101675901 3300005336 Bacteria 551
27 Ga0070682_100377140 3300005337 Bacteria 1065
28 Ga0070682_101683680 3300005337 Bacteria 550
29 Ga0068868_100009898 3300005338 Bacteria 6884
30 Ga0070660_100247680 3300005339 Bacteria 1452
31 Ga0070660_100837262 3300005339 Bacteria 775
32 Ga0070689_100775909 3300005340 Bacteria 841
33 Ga0070687_100637913 3300005343 Bacteria 737
34 Ga0070661_100007955 3300005344 Bacteria 7323
35 Ga0070661_100024757 3300005344 Bacteria 4307
36 Ga0070661_100220389 3300005344 Bacteria 1455
37 Ga0070661_101437120 3300005344 Bacteria 581
38 Ga0070692_10031795 3300005345 Bacteria 2648
39 Ga0070692_10862983 3300005345 Bacteria 623
40 Ga0070668_100000088 3300005347 Bacteria 57110
41 Ga0070668_100041916 3300005347 Bacteria 3508
42 Ga0070669_100009001 3300005353 Bacteria 7123
43 Ga0070669_100047960 3300005353 Bacteria 3117
44 Ga0070675_100000328 3300005354 Bacteria 32107
45 Ga0070675_100002241 3300005354 Bacteria 14347
46 Ga0070675_100027429 3300005354 Bacteria 4575
47 Ga0070675_100519902 3300005354 Bacteria 1074
48 Ga0070671_100293752 3300005355 Bacteria 1383
49 Ga0070671_101348664 3300005355 Bacteria 629
50 Ga0070674_100018717 3300005356 Bacteria 4386
51 Ga0070674_100273136 3300005356 Bacteria 1337
52 Ga0070674_100335802 3300005356 Bacteria 1216
53 Ga0070673_100060549 3300005364 Bacteria 3000
54 Ga0070673_100535481 3300005364 Bacteria 1062
55 Ga0070688_100560433 3300005365 Bacteria 870
56 Ga0070659_100036048 3300005366 Bacteria 3854
57 Ga0070659_100597009 3300005366 Bacteria 948
58 Ga0070659_100841104 3300005366 Bacteria 800
59 Ga0070667_100369803 3300005367 Bacteria 1300
60 Ga0070714_100015926 3300005435 Bacteria 6062
61 Ga0070713_101857413 3300005436 Bacteria 585
62 Ga0070701_10041132 3300005438 Bacteria 2354
63 Ga0070711_100327879 3300005439 Bacteria 1225
64 Ga0070711_101776120 3300005439 Bacteria 541
65 Ga0070700_100132825 3300005441 Bacteria 1682
66 Ga0070700_100310967 3300005441 Bacteria 1154
67 Ga0070700_100372416 3300005441 Bacteria 1065
68 Ga0070694_100287012 3300005444 Bacteria 1256
69 Ga0070694_100552695 3300005444 Bacteria 922
70 Ga0070663_100396185 3300005455 Bacteria 1128
71 Ga0070663_100723148 3300005455 Bacteria 848
72 Ga0070678_100918497 3300005456 Bacteria 801
73 Ga0070681_10002847 3300005458 Bacteria 15988
74 Ga0070681_10007035 3300005458 Bacteria 10954
75 Ga0070681_11083830 3300005458 Bacteria 722
76 Ga0068867_100044387 3300005459 Bacteria 3256
77 Ga0068867_100122521 3300005459 Bacteria 2011
78 Ga0068867_100697422 3300005459 Bacteria 895
79 Ga0068867_100852247 3300005459 Bacteria 816
80 Ga0070685_10751585 3300005466 Bacteria 715
81 Ga0070698_100125314 3300005471 Bacteria 2526
82 Ga0070698_101020200 3300005471 Bacteria 775
83 Ga0070699_100069961 3300005518 Bacteria 3050
84 Ga0070699_100783128 3300005518 Bacteria 873
85 Ga0070679_100004546 3300005530 Bacteria 12806
86 Ga0070679_100078270 3300005530 Bacteria 3295
87 Ga0070679_100222680 3300005530 Bacteria 1847
88 Ga0070679_100241220 3300005530 Bacteria 1765
89 Ga0070684_100727938 3300005535 Bacteria 925
90 Ga0070684_101138049 3300005535 Bacteria 734
91 Ga0070684_101266194 3300005535 Bacteria 694
92 Ga0070672_100017873 3300005543 Bacteria 5112
93 Ga0070672_100281799 3300005543 Bacteria 1405
94 Ga0070686_101091735 3300005544 Bacteria 659
95 Ga0070695_100124752 3300005545 Bacteria 1767
96 Ga0070696_101624484 3300005546 Bacteria 556
97 Ga0070693_100751795 3300005547 Bacteria 718
98 Ga0070665_100147926 3300005548 Bacteria 2351
99 Ga0070665_102486293 3300005548 Bacteria 519
100 Ga0068855_100177571 3300005563 Bacteria 2409
101 Ga0068855_100194092 3300005563 Bacteria 2288
102 Ga0068855_100258116 3300005563 Bacteria 1942
103 Ga0070664_100161510 3300005564 Bacteria 1983
104 Ga0070664_100245315 3300005564 Bacteria 1609
105 Ga0070664_100388531 3300005564 Bacteria 1275
106 Ga0068857_100012292 3300005577 Bacteria 7448
107 Ga0068857_100088541 3300005577 Bacteria 2770
108 Ga0068857_100994719 3300005577 Bacteria 807
109 Ga0068857_101491151 3300005577 Bacteria 659
110 Ga0068854_100236815 3300005578 Bacteria 1452
111 Ga0068854_100444324 3300005578 Bacteria 1082
112 Ga0068856_100391783 3300005614 Bacteria 1409
113 Ga0070702_100343351 3300005615 Bacteria 1049
114 Ga0068852_100030369 3300005616 Bacteria 4447
115 Ga0068852_101086993 3300005616 Bacteria 820
116 Ga0068859_102739279 3300005617 Unclassified 542
117 Ga0068864_100004940 3300005618 Bacteria 10925
118 Ga0068864_100046580 3300005618 Bacteria 3721
119 Ga0068864_102004914 3300005618 Bacteria 585
120 Ga0068866_10022515 3300005718 Bacteria 2917
121 Ga0068866_10686445 3300005718 Bacteria 701
122 Ga0068861_100011511 3300005719 Bacteria 6154
123 Ga0068861_100044307 3300005719 Bacteria 3345
124 Ga0068861_100447043 3300005719 Bacteria 1157
125 Ga0068851_10188458 3300005834 Bacteria 1146
126 Ga0068851_10444059 3300005834 Bacteria 770
127 Ga0068870_10020296 3300005840 Bacteria 3233
128 Ga0068870_10827334 3300005840 Bacteria 649
129 Ga0068863_100283541 3300005841 Bacteria 1605
130 Ga0068863_100466958 3300005841 Bacteria 1240
131 Ga0068858_100019838 3300005842 Bacteria 6286
132 Ga0068860_100051139 3300005843 Bacteria 3932
133 Ga0068862_100000439 3300005844 Bacteria 45176
134 Ga0068862_100099960 3300005844 Bacteria 2536
135 Ga0070715_10285590 3300006163 Bacteria 877
136 Ga0097621_100203309 3300006237 Bacteria 1720
137 Ga0068871_100046217 3300006358 Bacteria 3506
138 Ga0075428_100036025 3300006844 Bacteria 5452
139 Ga0075428_100416937 3300006844 Bacteria 1439
140 Ga0075428_100912410 3300006844 Bacteria 932
141 Ga0075428_101513693 3300006844 Bacteria 703
142 Ga0075428_101568469 3300006844 Bacteria 689
143 Ga0075430_100002964 3300006846 Bacteria 14214
144 Ga0075430_100030331 3300006846 Bacteria 4591
145 Ga0075430_100047699 3300006846 Bacteria 3617
146 Ga0075430_100171261 3300006846 Unclassified 1806
147 Ga0075430_100179147 3300006846 Bacteria 1763
148 Ga0075430_100350685 3300006846 Bacteria 1219
149 Ga0075430_100444132 3300006846 Bacteria 1070
150 Ga0075430_100789544 3300006846 Bacteria 782
151 Ga0075431_100006993 3300006847 Bacteria 11219
152 Ga0075431_100037078 3300006847 Bacteria 5023
153 Ga0075431_100051551 3300006847 Bacteria 4243
154 Ga0075431_100094367 3300006847 Bacteria 3088
155 Ga0075431_100098764 3300006847 Bacteria 3014
156 Ga0075431_100099565 3300006847 Bacteria 2999
157 Ga0075431_100306706 3300006847 Bacteria 1603
158 Ga0075431_100333627 3300006847 Bacteria 1527
159 Ga0075431_100389265 3300006847 Bacteria 1397
160 Ga0075433_10172312 3300006852 Bacteria 1926
161 Ga0075433_11581711 3300006852 Bacteria 566
162 Ga0075434_100008029 3300006871 Bacteria 9783
163 Ga0075434_100118312 3300006871 Bacteria 2663
164 Ga0075434_102138665 3300006871 Bacteria 564
165 Ga0075429_100020126 3300006880 Bacteria 5787
166 Ga0075429_100082655 3300006880 Bacteria 2799
167 Ga0075429_100134757 3300006880 Bacteria 2161
168 Ga0075429_100372749 3300006880 Bacteria 1250
169 Ga0075429_100584425 3300006880 Bacteria 979
170 Ga0075429_100971503 3300006880 Bacteria 743
171 Ga0075429_101657338 3300006880 Bacteria 556
172 Ga0068865_100041912 3300006881 Bacteria 3118
173 Ga0068865_101233206 3300006881 Bacteria 663
174 Ga0075436_100119156 3300006914 Bacteria 1846
175 Ga0105251_10494005 3300009011 Bacteria 571
176 Ga0105240_10008731 3300009093 Bacteria 14447
177 Ga0105240_10615211 3300009093 Unclassified 1194
178 Ga0105240_10630839 3300009093 Bacteria 1177
179 Ga0105240_11353442 3300009093 Unclassified 749
180 Ga0111539_10004741 3300009094 Bacteria 17756
181 Ga0111539_10154945 3300009094 Bacteria 2681
182 Ga0111539_10252059 3300009094 Bacteria 2055
183 Ga0111539_10443618 3300009094 Bacteria 1511
184 Ga0111539_12819393 3300009094 Bacteria 563
185 Ga0111539_13071017 3300009094 Bacteria 539
186 Ga0105245_10247062 3300009098 Bacteria 1732
187 Ga0105245_12087009 3300009098 Bacteria 620
188 Ga0114129_10006882 3300009147 Bacteria 16169
189 Ga0114129_10578255 3300009147 Bacteria 1458
190 Ga0114129_10681504 3300009147 Bacteria 1323
191 Ga0114129_10705780 3300009147 Bacteria 1296
192 Ga0114129_10769922 3300009147 Bacteria 1230
193 Ga0105243_10417915 3300009148 Bacteria 1250
194 Ga0105241_11657672 3300009174 Bacteria 620
195 Ga0105242_10234283 3300009176 Bacteria 1647
196 Ga0105242_11494123 3300009176 Bacteria 706
197 Ga0105248_10053267 3300009177 Bacteria 4540
198 Ga0105248_10106115 3300009177 Bacteria 3167
199 Ga0105237_10625398 3300009545 Bacteria 1084
200 Ga0105238_11252027 3300009551 Bacteria 767
201 Ga0105249_10000083 3300009553 Bacteria 135844
202 Ga0105249_10006364 3300009553 Bacteria 10270
203 Ga0105239_11149910 3300010375 Bacteria 894
204 Ga0105239_12596143 3300010375 Bacteria 591
205 Ga0105246_12576138 3300011119 Bacteria 502
206 Ga0157337_1015725 3300012483 Bacteria 648
207 Ga0157323_1007640 3300012495 Bacteria 785
208 Ga0157314_1045705 3300012500 Bacteria 544
209 Ga0157373_10120462 3300013100 Bacteria 1844
210 Ga0157373_10130484 3300013100 Bacteria 1767
211 Ga0157373_10266933 3300013100 Bacteria 1211
212 Ga0157373_11416421 3300013100 Bacteria 529
213 Ga0157371_10008381 3300013102 Bacteria 8242
214 Ga0157370_10007729 3300013104 Bacteria 11656
215 Ga0157370_10062261 3300013104 Bacteria 3539
216 Ga0157370_10606067 3300013104 Bacteria 1002
217 Ga0157369_10070156 3300013105 Bacteria 3765
218 Ga0157369_10697951 3300013105 Bacteria 1045
219 Ga0157369_11334046 3300013105 Unclassified 731
220 Ga0157369_11385673 3300013105 Bacteria 716
221 Ga0157374_10699950 3300013296 Bacteria 1026
222 Ga0157374_11047859 3300013296 Bacteria 835
223 Ga0157378_10531260 3300013297 Bacteria 1179
224 Ga0163162_10045978 3300013306 Bacteria 4375
225 Ga0157372_10029595 3300013307 Bacteria 5982
226 Ga0157372_11466587 3300013307 Bacteria 786
227 Ga0157372_11721060 3300013307 Unclassified 721
228 Ga0157372_11735926 3300013307 Unclassified 718
229 Ga0157372_12131002 3300013307 Bacteria 644
230 Ga0157375_10042107 3300013308 Bacteria 4417
231 Ga0157375_10104987 3300013308 Bacteria 2915
232 Ga0157375_10552745 3300013308 Bacteria 1313
233 Ga0163163_10114086 3300014325 Bacteria 2732
234 Ga0157380_10008461 3300014326 Bacteria 7349
235 Ga0157380_10156116 3300014326 Bacteria 1978
236 Ga0157380_11039160 3300014326 Bacteria 855
237 Ga0157380_11625068 3300014326 Bacteria 702
238 Ga0157377_10030937 3300014745 Bacteria 2905
239 Ga0157377_10409003 3300014745 Bacteria 926
240 Ga0157377_10482971 3300014745 Bacteria 862
241 Ga0157379_10019627 3300014968 Bacteria 5971
242 Ga0157376_11163100 3300014969 Bacteria 799
243 Ga0182007_10171056 3300015262 Bacteria 747
244 Ga0182007_10204021 3300015262 Bacteria 692
245 Ga0182005_1016162 3300015265 Bacteria 2077
246 Ga0163161_10132325 3300017792 Bacteria 1883
247 Ga0197907_10774304 3300020069 Unclassified 759
248 Ga0206356_10536816 3300020070 Bacteria 800
249 Ga0206352_10030481 3300020078 Bacteria 642
250 Ga0206352_11245330 3300020078 Bacteria 636
251 Ga0206350_10734957 3300020080 Bacteria 886
252 Ga0206354_10034601 3300020081 Bacteria 771
253 Ga0206354_10488864 3300020081 Bacteria 551
254 Ga0206353_10399243 3300020082 Bacteria 893
255 Ga0213876_10016407 3300021384 Bacteria 3915
256 Ga0213875_10370117 3300021388 Bacteria 682
257 Ga0224712_10669014 3300022467 Bacteria 510
258 Ga0207666_1013693 3300025271 Bacteria 1141
259 Ga0207697_10009810 3300025315 Bacteria 4117
260 Ga0207697_10171690 3300025315 Bacteria 948
261 Ga0207656_10085403 3300025321 Bacteria 1425
262 Ga0207656_10307138 3300025321 Bacteria 786
263 Ga0207682_10253876 3300025893 Bacteria 819
264 Ga0207642_10368154 3300025899 Bacteria 852
265 Ga0207688_10033228 3300025901 Bacteria 2853
266 Ga0207688_10581282 3300025901 Bacteria 705
267 Ga0207647_10081279 3300025904 Bacteria 1942
268 Ga0207645_10000813 3300025907 Bacteria 26129
269 Ga0207645_10107170 3300025907 Bacteria 1807
270 Ga0207643_10014953 3300025908 Bacteria 4223
271 Ga0207643_10765288 3300025908 Bacteria 625
272 Ga0207705_10047586 3300025909 Bacteria 3084
273 Ga0207705_10592480 3300025909 Bacteria 862
274 Ga0207654_10561254 3300025911 Bacteria 812
275 Ga0207707_10025067 3300025912 Bacteria 5217
276 Ga0207707_10077339 3300025912 Bacteria 2905
277 Ga0207707_10418479 3300025912 Bacteria 1149
278 Ga0207695_10048163 3300025913 Bacteria 4503
279 Ga0207695_10143001 3300025913 Bacteria 2339
280 Ga0207695_10223272 3300025913 Bacteria 1791
281 Ga0207695_10603483 3300025913 Bacteria 979
282 Ga0207695_10978990 3300025913 Bacteria 726
283 Ga0207671_10632156 3300025914 Bacteria 853
284 Ga0207663_10889315 3300025916 Bacteria 712
285 Ga0207660_10366131 3300025917 Bacteria 1157
286 Ga0207660_10605864 3300025917 Bacteria 892
287 Ga0207660_11300898 3300025917 Bacteria 590
288 Ga0207662_10010413 3300025918 Bacteria 5135
289 Ga0207657_10025256 3300025919 Bacteria 5482
290 Ga0207657_10564447 3300025919 Bacteria 889
291 Ga0207649_10006820 3300025920 Bacteria 6205
292 Ga0207649_10643537 3300025920 Bacteria 819
293 Ga0207649_10757528 3300025920 Bacteria 756
294 Ga0207652_10006003 3300025921 Bacteria 9828
295 Ga0207652_10123696 3300025921 Bacteria 2303
296 Ga0207652_10139989 3300025921 Bacteria 2163
297 Ga0207681_10008207 3300025923 Bacteria 6388
298 Ga0207681_10171369 3300025923 Bacteria 1645
299 Ga0207650_10009391 3300025925 Bacteria 6684
300 Ga0207650_10121511 3300025925 Bacteria 2034
301 Ga0207659_10017789 3300025926 Bacteria 4649
302 Ga0207659_10062230 3300025926 Bacteria 2693
303 Ga0207659_10345034 3300025926 Bacteria 1234
304 Ga0207687_11677649 3300025927 Bacteria 545
305 Ga0207700_10140605 3300025928 Bacteria 1983
306 Ga0207664_10744436 3300025929 Bacteria 881
307 Ga0207644_10176798 3300025931 Bacteria 1670
308 Ga0207644_10655688 3300025931 Bacteria 874
309 Ga0207690_10142139 3300025932 Bacteria 1770
310 Ga0207690_10294363 3300025932 Bacteria 1268
311 Ga0207690_10438095 3300025932 Bacteria 1048
312 Ga0207706_10000055 3300025933 Bacteria 114144
313 Ga0207686_10259107 3300025934 Bacteria 1274
314 Ga0207709_11551942 3300025935 Bacteria 550
315 Ga0207669_11502260 3300025937 Bacteria 574
316 Ga0207704_10065856 3300025938 Bacteria 2271
317 Ga0207691_10000129 3300025940 Bacteria 69176
318 Ga0207691_10000708 3300025940 Bacteria 33044
319 Ga0207691_10286580 3300025940 Bacteria 1417
320 Ga0207711_10164840 3300025941 Bacteria 2008
321 Ga0207689_10000623 3300025942 Bacteria 33879
322 Ga0207661_10070781 3300025944 Bacteria 2848
323 Ga0207661_10085002 3300025944 Bacteria 2622
324 Ga0207661_12046887 3300025944 Bacteria 518
325 Ga0207679_10005300 3300025945 Bacteria 8090
326 Ga0207679_10067306 3300025945 Bacteria 2687
327 Ga0207679_10091968 3300025945 Bacteria 2349
328 Ga0207679_10171210 3300025945 Bacteria 1788
329 Ga0207679_10262278 3300025945 Bacteria 1474
330 Ga0207667_10136146 3300025949 Bacteria 2529
331 Ga0207667_10645141 3300025949 Bacteria 1065
332 Ga0207667_10768010 3300025949 Bacteria 962
333 Ga0207667_11044152 3300025949 Unclassified 803
334 Ga0207651_10606391 3300025960 Bacteria 957
335 Ga0207712_10004764 3300025961 Bacteria 8567
336 Ga0207712_10010311 3300025961 Bacteria 5932
337 Ga0207668_10006867 3300025972 Bacteria 6752
338 Ga0207668_10031111 3300025972 Bacteria 3512
339 Ga0207640_10179150 3300025981 Bacteria 1587
340 Ga0207640_11142032 3300025981 Bacteria 691
341 Ga0207658_10036343 3300025986 Bacteria 3531
342 Ga0207677_10009665 3300026023 Bacteria 5431
343 Ga0207703_10186178 3300026035 Bacteria 1835
344 Ga0207639_10308648 3300026041 Unclassified 1401
345 Ga0207639_11287389 3300026041 Bacteria 686
346 Ga0207678_10469863 3300026067 Bacteria 1095
347 Ga0207708_10006119 3300026075 Bacteria 8923
348 Ga0207708_10040492 3300026075 Bacteria 3552
349 Ga0207708_10136664 3300026075 Bacteria 1920
350 Ga0207702_10373275 3300026078 Bacteria 1370
351 Ga0207641_10373898 3300026088 Bacteria 1363
352 Ga0207641_11677590 3300026088 Bacteria 637
353 Ga0207648_10068620 3300026089 Bacteria 3089
354 Ga0207648_10289950 3300026089 Bacteria 1465
355 Ga0207676_10050921 3300026095 Bacteria 3231
356 Ga0207676_10222073 3300026095 Bacteria 1683
357 Ga0207676_11660565 3300026095 Bacteria 637
358 Ga0207674_10001035 3300026116 Bacteria 36267
359 Ga0207674_10118805 3300026116 Bacteria 2613
360 Ga0207674_10539156 3300026116 Bacteria 1127
361 Ga0207674_11076565 3300026116 Bacteria 773
362 Ga0207675_100000096 3300026118 Bacteria 69990
363 Ga0207675_100026113 3300026118 Bacteria 5436
364 Ga0207675_100490929 3300026118 Bacteria 1221
365 Ga0207683_10386683 3300026121 Bacteria 1286
366 Ga0207698_10774152 3300026142 Bacteria 960
367 Ga0207698_11277730 3300026142 Bacteria 748
368 Ga0209995_1057867 3300027471 Bacteria 659
369 Ga0209999_1089319 3300027543 Bacteria 597
370 Ga0207428_10067090 3300027907 Bacteria 2825
371 Ga0207428_10285211 3300027907 Bacteria 1225
372 Ga0268266_10201093 3300028379 Bacteria 1823
373 Ga0268266_11774115 3300028379 Bacteria 592
374 Ga0268265_10005621 3300028380 Bacteria 8562
375 Ga0268265_10033945 3300028380 Bacteria 3714
376 Ga0268264_10039846 3300028381 Bacteria 3881
377 Ga0265332_10051168 3300031238 Bacteria 1774
378 Ga0265332_10069970 3300031238 Bacteria 1495
379 Ga0265328_10298553 3300031239 Bacteria 622
380 Ga0265327_10216607 3300031251 Bacteria 862
381 Ga0307408_100008719 3300031548 Bacteria 6698
382 Ga0307408_100577648 3300031548 Bacteria 995
383 Ga0307408_100603677 3300031548 Bacteria 975
384 Ga0307408_100800662 3300031548 Bacteria 855
385 Ga0307408_101027248 3300031548 Bacteria 761
386 Ga0307408_102076855 3300031548 Bacteria 547
387 Ga0307408_102241963 3300031548 Bacteria 528
388 Ga0265314_10018388 3300031711 Bacteria 5449
389 Ga0307405_10003488 3300031731 Bacteria 7233
390 Ga0307405_10015147 3300031731 Bacteria 4167
391 Ga0307405_10021094 3300031731 Bacteria 3657
392 Ga0307405_10191339 3300031731 Bacteria 1478
393 Ga0307405_10204548 3300031731 Bacteria 1436
394 Ga0307405_10298957 3300031731 Bacteria 1220
395 Ga0307405_10398100 3300031731 Bacteria 1077
396 Ga0307405_10510021 3300031731 Bacteria 966
397 Ga0307405_10524649 3300031731 Bacteria 954
398 Ga0307405_10710270 3300031731 Bacteria 833
399 Ga0307405_10881685 3300031731 Bacteria 755
400 Ga0307405_10892810 3300031731 Bacteria 751
401 Ga0307405_11880934 3300031731 Bacteria 533
402 Ga0307413_10004067 3300031824 Bacteria 6295
403 Ga0307413_10005147 3300031824 Bacteria 5795
404 Ga0307413_10009962 3300031824 Bacteria 4580
405 Ga0307413_10185529 3300031824 Bacteria 1488
406 Ga0307413_10237077 3300031824 Unclassified 1344
407 Ga0307413_10257657 3300031824 Bacteria 1298
408 Ga0307410_10001921 3300031852 Bacteria 9736
409 Ga0307410_10010973 3300031852 Bacteria 5159
410 Ga0307410_10111297 3300031852 Bacteria 1981
411 Ga0307410_10448865 3300031852 Bacteria 1051
412 Ga0307410_10462379 3300031852 Bacteria 1037
413 Ga0307406_10002061 3300031901 Bacteria 10970
414 Ga0307406_10046761 3300031901 Bacteria 2724
415 Ga0307406_10074050 3300031901 Bacteria 2241
416 Ga0307406_10079318 3300031901 Bacteria 2177
417 Ga0307406_10279601 3300031901 Bacteria 1272
418 Ga0307406_11080811 3300031901 Bacteria 692
419 Ga0307406_11190484 3300031901 Bacteria 661
420 Ga0307406_11595015 3300031901 Bacteria 576
421 Ga0307406_11764845 3300031901 Bacteria 549
422 Ga0307407_10006252 3300031903 Bacteria 5266
423 Ga0307407_10047689 3300031903 Bacteria 2433
424 Ga0307407_10066940 3300031903 Bacteria 2120
425 Ga0307407_10124938 3300031903 Bacteria 1637
426 Ga0307407_10132612 3300031903 Bacteria 1596
427 Ga0307407_10164967 3300031903 Bacteria 1453
428 Ga0307407_10167174 3300031903 Bacteria 1445
429 Ga0307407_10187927 3300031903 Bacteria 1374
430 Ga0307407_10188373 3300031903 Bacteria 1373
431 Ga0307407_10247799 3300031903 Bacteria 1219
432 Ga0307412_10004189 3300031911 Bacteria 8042
433 Ga0307412_10056309 3300031911 Bacteria 2620
434 Ga0307412_10057189 3300031911 Bacteria 2602
435 Ga0307412_10269731 3300031911 Bacteria 1331
436 Ga0307412_10462896 3300031911 Bacteria 1048
437 Ga0307412_10813606 3300031911 Bacteria 812
438 Ga0307412_11065774 3300031911 Bacteria 717
439 Ga0307412_11551149 3300031911 Bacteria 603
440 Ga0307412_11806072 3300031911 Bacteria 562
441 Ga0307409_100020322 3300031995 Bacteria 4522
442 Ga0307409_100100836 3300031995 Bacteria 2394
443 Ga0307409_100103730 3300031995 Bacteria 2366
444 Ga0307409_100125976 3300031995 Bacteria 2179
445 Ga0307409_100126402 3300031995 Bacteria 2175
446 Ga0307409_100207681 3300031995 Bacteria 1757
447 Ga0307409_100258459 3300031995 Bacteria 1596
448 Ga0307409_100722594 3300031995 Bacteria 997
449 Ga0307409_101178673 3300031995 Bacteria 789
450 Ga0307409_101626096 3300031995 Bacteria 674
451 Ga0307409_102612802 3300031995 Bacteria 533
452 Ga0307416_100001374 3300032002 Bacteria 13144
453 Ga0307416_100045974 3300032002 Bacteria 3442
454 Ga0307416_100194563 3300032002 Bacteria 1917
455 Ga0307416_100219520 3300032002 Bacteria 1822
456 Ga0307416_100344585 3300032002 Bacteria 1505
457 Ga0307416_100646770 3300032002 Bacteria 1142
458 Ga0307416_100675996 3300032002 Bacteria 1119
459 Ga0307416_100859835 3300032002 Bacteria 1005
460 Ga0307416_100869152 3300032002 Bacteria 1000
461 Ga0307416_101090166 3300032002 Bacteria 903
462 Ga0307416_101540252 3300032002 Bacteria 770
463 Ga0307416_101913201 3300032002 Bacteria 696
464 Ga0307416_102311727 3300032002 Bacteria 638
465 Ga0307414_10004020 3300032004 Bacteria 7938
466 Ga0307414_10006097 3300032004 Bacteria 6690
467 Ga0307414_10019404 3300032004 Bacteria 4213
468 Ga0307414_10328168 3300032004 Bacteria 1305
469 Ga0307414_10519541 3300032004 Bacteria 1056
470 Ga0307414_12124560 3300032004 Bacteria 524
471 Ga0307411_10006107 3300032005 Bacteria 5991
472 Ga0307411_10015880 3300032005 Bacteria 4244
473 Ga0307411_10033989 3300032005 Bacteria 3168
474 Ga0307411_10132289 3300032005 Bacteria 1825
475 Ga0307411_10612387 3300032005 Bacteria 938
476 Ga0307411_10845375 3300032005 Bacteria 809
477 Ga0307411_11063695 3300032005 Bacteria 727
478 Ga0307411_11673406 3300032005 Bacteria 588
479 Ga0307411_11961591 3300032005 Bacteria 546
480 Ga0307415_100001757 3300032126 Bacteria 10581
481 Ga0307415_100004233 3300032126 Bacteria 7417
482 Ga0307415_100017602 3300032126 Bacteria 4288
483 Ga0307415_100088340 3300032126 Bacteria 2236
484 Ga0307415_100317734 3300032126 Bacteria 1297
485 Ga0307415_100860697 3300032126 Bacteria 832
486 Ga0307415_100985764 3300032126 Bacteria 782
487 Ga0307415_101421413 3300032126 Bacteria 661
488 Ga0307415_101944873 3300032126 Bacteria 572
489 Ga0307415_102263701 3300032126 Bacteria 533
490 Ga0316593_10428655 3300032168 Unclassified 514
491 Ga0373941_0330408 3300035115 Bacteria 615
492 Ga0373960_0053465 3300035121 Bacteria 1205
493 Ga0373943_0901666 3300035170 Bacteria 528
494 Ga0373927_0492188 3300035695 Bacteria 810
495 Ga0373947_0048833 3300035725 Bacteria 2540
496 Ga0373925_0326833 3300037068 Bacteria 1242
497 Ga0395899_0403869 3300037312 Bacteria 903
498 Ga0395900_0014431 3300037418 Bacteria 8063
499 Ga0395900_1331782 3300037418 Bacteria 632
500 Ga0395898_0311808 3300037466 Bacteria 1501
501 Ga0395905_0058720 3300037471 Bacteria 3597
502 Ga0395905_0085674 3300037471 Bacteria 2952
503 Ga0395905_0150743 3300037471 Bacteria 2188
504 Ga0436364_0538146 3300037853 Bacteria 666
505 Ga0395901_0017032 3300038443 Bacteria 7406
506 Ga0436365_0850895 3300039437 Bacteria 503
507 Ga0436365_1844771 3300039437 Bacteria 7246
508 Ga0439439_0033131 3300041406 Bacteria 1321
509 Ga0439461_0030902 3300041410 Bacteria 1116
510 Ga0451795_0359709 3300041456 Bacteria 1065
511 Ga0451795_0917223 3300041456 Unclassified 620
512 Ga0451795_1201529 3300041456 Bacteria 518
513 Ga0451807_0575583 3300041486 Bacteria 1210
514 Ga0451807_1859592 3300041486 Unclassified 828
515 Ga0451847_0137072 3300041503 Bacteria 539
516 Ga0451849_0318348 3300041505 Bacteria 570
517 Ga0451852_08252 3300041508 Bacteria 559
518 Ga0451852_10316 3300041508 Bacteria 945
519 Ga0451855_0755153 3300041511 Bacteria 632
520 Ga0451855_0792323 3300041511 Bacteria 532
521 Ga0439448_0214404 3300042005 Bacteria 676
522 Ga0439449_0295991 3300042007 Bacteria 611
523 Ga0439462_0099275 3300042015 Bacteria 802
524 Ga0450898_106729 3300042134 Bacteria 589
525 Ga0439446_0066878 3300042156 Bacteria 1094
526 Ga0439434_0007176 3300042435 Bacteria 3263
527 Ga0439434_0042988 3300042435 Bacteria 1390
528 Ga0439434_0159439 3300042435 Bacteria 749
529 Ga0451577_0000016 3300042876 Bacteria 531002
530 Ga0451577_0003423 3300042876 Bacteria 17680
531 Ga0451577_0051202 3300042876 Bacteria 3686
532 Ga0451577_0059655 3300042876 Bacteria 3402
533 Ga0439440_0241150 3300042993 Bacteria 548
534 Ga0466966_0647004 3300044684 Bacteria 637
535 Ga0466963_0547068 3300044694 Bacteria 818
536 Ga0453684_0000368 3300044712 Bacteria 185018
537 Ga0453684_0021439 3300044712 Bacteria 9652
538 Ga0453684_1532475 3300044712 Bacteria 687
539 Ga0466971_0417250 3300044719 Bacteria 656
540 Ga0466970_0789667 3300044765 Bacteria 556
541 Ga0466957_0620818 3300044842 Bacteria 758
542 Ga0466960_0326110 3300044901 Bacteria 871
543 Ga0466960_0914535 3300044901 Bacteria 536
544 Ga0451576_0108438 3300045051 Bacteria 2889
545 Ga0451576_1920053 3300045051 Bacteria 611
546 Ga0466958_0113324 3300045836 Bacteria 1694
547 Ga0466958_0332616 3300045836 Bacteria 977
548 Ga0466967_1248514 3300045976 Bacteria 740
549 Ga0495629_0450646 3300046459 Bacteria 871
550 Ga0495638_0090498 3300046460 Bacteria 1844
551 Ga0495584_0429383 3300046491 Bacteria 672
552 Ga0495586_0226495 3300046535 Bacteria 1063
553 Ga0495658_0255284 3300046683 Bacteria 1103
554 Ga0495670_0152955 3300046691 Bacteria 1210
555 Ga0495581_0706503 3300047315 Bacteria 581
556 Ga0495684_0626998 3300047471 Bacteria 722
557 Ga0496108_0733952 3300048911 Bacteria 855
558 Ga0496109_0035287 3300048912 Bacteria 4510
559 Ga0496110_0081019 3300048913 Bacteria 2894
560 Ga0496111_1115855 3300048914 Bacteria 562
561 Ga0496112_0097418 3300048915 Bacteria 2912
562 Ga0496113_0411128 3300048916 Bacteria 1087
563 Ga0496115_0147084 3300048918 Bacteria 1945
564 Ga0496119_0521290 3300048922 Bacteria 550
565 Ga0496122_0007634 3300048925 Bacteria 11943
566 Ga0496126_0316966 3300048929 Bacteria 1283
567 Ga0501306_049350 3300049127 Bacteria 672
568 Ga0501306_062587 3300049127 Bacteria 615
569 Ga0501306_083539 3300049127 Bacteria 554
570 Ga0501308_045481 3300049128 Bacteria 630
571 Ga0501309_045884 3300049129 Bacteria 677
572 Ga0501309_076740 3300049129 Bacteria 556
573 Ga0501343_005378 3300049132 Bacteria 981
574 Ga0501305_053789 3300049161 Bacteria 681
575 Ga0501305_085581 3300049161 Bacteria 571
576 Ga0501305_107219 3300049161 Bacteria 525
577 Ga0501307_048006 3300049162 Bacteria 636
578 Ga0501307_073541 3300049162 Bacteria 548
579 Ga0501298_156461 3300049521 Bacteria 560
580 Ga0501311_022577 3300049527 Bacteria 866
581 Ga0501311_039956 3300049527 Bacteria 708
582 Ga0501311_071707 3300049527 Bacteria 576
583 Ga0501311_094503 3300049527 Bacteria 523
584 Ga0501312_059348 3300049528 Bacteria 660
585 Ga0501312_060263 3300049528 Bacteria 656
586 Ga0501312_100111 3300049528 Bacteria 543
587 Ga0501315_043692 3300049531 Bacteria 686
588 Ga0501315_044570 3300049531 Bacteria 681
589 Ga0501315_053100 3300049531 Bacteria 640
590 Ga0501315_098890 3300049531 Bacteria 513
591 Ga0501316_034865 3300049532 Bacteria 685
592 Ga0501316_043899 3300049532 Bacteria 629
593 Ga0501316_076530 3300049532 Bacteria 513
594 Ga0501318_043664 3300049534 Bacteria 648
595 Ga0501321_017999 3300049537 Bacteria 854
596 Ga0501321_053394 3300049537 Bacteria 596
597 Ga0501321_079279 3300049537 Bacteria 521
598 Ga0501323_013111 3300049539 Bacteria 1021
599 Ga0501323_050108 3300049539 Bacteria 632
600 Ga0501324_024502 3300049540 Bacteria 633
601 Ga0501325_046257 3300049541 Bacteria 543
602 Ga0501330_020228 3300049546 Bacteria 532
603 Ga0501340_010805 3300049556 Bacteria 674
604 Ga0501031_0211048 3300049568 Bacteria 1265
605 Ga0501031_1031803 3300049568 Bacteria 525
606 Ga0501033_1064523 3300049570 Bacteria 539
607 Ga0501036_0441044 3300049572 Bacteria 1085
608 Ga0501040_0010487 3300049576 Bacteria 6061
609 Ga0501069_0577419 3300049585 Bacteria 674
610 Ga0501070_0913506 3300049586 Bacteria 684
611 Ga0501071_1046458 3300049587 Bacteria 631
612 Ga0501072_0589649 3300049588 Bacteria 877
613 Ga0501074_0532383 3300049590 Bacteria 832
614 Ga0501074_1171464 3300049590 Bacteria 539
615 Ga0501075_1359786 3300049591 Bacteria 538
616 Ga0501076_0810111 3300049592 Bacteria 773
617 Ga0501202_213777 3300049652 Bacteria 532
618 Ga0501209_271436 3300049656 Bacteria 532
619 Ga0501235_155420 3300049669 Bacteria 595
620 Ga0501239_018431 3300049672 Bacteria 839
621 Ga0501242_032787 3300049674 Bacteria 710
622 Ga0501242_082764 3300049674 Bacteria 517
623 Ga0501242_086688 3300049674 Bacteria 509
624 Ga0501243_091552 3300049675 Bacteria 604
625 Ga0501249_087286 3300049679 Bacteria 737
626 Ga0501250_019078 3300049680 Bacteria 874
627 Ga0501257_178400 3300049686 Bacteria 600
628 Ga0501260_023056 3300049689 Bacteria 684
629 Ga0501225_0199298 3300049705 Bacteria 634
630 Ga0501225_0349274 3300049705 Bacteria 511
631 Ga0501079_0058235 3300049741 Bacteria 2981
632 Ga0501079_0759944 3300049741 Bacteria 763
633 Ga0501079_1548245 3300049741 Bacteria 521
634 Ga0501080_0526591 3300049742 Bacteria 1054
635 Ga0501080_1391630 3300049742 Bacteria 599
636 Ga0501081_0434671 3300049743 Bacteria 974
637 Ga0501083_0648515 3300049744 Bacteria 687
638 Ga0501268_089851 3300049765 Bacteria 645
639 Ga0501268_154304 3300049765 Bacteria 532
640 Ga0501271_028867 3300049768 Bacteria 677
641 Ga0501274_019228 3300049771 Bacteria 698
642 Ga0501283_025389 3300049779 Bacteria 970
643 Ga0501035_0773208 3300049822 Bacteria 769
644 Ga0501045_0349186 3300049824 Bacteria 1101
645 Ga0501045_1252635 3300049824 Bacteria 540
646 nmdc:mga05p37_1010845_c1 3300050507 Bacteria 882
647 nmdc:mga05p37_1339780_c1 3300050507 Bacteria 726
648 nmdc:mga05p37_155008_c1 3300050507 Bacteria 2800
649 nmdc:mga05p37_2182248_c1 3300050507 Bacteria 515
650 nmdc:mga05p37_243241_c1 3300050507 Bacteria 2162
651 nmdc:mga05p37_618127_c1 3300050507 Bacteria 1220
652 nmdc:mga09592_1154112_c1 3300050508 Bacteria 642
653 nmdc:mga09592_1368866_c1 3300050508 Bacteria 580
654 nmdc:mga09592_1486150_c1 3300050508 Bacteria 552
655 nmdc:mga09592_278139_c1 3300050508 Bacteria 1452
656 nmdc:mga09592_333116_c1 3300050508 Bacteria 1314
657 nmdc:mga09592_378498_c1 3300050508 Bacteria 1224
658 nmdc:mga09592_408842_c1 3300050508 Unclassified 1173
659 nmdc:mga09592_427372_c1 3300050508 Bacteria 1144
660 nmdc:mga09592_81921_c1 3300050508 Bacteria 2750
661 nmdc:mga0qj67_1107898_c1 3300050509 Bacteria 618
662 nmdc:mga0qj67_113311_c1 3300050509 Bacteria 2190
663 nmdc:mga0qj67_135467_c1 3300050509 Bacteria 1996
664 nmdc:mga0qj67_146257_c1 3300050509 Bacteria 1916
665 nmdc:mga0qj67_16602_c1 3300050509 Bacteria 5587
666 nmdc:mga0qj67_167202_c1 3300050509 Bacteria 1786
667 nmdc:mga0qj67_228681_c1 3300050509 Bacteria 1509
668 nmdc:mga0qj67_366079_c1 3300050509 Bacteria 1165
669 nmdc:mga0qj67_98787_c1 3300050509 Bacteria 2352
670 nmdc:mga06r32_1029249_c1 3300050510 Bacteria 775
671 nmdc:mga06r32_1122475_c1 3300050510 Bacteria 735
672 nmdc:mga06r32_274274_c1 3300050510 Bacteria 1674
673 nmdc:mga06r32_337699_c2 3300050510 Bacteria 875
674 nmdc:mga06r32_344546_c1 3300050510 Bacteria 1475
675 nmdc:mga06r32_45043_c1 3300050510 Bacteria 4204
676 nmdc:mga06r32_45468_c1 3300050510 Bacteria 4185
677 nmdc:mga06r32_514225_c1 3300050510 Bacteria 1173
678 nmdc:mga06r32_766039_c1 3300050510 Bacteria 927
679 nmdc:mga06r32_78412_c1 3300050510 Bacteria 3211
680 nmdc:mga08y16_1952111_c1 3300050511 Bacteria 537
681 nmdc:mga08y16_270272_c1 3300050511 Bacteria 1755
682 nmdc:mga08y16_281809_c1 3300050511 Bacteria 1714
683 nmdc:mga08y16_349213_c1 3300050511 Bacteria 1520
684 nmdc:mga08y16_37314_c1 3300050511 Bacteria 5104
685 nmdc:mga08y16_7108_c1 3300050511 Bacteria 11751
686 nmdc:mga0n895_4655_c1 3300050512 Bacteria 11316
687 nmdc:mga0n895_674464_c1 3300050512 Bacteria 1031
688 nmdc:mga0n895_71307_c1 3300050512 Bacteria 3445
689 nmdc:mga08x19_362816_c1 3300050514 Bacteria 1013
690 nmdc:mga0a205_163153_c1 3300050515 Bacteria 2124
691 nmdc:mga0a205_237574_c1 3300050515 Bacteria 1704
692 nmdc:mga0a205_81225_c1 3300050515 Bacteria 3131
693 Ga0500596_023171 3300053735 Bacteria 941
694 Ga0501084_0453819 3300054114 Bacteria 1084
695 Ga0590071_065344 3300059421 Bacteria 892
696 Ga0590075_101676 3300059424 Bacteria 749
697 Ga0590075_123137 3300059424 Bacteria 679
698 Ga0587101_113173 3300059623 Bacteria 553
699 Ga0587069_156213 3300059642 Bacteria 510
700 Ga0501082_0110816 3300060353 Bacteria 2375
701 Ga0530510_0351048 3300061734 Bacteria 1108

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0913506 Ga0501070_0913506_104_391 95
2 3300041511 Ga0451855_0755153 Ga0451855_0755153_178_501 99
3 3300032168 Ga0316593_10428655 Ga0316593_104286552 103
4 3300041456 Ga0451795_0359709 Ga0451795_0359709_456_767 103
5 3300041456 Ga0451795_0917223 Ga0451795_0917223_57_368 103
6 3300041456 Ga0451795_1201529 Ga0451795_1201529_155_466 103
7 3300041508 Ga0451852_10316 Ga0451852_10316_70_381 103
8 3300048913 Ga0496110_0081019 Ga0496110_0081019_884_1195 103
9 3300048914 Ga0496111_1115855 Ga0496111_1115855_205_516 103
10 3300048922 Ga0496119_0521290 Ga0496119_0521290_139_450 103
11 3300048925 Ga0496122_0007634 Ga0496122_0007634_2973_3284 103
12 3300048929 Ga0496126_0316966 Ga0496126_0316966_362_673 103
13 3300049132 Ga0501343_005378 Ga0501343_005378_226_537 103
14 3300049537 Ga0501321_017999 Ga0501321_017999_98_409 103
15 3300049539 Ga0501323_013111 Ga0501323_013111_109_420 103
16 3300049546 Ga0501330_020228 Ga0501330_020228_52_363 103
17 3300005327 Ga0070658_10185468 Ga0070658_101854682 104
18 3300005328 Ga0070676_10441942 Ga0070676_104419422 104
19 3300005329 Ga0070683_100100136 Ga0070683_1001001362 104
20 3300005331 Ga0070670_100004241 Ga0070670_1000042415 104
21 3300005343 Ga0070687_100637913 Ga0070687_1006379132 104
22 3300005344 Ga0070661_100220389 Ga0070661_1002203893 104
23 3300005345 Ga0070692_10862983 Ga0070692_108629832 104
24 3300005353 Ga0070669_100047960 Ga0070669_1000479602 104
25 3300005354 Ga0070675_100002241 Ga0070675_10000224114 104
26 3300005355 Ga0070671_100293752 Ga0070671_1002937521 104
27 3300005356 Ga0070674_100273136 Ga0070674_1002731362 104
28 3300005356 Ga0070674_100335802 Ga0070674_1003358022 104
29 3300005364 Ga0070673_100060549 Ga0070673_1000605492 104
30 3300005365 Ga0070688_100560433 Ga0070688_1005604331 104
31 3300005456 Ga0070678_100918497 Ga0070678_1009184972 104
32 3300005459 Ga0068867_100122521 Ga0068867_1001225211 104
33 3300005543 Ga0070672_100017873 Ga0070672_1000178733 104
34 3300005564 Ga0070664_100245315 Ga0070664_1002453153 104
35 3300005616 Ga0068852_101086993 Ga0068852_1010869932 104
36 3300005618 Ga0068864_100046580 Ga0068864_1000465804 104
37 3300005718 Ga0068866_10686445 Ga0068866_106864452 104
38 3300005719 Ga0068861_100447043 Ga0068861_1004470432 104
39 3300005834 Ga0068851_10444059 Ga0068851_104440592 104
40 3300005840 Ga0068870_10827334 Ga0068870_108273342 104
41 3300005841 Ga0068863_100466958 Ga0068863_1004669582 104
42 3300006881 Ga0068865_101233206 Ga0068865_1012332062 104
43 3300009094 Ga0111539_13071017 Ga0111539_130710171 104
44 3300009098 Ga0105245_12087009 Ga0105245_120870092 104
45 3300009177 Ga0105248_10053267 Ga0105248_100532676 104
46 3300013100 Ga0157373_11416421 Ga0157373_114164212 104
47 3300013308 Ga0157375_10552745 Ga0157375_105527453 104
48 3300014745 Ga0157377_10482971 Ga0157377_104829712 104
49 3300014969 Ga0157376_11163100 Ga0157376_111631002 104
50 3300025315 Ga0207697_10171690 Ga0207697_101716902 104
51 3300025321 Ga0207656_10307138 Ga0207656_103071382 104
52 3300025901 Ga0207688_10581282 Ga0207688_105812821 104
53 3300025907 Ga0207645_10107170 Ga0207645_101071703 104
54 3300025908 Ga0207643_10765288 Ga0207643_107652882 104
55 3300025909 Ga0207705_10592480 Ga0207705_105924802 104
56 3300025920 Ga0207649_10643537 Ga0207649_106435372 104
57 3300025923 Ga0207681_10171369 Ga0207681_101713692 104
58 3300025925 Ga0207650_10009391 Ga0207650_100093917 104
59 3300025926 Ga0207659_10017789 Ga0207659_100177892 104
60 3300025931 Ga0207644_10655688 Ga0207644_106556882 104
61 3300025932 Ga0207690_10294363 Ga0207690_102943633 104
62 3300025937 Ga0207669_11502260 Ga0207669_115022601 104
63 3300025940 Ga0207691_10000708 Ga0207691_1000070811 104
64 3300025940 Ga0207691_10286580 Ga0207691_102865803 104
65 3300025941 Ga0207711_10164840 Ga0207711_101648402 104
66 3300025944 Ga0207661_10085002 Ga0207661_100850022 104
67 3300025945 Ga0207679_10171210 Ga0207679_101712102 104
68 3300025981 Ga0207640_11142032 Ga0207640_111420322 104
69 3300026088 Ga0207641_10373898 Ga0207641_103738984 104
70 3300026089 Ga0207648_10068620 Ga0207648_100686203 104
71 3300026095 Ga0207676_10222073 Ga0207676_102220732 104
72 3300026095 Ga0207676_11660565 Ga0207676_116605652 104
73 3300026118 Ga0207675_100490929 Ga0207675_1004909292 104
74 3300026121 Ga0207683_10386683 Ga0207683_103866832 104
75 3300041410 Ga0439461_0030902 Ga0439461_0030902_317_631 104
76 3300041486 Ga0451807_0575583 Ga0451807_0575583_113_427 104
77 3300041503 Ga0451847_0137072 Ga0451847_0137072_193_507 104
78 3300041505 Ga0451849_0318348 Ga0451849_0318348_194_508 104
79 3300041508 Ga0451852_08252 Ga0451852_08252_181_513 104
80 3300041511 Ga0451855_0792323 Ga0451855_0792323_72_386 104
81 3300042156 Ga0439446_0066878 Ga0439446_0066878_401_715 104
82 3300042435 Ga0439434_0007176 Ga0439434_0007176_2834_3148 104
83 3300050511 nmdc:mga08y16_1952111_c1 nmdc:mga08y16_1952111_c1_201_515 104
84 3300004800 Ga0058861_11979178 Ga0058861_119791782 105
85 3300004801 Ga0058860_12185004 Ga0058860_121850041 105
86 3300004803 Ga0058862_12385096 Ga0058862_123850962 105
87 3300005288 Ga0065714_10290611 Ga0065714_102906111 105
88 3300005290 Ga0065712_10509946 Ga0065712_105099461 105
89 3300005293 Ga0065715_10742786 Ga0065715_107427862 105
90 3300005295 Ga0065707_10105958 Ga0065707_101059581 105
91 3300005295 Ga0065707_10187658 Ga0065707_101876581 105
92 3300005295 Ga0065707_10502070 Ga0065707_105020702 105
93 3300005327 Ga0070658_11061393 Ga0070658_110613931 105
94 3300005328 Ga0070676_10000666 Ga0070676_100006666 105
95 3300005329 Ga0070683_100324044 Ga0070683_1003240444 105
96 3300005329 Ga0070683_100673603 Ga0070683_1006736031 105
97 3300005329 Ga0070683_101514691 Ga0070683_1015146912 105
98 3300005331 Ga0070670_100034433 Ga0070670_1000344334 105
99 3300005334 Ga0068869_100003748 Ga0068869_1000037486 105
100 3300005334 Ga0068869_100274889 Ga0068869_1002748892 105
101 3300005335 Ga0070666_10844697 Ga0070666_108446971 105
102 3300005336 Ga0070680_100116536 Ga0070680_1001165362 105
103 3300005336 Ga0070680_100504342 Ga0070680_1005043422 105
104 3300005336 Ga0070680_100670910 Ga0070680_1006709101 105
105 3300005336 Ga0070680_101675901 Ga0070680_1016759012 105
106 3300005337 Ga0070682_100377140 Ga0070682_1003771402 105
107 3300005337 Ga0070682_101683680 Ga0070682_1016836801 105
108 3300005338 Ga0068868_100009898 Ga0068868_10000989810 105
109 3300005339 Ga0070660_100247680 Ga0070660_1002476801 105
110 3300005339 Ga0070660_100837262 Ga0070660_1008372621 105
111 3300005340 Ga0070689_100775909 Ga0070689_1007759092 105
112 3300005344 Ga0070661_100007955 Ga0070661_1000079555 105
113 3300005344 Ga0070661_100024757 Ga0070661_1000247574 105
114 3300005344 Ga0070661_101437120 Ga0070661_1014371201 105
115 3300005345 Ga0070692_10031795 Ga0070692_100317951 105
116 3300005347 Ga0070668_100000088 Ga0070668_10000008823 105
117 3300005347 Ga0070668_100041916 Ga0070668_1000419162 105
118 3300005353 Ga0070669_100009001 Ga0070669_1000090015 105
119 3300005354 Ga0070675_100000328 Ga0070675_10000032822 105
120 3300005354 Ga0070675_100027429 Ga0070675_1000274293 105
121 3300005354 Ga0070675_100519902 Ga0070675_1005199022 105
122 3300005355 Ga0070671_101348664 Ga0070671_1013486642 105
123 3300005356 Ga0070674_100018717 Ga0070674_1000187175 105
124 3300005364 Ga0070673_100535481 Ga0070673_1005354813 105
125 3300005366 Ga0070659_100036048 Ga0070659_1000360484 105
126 3300005366 Ga0070659_100597009 Ga0070659_1005970092 105
127 3300005366 Ga0070659_100841104 Ga0070659_1008411041 105
128 3300005367 Ga0070667_100369803 Ga0070667_1003698033 105
129 3300005435 Ga0070714_100015926 Ga0070714_1000159267 105
130 3300005436 Ga0070713_101857413 Ga0070713_1018574131 105
131 3300005438 Ga0070701_10041132 Ga0070701_100411322 105
132 3300005439 Ga0070711_100327879 Ga0070711_1003278791 105
133 3300005439 Ga0070711_101776120 Ga0070711_1017761201 105
134 3300005441 Ga0070700_100132825 Ga0070700_1001328252 105
135 3300005441 Ga0070700_100310967 Ga0070700_1003109673 105
136 3300005441 Ga0070700_100372416 Ga0070700_1003724161 105
137 3300005444 Ga0070694_100287012 Ga0070694_1002870121 105
138 3300005444 Ga0070694_100552695 Ga0070694_1005526952 105
139 3300005455 Ga0070663_100396185 Ga0070663_1003961851 105
140 3300005455 Ga0070663_100723148 Ga0070663_1007231482 105
141 3300005458 Ga0070681_10002847 Ga0070681_100028472 105
142 3300005458 Ga0070681_10007035 Ga0070681_100070354 105
143 3300005458 Ga0070681_11083830 Ga0070681_110838302 105
144 3300005459 Ga0068867_100044387 Ga0068867_1000443875 105
145 3300005459 Ga0068867_100697422 Ga0068867_1006974222 105
146 3300005459 Ga0068867_100852247 Ga0068867_1008522472 105
147 3300005466 Ga0070685_10751585 Ga0070685_107515851 105
148 3300005471 Ga0070698_100125314 Ga0070698_1001253145 105
149 3300005471 Ga0070698_101020200 Ga0070698_1010202001 105
150 3300005518 Ga0070699_100069961 Ga0070699_1000699613 105
151 3300005518 Ga0070699_100783128 Ga0070699_1007831281 105
152 3300005530 Ga0070679_100004546 Ga0070679_1000045467 105
153 3300005530 Ga0070679_100078270 Ga0070679_1000782703 105
154 3300005530 Ga0070679_100222680 Ga0070679_1002226803 105
155 3300005530 Ga0070679_100241220 Ga0070679_1002412201 105
156 3300005535 Ga0070684_100727938 Ga0070684_1007279381 105
157 3300005535 Ga0070684_101138049 Ga0070684_1011380492 105
158 3300005535 Ga0070684_101266194 Ga0070684_1012661942 105
159 3300005543 Ga0070672_100281799 Ga0070672_1002817993 105
160 3300005544 Ga0070686_101091735 Ga0070686_1010917351 105
161 3300005545 Ga0070695_100124752 Ga0070695_1001247523 105
162 3300005546 Ga0070696_101624484 Ga0070696_1016244842 105
163 3300005547 Ga0070693_100751795 Ga0070693_1007517952 105
164 3300005548 Ga0070665_100147926 Ga0070665_1001479262 105
165 3300005548 Ga0070665_102486293 Ga0070665_1024862931 105
166 3300005563 Ga0068855_100177571 Ga0068855_1001775714 105
167 3300005563 Ga0068855_100194092 Ga0068855_1001940923 105
168 3300005563 Ga0068855_100258116 Ga0068855_1002581162 105
169 3300005564 Ga0070664_100161510 Ga0070664_1001615104 105
170 3300005564 Ga0070664_100388531 Ga0070664_1003885312 105
171 3300005577 Ga0068857_100012292 Ga0068857_1000122927 105
172 3300005577 Ga0068857_100088541 Ga0068857_1000885412 105
173 3300005577 Ga0068857_100994719 Ga0068857_1009947192 105
174 3300005577 Ga0068857_101491151 Ga0068857_1014911512 105
175 3300005578 Ga0068854_100236815 Ga0068854_1002368152 105
176 3300005578 Ga0068854_100444324 Ga0068854_1004443241 105
177 3300005614 Ga0068856_100391783 Ga0068856_1003917833 105
178 3300005615 Ga0070702_100343351 Ga0070702_1003433512 105
179 3300005616 Ga0068852_100030369 Ga0068852_1000303696 105
180 3300005617 Ga0068859_102739279 Ga0068859_1027392791 105
181 3300005618 Ga0068864_100004940 Ga0068864_1000049406 105
182 3300005618 Ga0068864_102004914 Ga0068864_1020049141 105
183 3300005718 Ga0068866_10022515 Ga0068866_100225152 105
184 3300005719 Ga0068861_100011511 Ga0068861_1000115112 105
185 3300005719 Ga0068861_100044307 Ga0068861_1000443075 105
186 3300005834 Ga0068851_10188458 Ga0068851_101884581 105
187 3300005840 Ga0068870_10020296 Ga0068870_100202961 105
188 3300005841 Ga0068863_100283541 Ga0068863_1002835414 105
189 3300005842 Ga0068858_100019838 Ga0068858_1000198388 105
190 3300005843 Ga0068860_100051139 Ga0068860_1000511393 105
191 3300005844 Ga0068862_100000439 Ga0068862_10000043939 105
192 3300005844 Ga0068862_100099960 Ga0068862_1000999602 105
193 3300006163 Ga0070715_10285590 Ga0070715_102855901 105
194 3300006237 Ga0097621_100203309 Ga0097621_1002033092 105
195 3300006358 Ga0068871_100046217 Ga0068871_1000462172 105
196 3300006844 Ga0075428_100036025 Ga0075428_1000360257 105
197 3300006844 Ga0075428_100416937 Ga0075428_1004169371 105
198 3300006844 Ga0075428_100912410 Ga0075428_1009124102 105
199 3300006844 Ga0075428_101513693 Ga0075428_1015136932 105
200 3300006844 Ga0075428_101568469 Ga0075428_1015684691 105
201 3300006846 Ga0075430_100002964 Ga0075430_10000296411 105
202 3300006846 Ga0075430_100030331 Ga0075430_1000303313 105
203 3300006846 Ga0075430_100047699 Ga0075430_1000476994 105
204 3300006846 Ga0075430_100171261 Ga0075430_1001712614 105
205 3300006846 Ga0075430_100179147 Ga0075430_1001791472 105
206 3300006846 Ga0075430_100350685 Ga0075430_1003506854 105
207 3300006846 Ga0075430_100444132 Ga0075430_1004441322 105
208 3300006846 Ga0075430_100789544 Ga0075430_1007895442 105
209 3300006847 Ga0075431_100006993 Ga0075431_1000069939 105
210 3300006847 Ga0075431_100037078 Ga0075431_1000370782 105
211 3300006847 Ga0075431_100051551 Ga0075431_1000515514 105
212 3300006847 Ga0075431_100094367 Ga0075431_1000943672 105
213 3300006847 Ga0075431_100098764 Ga0075431_1000987642 105
214 3300006847 Ga0075431_100099565 Ga0075431_1000995655 105
215 3300006847 Ga0075431_100306706 Ga0075431_1003067063 105
216 3300006847 Ga0075431_100333627 Ga0075431_1003336272 105
217 3300006847 Ga0075431_100389265 Ga0075431_1003892651 105
218 3300006852 Ga0075433_10172312 Ga0075433_101723124 105
219 3300006852 Ga0075433_11581711 Ga0075433_115817111 105
220 3300006871 Ga0075434_100008029 Ga0075434_1000080294 105
221 3300006871 Ga0075434_100118312 Ga0075434_1001183122 105
222 3300006871 Ga0075434_102138665 Ga0075434_1021386651 105
223 3300006880 Ga0075429_100020126 Ga0075429_1000201263 105
224 3300006880 Ga0075429_100082655 Ga0075429_1000826553 105
225 3300006880 Ga0075429_100134757 Ga0075429_1001347572 105
226 3300006880 Ga0075429_100372749 Ga0075429_1003727493 105
227 3300006880 Ga0075429_100584425 Ga0075429_1005844252 105
228 3300006880 Ga0075429_100971503 Ga0075429_1009715032 105
229 3300006880 Ga0075429_101657338 Ga0075429_1016573381 105
230 3300006881 Ga0068865_100041912 Ga0068865_1000419125 105
231 3300006914 Ga0075436_100119156 Ga0075436_1001191561 105
232 3300009011 Ga0105251_10494005 Ga0105251_104940051 105
233 3300009093 Ga0105240_10008731 Ga0105240_1000873115 105
234 3300009093 Ga0105240_10615211 Ga0105240_106152112 105
235 3300009093 Ga0105240_10630839 Ga0105240_106308393 105
236 3300009093 Ga0105240_11353442 Ga0105240_113534421 105
237 3300009094 Ga0111539_10004741 Ga0111539_100047415 105
238 3300009094 Ga0111539_10154945 Ga0111539_101549453 105
239 3300009094 Ga0111539_10252059 Ga0111539_102520593 105
240 3300009094 Ga0111539_10443618 Ga0111539_104436182 105
241 3300009094 Ga0111539_12819393 Ga0111539_128193931 105
242 3300009098 Ga0105245_10247062 Ga0105245_102470622 105
243 3300009147 Ga0114129_10006882 Ga0114129_100068827 105
244 3300009147 Ga0114129_10578255 Ga0114129_105782554 105
245 3300009147 Ga0114129_10681504 Ga0114129_106815042 105
246 3300009147 Ga0114129_10705780 Ga0114129_107057801 105
247 3300009147 Ga0114129_10769922 Ga0114129_107699223 105
248 3300009148 Ga0105243_10417915 Ga0105243_104179153 105
249 3300009174 Ga0105241_11657672 Ga0105241_116576721 105
250 3300009176 Ga0105242_10234283 Ga0105242_102342831 105
251 3300009176 Ga0105242_11494123 Ga0105242_114941231 105
252 3300009177 Ga0105248_10106115 Ga0105248_101061152 105
253 3300009545 Ga0105237_10625398 Ga0105237_106253982 105
254 3300009551 Ga0105238_11252027 Ga0105238_112520272 105
255 3300009553 Ga0105249_10000083 Ga0105249_100000835 105
256 3300009553 Ga0105249_10006364 Ga0105249_1000636414 105
257 3300010375 Ga0105239_11149910 Ga0105239_111499101 105
258 3300010375 Ga0105239_12596143 Ga0105239_125961431 105
259 3300011119 Ga0105246_12576138 Ga0105246_125761381 105
260 3300012483 Ga0157337_1015725 Ga0157337_10157251 105
261 3300012495 Ga0157323_1007640 Ga0157323_10076402 105
262 3300012500 Ga0157314_1045705 Ga0157314_10457052 105
263 3300013100 Ga0157373_10120462 Ga0157373_101204623 105
264 3300013100 Ga0157373_10130484 Ga0157373_101304842 105
265 3300013100 Ga0157373_10266933 Ga0157373_102669332 105
266 3300013102 Ga0157371_10008381 Ga0157371_100083812 105
267 3300013104 Ga0157370_10007729 Ga0157370_100077297 105
268 3300013104 Ga0157370_10062261 Ga0157370_100622611 105
269 3300013104 Ga0157370_10606067 Ga0157370_106060673 105
270 3300013105 Ga0157369_10070156 Ga0157369_100701564 105
271 3300013105 Ga0157369_10697951 Ga0157369_106979511 105
272 3300013105 Ga0157369_11334046 Ga0157369_113340461 105
273 3300013105 Ga0157369_11385673 Ga0157369_113856732 105
274 3300013296 Ga0157374_10699950 Ga0157374_106999502 105
275 3300013296 Ga0157374_11047859 Ga0157374_110478592 105
276 3300013297 Ga0157378_10531260 Ga0157378_105312603 105
277 3300013306 Ga0163162_10045978 Ga0163162_100459782 105
278 3300013307 Ga0157372_10029595 Ga0157372_100295953 105
279 3300013307 Ga0157372_11466587 Ga0157372_114665872 105
280 3300013307 Ga0157372_11721060 Ga0157372_117210602 105
281 3300013307 Ga0157372_11735926 Ga0157372_117359261 105
282 3300013307 Ga0157372_12131002 Ga0157372_121310022 105
283 3300013308 Ga0157375_10042107 Ga0157375_100421072 105
284 3300013308 Ga0157375_10104987 Ga0157375_101049872 105
285 3300014325 Ga0163163_10114086 Ga0163163_101140861 105
286 3300014326 Ga0157380_10008461 Ga0157380_100084616 105
287 3300014326 Ga0157380_10156116 Ga0157380_101561164 105
288 3300014326 Ga0157380_11039160 Ga0157380_110391602 105
289 3300014326 Ga0157380_11625068 Ga0157380_116250681 105
290 3300014745 Ga0157377_10030937 Ga0157377_100309373 105
291 3300014745 Ga0157377_10409003 Ga0157377_104090031 105
292 3300014968 Ga0157379_10019627 Ga0157379_100196278 105
293 3300015262 Ga0182007_10171056 Ga0182007_101710561 105
294 3300015262 Ga0182007_10204021 Ga0182007_102040211 105
295 3300015265 Ga0182005_1016162 Ga0182005_10161624 105
296 3300017792 Ga0163161_10132325 Ga0163161_101323252 105
297 3300020069 Ga0197907_10774304 Ga0197907_107743041 105
298 3300020070 Ga0206356_10536816 Ga0206356_105368162 105
299 3300020078 Ga0206352_10030481 Ga0206352_100304811 105
300 3300020078 Ga0206352_11245330 Ga0206352_112453302 105
301 3300020080 Ga0206350_10734957 Ga0206350_107349572 105
302 3300020081 Ga0206354_10034601 Ga0206354_100346012 105
303 3300020081 Ga0206354_10488864 Ga0206354_104888641 105
304 3300020082 Ga0206353_10399243 Ga0206353_103992431 105
305 3300021384 Ga0213876_10016407 Ga0213876_100164075 105
306 3300021388 Ga0213875_10370117 Ga0213875_103701171 105
307 3300022467 Ga0224712_10669014 Ga0224712_106690141 105
308 3300025271 Ga0207666_1013693 Ga0207666_10136931 105
309 3300025315 Ga0207697_10009810 Ga0207697_100098105 105
310 3300025321 Ga0207656_10085403 Ga0207656_100854034 105
311 3300025893 Ga0207682_10253876 Ga0207682_102538762 105
312 3300025899 Ga0207642_10368154 Ga0207642_103681542 105
313 3300025901 Ga0207688_10033228 Ga0207688_100332282 105
314 3300025904 Ga0207647_10081279 Ga0207647_100812791 105
315 3300025907 Ga0207645_10000813 Ga0207645_1000081314 105
316 3300025908 Ga0207643_10014953 Ga0207643_100149532 105
317 3300025909 Ga0207705_10047586 Ga0207705_100475862 105
318 3300025911 Ga0207654_10561254 Ga0207654_105612542 105
319 3300025912 Ga0207707_10025067 Ga0207707_100250674 105
320 3300025912 Ga0207707_10077339 Ga0207707_100773394 105
321 3300025912 Ga0207707_10418479 Ga0207707_104184792 105
322 3300025913 Ga0207695_10048163 Ga0207695_100481631 105
323 3300025913 Ga0207695_10143001 Ga0207695_101430011 105
324 3300025913 Ga0207695_10223272 Ga0207695_102232723 105
325 3300025913 Ga0207695_10603483 Ga0207695_106034831 105
326 3300025913 Ga0207695_10978990 Ga0207695_109789901 105
327 3300025914 Ga0207671_10632156 Ga0207671_106321562 105
328 3300025916 Ga0207663_10889315 Ga0207663_108893152 105
329 3300025917 Ga0207660_10366131 Ga0207660_103661312 105
330 3300025917 Ga0207660_10605864 Ga0207660_106058642 105
331 3300025917 Ga0207660_11300898 Ga0207660_113008982 105
332 3300025918 Ga0207662_10010413 Ga0207662_100104134 105
333 3300025919 Ga0207657_10025256 Ga0207657_100252564 105
334 3300025919 Ga0207657_10564447 Ga0207657_105644472 105
335 3300025920 Ga0207649_10006820 Ga0207649_100068205 105
336 3300025920 Ga0207649_10757528 Ga0207649_107575281 105
337 3300025921 Ga0207652_10006003 Ga0207652_100060035 105
338 3300025921 Ga0207652_10123696 Ga0207652_101236963 105
339 3300025921 Ga0207652_10139989 Ga0207652_101399891 105
340 3300025923 Ga0207681_10008207 Ga0207681_100082075 105
341 3300025925 Ga0207650_10121511 Ga0207650_101215112 105
342 3300025926 Ga0207659_10062230 Ga0207659_100622304 105
343 3300025926 Ga0207659_10345034 Ga0207659_103450342 105
344 3300025927 Ga0207687_11677649 Ga0207687_116776492 105
345 3300025928 Ga0207700_10140605 Ga0207700_101406051 105
346 3300025929 Ga0207664_10744436 Ga0207664_107444361 105
347 3300025931 Ga0207644_10176798 Ga0207644_101767981 105
348 3300025932 Ga0207690_10142139 Ga0207690_101421394 105
349 3300025932 Ga0207690_10438095 Ga0207690_104380952 105
350 3300025933 Ga0207706_10000055 Ga0207706_1000005535 105
351 3300025934 Ga0207686_10259107 Ga0207686_102591073 105
352 3300025935 Ga0207709_11551942 Ga0207709_115519422 105
353 3300025938 Ga0207704_10065856 Ga0207704_100658564 105
354 3300025940 Ga0207691_10000129 Ga0207691_1000012934 105
355 3300025942 Ga0207689_10000623 Ga0207689_100006232 105
356 3300025944 Ga0207661_10070781 Ga0207661_100707812 105
357 3300025944 Ga0207661_12046887 Ga0207661_120468871 105
358 3300025945 Ga0207679_10005300 Ga0207679_100053005 105
359 3300025945 Ga0207679_10067306 Ga0207679_100673062 105
360 3300025945 Ga0207679_10091968 Ga0207679_100919682 105
361 3300025945 Ga0207679_10262278 Ga0207679_102622782 105
362 3300025949 Ga0207667_10136146 Ga0207667_101361462 105
363 3300025949 Ga0207667_10645141 Ga0207667_106451412 105
364 3300025949 Ga0207667_10768010 Ga0207667_107680102 105
365 3300025949 Ga0207667_11044152 Ga0207667_110441521 105
366 3300025960 Ga0207651_10606391 Ga0207651_106063913 105
367 3300025961 Ga0207712_10004764 Ga0207712_100047645 105
368 3300025961 Ga0207712_10010311 Ga0207712_100103111 105
369 3300025972 Ga0207668_10006867 Ga0207668_100068672 105
370 3300025972 Ga0207668_10031111 Ga0207668_100311112 105
371 3300025981 Ga0207640_10179150 Ga0207640_101791503 105
372 3300025986 Ga0207658_10036343 Ga0207658_100363432 105
373 3300026023 Ga0207677_10009665 Ga0207677_100096651 105
374 3300026035 Ga0207703_10186178 Ga0207703_101861783 105
375 3300026041 Ga0207639_10308648 Ga0207639_103086481 105
376 3300026041 Ga0207639_11287389 Ga0207639_112873891 105
377 3300026067 Ga0207678_10469863 Ga0207678_104698632 105
378 3300026075 Ga0207708_10006119 Ga0207708_100061195 105
379 3300026075 Ga0207708_10040492 Ga0207708_100404922 105
380 3300026075 Ga0207708_10136664 Ga0207708_101366642 105
381 3300026078 Ga0207702_10373275 Ga0207702_103732752 105
382 3300026088 Ga0207641_11677590 Ga0207641_116775902 105
383 3300026089 Ga0207648_10289950 Ga0207648_102899502 105
384 3300026095 Ga0207676_10050921 Ga0207676_100509212 105
385 3300026116 Ga0207674_10001035 Ga0207674_100010351 105
386 3300026116 Ga0207674_10118805 Ga0207674_101188052 105
387 3300026116 Ga0207674_10539156 Ga0207674_105391561 105
388 3300026116 Ga0207674_11076565 Ga0207674_110765651 105
389 3300026118 Ga0207675_100000096 Ga0207675_10000009618 105
390 3300026118 Ga0207675_100026113 Ga0207675_1000261132 105
391 3300026142 Ga0207698_10774152 Ga0207698_107741522 105
392 3300026142 Ga0207698_11277730 Ga0207698_112777302 105
393 3300027471 Ga0209995_1057867 Ga0209995_10578672 105
394 3300027543 Ga0209999_1089319 Ga0209999_10893192 105
395 3300027907 Ga0207428_10067090 Ga0207428_100670905 105
396 3300027907 Ga0207428_10285211 Ga0207428_102852113 105
397 3300028379 Ga0268266_10201093 Ga0268266_102010934 105
398 3300028379 Ga0268266_11774115 Ga0268266_117741151 105
399 3300028380 Ga0268265_10005621 Ga0268265_100056215 105
400 3300028380 Ga0268265_10033945 Ga0268265_100339454 105
401 3300028381 Ga0268264_10039846 Ga0268264_100398463 105
402 3300031238 Ga0265332_10051168 Ga0265332_100511682 105
403 3300031238 Ga0265332_10069970 Ga0265332_100699701 105
404 3300031239 Ga0265328_10298553 Ga0265328_102985531 105
405 3300031251 Ga0265327_10216607 Ga0265327_102166071 105
406 3300031548 Ga0307408_100008719 Ga0307408_1000087194 105
407 3300031548 Ga0307408_100577648 Ga0307408_1005776483 105
408 3300031548 Ga0307408_100603677 Ga0307408_1006036773 105
409 3300031548 Ga0307408_100800662 Ga0307408_1008006621 105
410 3300031548 Ga0307408_101027248 Ga0307408_1010272482 105
411 3300031548 Ga0307408_102076855 Ga0307408_1020768551 105
412 3300031548 Ga0307408_102241963 Ga0307408_1022419632 105
413 3300031711 Ga0265314_10018388 Ga0265314_100183889 105
414 3300031731 Ga0307405_10003488 Ga0307405_100034885 105
415 3300031731 Ga0307405_10015147 Ga0307405_100151474 105
416 3300031731 Ga0307405_10021094 Ga0307405_100210942 105
417 3300031731 Ga0307405_10191339 Ga0307405_101913393 105
418 3300031731 Ga0307405_10204548 Ga0307405_102045484 105
419 3300031731 Ga0307405_10298957 Ga0307405_102989573 105
420 3300031731 Ga0307405_10398100 Ga0307405_103981002 105
421 3300031731 Ga0307405_10510021 Ga0307405_105100213 105
422 3300031731 Ga0307405_10524649 Ga0307405_105246491 105
423 3300031731 Ga0307405_10710270 Ga0307405_107102702 105
424 3300031731 Ga0307405_10881685 Ga0307405_108816852 105
425 3300031731 Ga0307405_10892810 Ga0307405_108928102 105
426 3300031731 Ga0307405_11880934 Ga0307405_118809341 105
427 3300031824 Ga0307413_10004067 Ga0307413_100040675 105
428 3300031824 Ga0307413_10005147 Ga0307413_100051473 105
429 3300031824 Ga0307413_10009962 Ga0307413_100099622 105
430 3300031824 Ga0307413_10185529 Ga0307413_101855292 105
431 3300031824 Ga0307413_10237077 Ga0307413_102370772 105
432 3300031824 Ga0307413_10257657 Ga0307413_102576572 105
433 3300031852 Ga0307410_10001921 Ga0307410_100019216 105
434 3300031852 Ga0307410_10010973 Ga0307410_100109734 105
435 3300031852 Ga0307410_10111297 Ga0307410_101112972 105
436 3300031852 Ga0307410_10448865 Ga0307410_104488652 105
437 3300031852 Ga0307410_10462379 Ga0307410_104623792 105
438 3300031901 Ga0307406_10002061 Ga0307406_100020616 105
439 3300031901 Ga0307406_10046761 Ga0307406_100467612 105
440 3300031901 Ga0307406_10074050 Ga0307406_100740503 105
441 3300031901 Ga0307406_10079318 Ga0307406_100793182 105
442 3300031901 Ga0307406_10279601 Ga0307406_102796012 105
443 3300031901 Ga0307406_11080811 Ga0307406_110808111 105
444 3300031901 Ga0307406_11190484 Ga0307406_111904841 105
445 3300031901 Ga0307406_11595015 Ga0307406_115950151 105
446 3300031901 Ga0307406_11764845 Ga0307406_117648452 105
447 3300031903 Ga0307407_10006252 Ga0307407_100062523 105
448 3300031903 Ga0307407_10047689 Ga0307407_100476892 105
449 3300031903 Ga0307407_10066940 Ga0307407_100669402 105
450 3300031903 Ga0307407_10124938 Ga0307407_101249381 105
451 3300031903 Ga0307407_10132612 Ga0307407_101326121 105
452 3300031903 Ga0307407_10164967 Ga0307407_101649672 105
453 3300031903 Ga0307407_10167174 Ga0307407_101671741 105
454 3300031903 Ga0307407_10187927 Ga0307407_101879273 105
455 3300031903 Ga0307407_10188373 Ga0307407_101883732 105
456 3300031903 Ga0307407_10247799 Ga0307407_102477992 105
457 3300031911 Ga0307412_10004189 Ga0307412_100041896 105
458 3300031911 Ga0307412_10056309 Ga0307412_100563092 105
459 3300031911 Ga0307412_10057189 Ga0307412_100571893 105
460 3300031911 Ga0307412_10269731 Ga0307412_102697312 105
461 3300031911 Ga0307412_10462896 Ga0307412_104628962 105
462 3300031911 Ga0307412_10813606 Ga0307412_108136062 105
463 3300031911 Ga0307412_11065774 Ga0307412_110657741 105
464 3300031911 Ga0307412_11551149 Ga0307412_115511492 105
465 3300031911 Ga0307412_11806072 Ga0307412_118060721 105
466 3300031995 Ga0307409_100020322 Ga0307409_1000203224 105
467 3300031995 Ga0307409_100100836 Ga0307409_1001008362 105
468 3300031995 Ga0307409_100103730 Ga0307409_1001037302 105
469 3300031995 Ga0307409_100125976 Ga0307409_1001259762 105
470 3300031995 Ga0307409_100126402 Ga0307409_1001264024 105
471 3300031995 Ga0307409_100207681 Ga0307409_1002076812 105
472 3300031995 Ga0307409_100258459 Ga0307409_1002584593 105
473 3300031995 Ga0307409_100722594 Ga0307409_1007225942 105
474 3300031995 Ga0307409_101178673 Ga0307409_1011786732 105
475 3300031995 Ga0307409_101626096 Ga0307409_1016260962 105
476 3300031995 Ga0307409_102612802 Ga0307409_1026128022 105
477 3300032002 Ga0307416_100001374 Ga0307416_1000013744 105
478 3300032002 Ga0307416_100045974 Ga0307416_1000459743 105
479 3300032002 Ga0307416_100194563 Ga0307416_1001945634 105
480 3300032002 Ga0307416_100219520 Ga0307416_1002195202 105
481 3300032002 Ga0307416_100344585 Ga0307416_1003445852 105
482 3300032002 Ga0307416_100646770 Ga0307416_1006467702 105
483 3300032002 Ga0307416_100675996 Ga0307416_1006759963 105
484 3300032002 Ga0307416_100859835 Ga0307416_1008598352 105
485 3300032002 Ga0307416_100869152 Ga0307416_1008691521 105
486 3300032002 Ga0307416_101090166 Ga0307416_1010901661 105
487 3300032002 Ga0307416_101540252 Ga0307416_1015402521 105
488 3300032002 Ga0307416_101913201 Ga0307416_1019132012 105
489 3300032002 Ga0307416_102311727 Ga0307416_1023117272 105
490 3300032004 Ga0307414_10004020 Ga0307414_100040202 105
491 3300032004 Ga0307414_10006097 Ga0307414_100060977 105
492 3300032004 Ga0307414_10019404 Ga0307414_100194045 105
493 3300032004 Ga0307414_10328168 Ga0307414_103281682 105
494 3300032004 Ga0307414_10519541 Ga0307414_105195412 105
495 3300032004 Ga0307414_12124560 Ga0307414_121245601 105
496 3300032005 Ga0307411_10006107 Ga0307411_100061075 105
497 3300032005 Ga0307411_10015880 Ga0307411_100158802 105
498 3300032005 Ga0307411_10033989 Ga0307411_100339892 105
499 3300032005 Ga0307411_10132289 Ga0307411_101322892 105
500 3300032005 Ga0307411_10612387 Ga0307411_106123872 105
501 3300032005 Ga0307411_10845375 Ga0307411_108453752 105
502 3300032005 Ga0307411_11063695 Ga0307411_110636952 105
503 3300032005 Ga0307411_11673406 Ga0307411_116734061 105
504 3300032005 Ga0307411_11961591 Ga0307411_119615911 105
505 3300032126 Ga0307415_100001757 Ga0307415_1000017573 105
506 3300032126 Ga0307415_100004233 Ga0307415_1000042334 105
507 3300032126 Ga0307415_100017602 Ga0307415_1000176022 105
508 3300032126 Ga0307415_100088340 Ga0307415_1000883404 105
509 3300032126 Ga0307415_100317734 Ga0307415_1003177342 105
510 3300032126 Ga0307415_100860697 Ga0307415_1008606972 105
511 3300032126 Ga0307415_100985764 Ga0307415_1009857641 105
512 3300032126 Ga0307415_101421413 Ga0307415_1014214131 105
513 3300032126 Ga0307415_101944873 Ga0307415_1019448731 105
514 3300032126 Ga0307415_102263701 Ga0307415_1022637012 105
515 3300035115 Ga0373941_0330408 Ga0373941_0330408_214_531 105
516 3300035121 Ga0373960_0053465 Ga0373960_0053465_748_1065 105
517 3300035170 Ga0373943_0901666 Ga0373943_0901666_77_394 105
518 3300035695 Ga0373927_0492188 Ga0373927_0492188_425_742 105
519 3300035725 Ga0373947_0048833 Ga0373947_0048833_1614_1931 105
520 3300037068 Ga0373925_0326833 Ga0373925_0326833_276_593 105
521 3300037312 Ga0395899_0403869 Ga0395899_0403869_273_593 105
522 3300037418 Ga0395900_0014431 Ga0395900_0014431_6553_6873 105
523 3300037418 Ga0395900_1331782 Ga0395900_1331782_85_402 105
524 3300037466 Ga0395898_0311808 Ga0395898_0311808_860_1180 105
525 3300037471 Ga0395905_0058720 Ga0395905_0058720_897_1217 105
526 3300037471 Ga0395905_0085674 Ga0395905_0085674_1755_2072 105
527 3300037471 Ga0395905_0150743 Ga0395905_0150743_675_992 105
528 3300037853 Ga0436364_0538146 Ga0436364_0538146_259_579 105
529 3300038443 Ga0395901_0017032 Ga0395901_0017032_2612_2932 105
530 3300039437 Ga0436365_0850895 Ga0436365_0850895_163_480 105
531 3300039437 Ga0436365_1844771 Ga0436365_1844771_4661_4978 105
532 3300041406 Ga0439439_0033131 Ga0439439_0033131_695_1012 105
533 3300041486 Ga0451807_1859592 Ga0451807_1859592_346_663 105
534 3300042005 Ga0439448_0214404 Ga0439448_0214404_255_572 105
535 3300042007 Ga0439449_0295991 Ga0439449_0295991_193_510 105
536 3300042015 Ga0439462_0099275 Ga0439462_0099275_91_408 105
537 3300042134 Ga0450898_106729 Ga0450898_106729_71_388 105
538 3300042435 Ga0439434_0042988 Ga0439434_0042988_715_1032 105
539 3300042435 Ga0439434_0159439 Ga0439434_0159439_358_675 105
540 3300042876 Ga0451577_0000016 Ga0451577_0000016_191826_192143 105
541 3300042876 Ga0451577_0003423 Ga0451577_0003423_3364_3681 105
542 3300042876 Ga0451577_0051202 Ga0451577_0051202_1357_1674 105
543 3300042876 Ga0451577_0059655 Ga0451577_0059655_1197_1514 105
544 3300042993 Ga0439440_0241150 Ga0439440_0241150_78_395 105
545 3300044684 Ga0466966_0647004 Ga0466966_0647004_156_473 105
546 3300044694 Ga0466963_0547068 Ga0466963_0547068_261_578 105
547 3300044712 Ga0453684_0000368 Ga0453684_0000368_107302_107619 105
548 3300044712 Ga0453684_0021439 Ga0453684_0021439_6236_6553 105
549 3300044712 Ga0453684_1532475 Ga0453684_1532475_255_572 105
550 3300044719 Ga0466971_0417250 Ga0466971_0417250_245_562 105
551 3300044765 Ga0466970_0789667 Ga0466970_0789667_178_495 105
552 3300044842 Ga0466957_0620818 Ga0466957_0620818_43_363 105
553 3300044901 Ga0466960_0326110 Ga0466960_0326110_395_712 105
554 3300044901 Ga0466960_0914535 Ga0466960_0914535_180_497 105
555 3300045051 Ga0451576_0108438 Ga0451576_0108438_113_430 105
556 3300045051 Ga0451576_1920053 Ga0451576_1920053_204_521 105
557 3300045836 Ga0466958_0113324 Ga0466958_0113324_1053_1370 105
558 3300045836 Ga0466958_0332616 Ga0466958_0332616_138_455 105
559 3300045976 Ga0466967_1248514 Ga0466967_1248514_49_369 105
560 3300046459 Ga0495629_0450646 Ga0495629_0450646_224_541 105
561 3300046460 Ga0495638_0090498 Ga0495638_0090498_560_877 105
562 3300046491 Ga0495584_0429383 Ga0495584_0429383_66_383 105
563 3300046535 Ga0495586_0226495 Ga0495586_0226495_554_871 105
564 3300046683 Ga0495658_0255284 Ga0495658_0255284_625_942 105
565 3300046691 Ga0495670_0152955 Ga0495670_0152955_315_632 105
566 3300047315 Ga0495581_0706503 Ga0495581_0706503_101_418 105
567 3300047471 Ga0495684_0626998 Ga0495684_0626998_148_465 105
568 3300048911 Ga0496108_0733952 Ga0496108_0733952_445_762 105
569 3300048912 Ga0496109_0035287 Ga0496109_0035287_1938_2255 105
570 3300048915 Ga0496112_0097418 Ga0496112_0097418_1978_2295 105
571 3300048916 Ga0496113_0411128 Ga0496113_0411128_640_957 105
572 3300048918 Ga0496115_0147084 Ga0496115_0147084_836_1153 105
573 3300049127 Ga0501306_049350 Ga0501306_049350_335_652 105
574 3300049127 Ga0501306_062587 Ga0501306_062587_223_540 105
575 3300049127 Ga0501306_083539 Ga0501306_083539_14_331 105
576 3300049128 Ga0501308_045481 Ga0501308_045481_19_336 105
577 3300049129 Ga0501309_045884 Ga0501309_045884_19_336 105
578 3300049129 Ga0501309_076740 Ga0501309_076740_214_531 105
579 3300049161 Ga0501305_053789 Ga0501305_053789_344_661 105
580 3300049161 Ga0501305_085581 Ga0501305_085581_20_337 105
581 3300049161 Ga0501305_107219 Ga0501305_107219_191_508 105
582 3300049162 Ga0501307_048006 Ga0501307_048006_294_611 105
583 3300049162 Ga0501307_073541 Ga0501307_073541_213_530 105
584 3300049521 Ga0501298_156461 Ga0501298_156461_214_531 105
585 3300049527 Ga0501311_022577 Ga0501311_022577_270_587 105
586 3300049527 Ga0501311_039956 Ga0501311_039956_374_691 105
587 3300049527 Ga0501311_071707 Ga0501311_071707_242_559 105
588 3300049527 Ga0501311_094503 Ga0501311_094503_19_336 105
589 3300049528 Ga0501312_059348 Ga0501312_059348_326_643 105
590 3300049528 Ga0501312_060263 Ga0501312_060263_318_635 105
591 3300049528 Ga0501312_100111 Ga0501312_100111_21_338 105
592 3300049531 Ga0501315_043692 Ga0501315_043692_21_338 105
593 3300049531 Ga0501315_044570 Ga0501315_044570_342_659 105
594 3300049531 Ga0501315_053100 Ga0501315_053100_15_332 105
595 3300049531 Ga0501315_098890 Ga0501315_098890_20_337 105
596 3300049532 Ga0501316_034865 Ga0501316_034865_341_658 105
597 3300049532 Ga0501316_043899 Ga0501316_043899_19_336 105
598 3300049532 Ga0501316_076530 Ga0501316_076530_180_497 105
599 3300049534 Ga0501318_043664 Ga0501318_043664_18_335 105
600 3300049537 Ga0501321_053394 Ga0501321_053394_224_541 105
601 3300049537 Ga0501321_079279 Ga0501321_079279_11_328 105
602 3300049539 Ga0501323_050108 Ga0501323_050108_293_610 105
603 3300049540 Ga0501324_024502 Ga0501324_024502_11_328 105
604 3300049541 Ga0501325_046257 Ga0501325_046257_194_526 105
605 3300049556 Ga0501340_010805 Ga0501340_010805_10_327 105
606 3300049568 Ga0501031_0211048 Ga0501031_0211048_766_1083 105
607 3300049568 Ga0501031_1031803 Ga0501031_1031803_99_416 105
608 3300049570 Ga0501033_1064523 Ga0501033_1064523_63_380 105
609 3300049572 Ga0501036_0441044 Ga0501036_0441044_33_350 105
610 3300049576 Ga0501040_0010487 Ga0501040_0010487_2804_3121 105
611 3300049585 Ga0501069_0577419 Ga0501069_0577419_294_611 105
612 3300049587 Ga0501071_1046458 Ga0501071_1046458_62_379 105
613 3300049588 Ga0501072_0589649 Ga0501072_0589649_173_490 105
614 3300049590 Ga0501074_0532383 Ga0501074_0532383_100_417 105
615 3300049590 Ga0501074_1171464 Ga0501074_1171464_158_475 105
616 3300049591 Ga0501075_1359786 Ga0501075_1359786_157_474 105
617 3300049592 Ga0501076_0810111 Ga0501076_0810111_96_413 105
618 3300049652 Ga0501202_213777 Ga0501202_213777_111_428 105
619 3300049656 Ga0501209_271436 Ga0501209_271436_72_389 105
620 3300049669 Ga0501235_155420 Ga0501235_155420_196_513 105
621 3300049672 Ga0501239_018431 Ga0501239_018431_463_780 105
622 3300049674 Ga0501242_032787 Ga0501242_032787_348_665 105
623 3300049674 Ga0501242_082764 Ga0501242_082764_72_389 105
624 3300049674 Ga0501242_086688 Ga0501242_086688_118_435 105
625 3300049675 Ga0501243_091552 Ga0501243_091552_227_544 105
626 3300049679 Ga0501249_087286 Ga0501249_087286_60_377 105
627 3300049680 Ga0501250_019078 Ga0501250_019078_341_658 105
628 3300049686 Ga0501257_178400 Ga0501257_178400_112_429 105
629 3300049689 Ga0501260_023056 Ga0501260_023056_169_486 105
630 3300049705 Ga0501225_0199298 Ga0501225_0199298_45_362 105
631 3300049705 Ga0501225_0349274 Ga0501225_0349274_130_447 105
632 3300049741 Ga0501079_0058235 Ga0501079_0058235_2529_2846 105
633 3300049741 Ga0501079_0759944 Ga0501079_0759944_114_431 105
634 3300049741 Ga0501079_1548245 Ga0501079_1548245_64_381 105
635 3300049742 Ga0501080_0526591 Ga0501080_0526591_539_856 105
636 3300049742 Ga0501080_1391630 Ga0501080_1391630_182_499 105
637 3300049743 Ga0501081_0434671 Ga0501081_0434671_344_661 105
638 3300049744 Ga0501083_0648515 Ga0501083_0648515_273_590 105
639 3300049765 Ga0501268_089851 Ga0501268_089851_202_519 105
640 3300049765 Ga0501268_154304 Ga0501268_154304_39_356 105
641 3300049768 Ga0501271_028867 Ga0501271_028867_238_555 105
642 3300049771 Ga0501274_019228 Ga0501274_019228_317_634 105
643 3300049779 Ga0501283_025389 Ga0501283_025389_547_864 105
644 3300049822 Ga0501035_0773208 Ga0501035_0773208_135_452 105
645 3300049824 Ga0501045_0349186 Ga0501045_0349186_88_405 105
646 3300049824 Ga0501045_1252635 Ga0501045_1252635_166_483 105
647 3300050507 nmdc:mga05p37_1010845_c1 nmdc:mga05p37_1010845_c1_94_411 105
648 3300050507 nmdc:mga05p37_1339780_c1 nmdc:mga05p37_1339780_c1_99_416 105
649 3300050507 nmdc:mga05p37_155008_c1 nmdc:mga05p37_155008_c1_229_546 105
650 3300050507 nmdc:mga05p37_2182248_c1 nmdc:mga05p37_2182248_c1_48_365 105
651 3300050507 nmdc:mga05p37_243241_c1 nmdc:mga05p37_243241_c1_16_333 105
652 3300050507 nmdc:mga05p37_618127_c1 nmdc:mga05p37_618127_c1_47_364 105
653 3300050508 nmdc:mga09592_1154112_c1 nmdc:mga09592_1154112_c1_313_630 105
654 3300050508 nmdc:mga09592_1368866_c1 nmdc:mga09592_1368866_c1_36_353 105
655 3300050508 nmdc:mga09592_1486150_c1 nmdc:mga09592_1486150_c1_28_345 105
656 3300050508 nmdc:mga09592_278139_c1 nmdc:mga09592_278139_c1_59_376 105
657 3300050508 nmdc:mga09592_333116_c1 nmdc:mga09592_333116_c1_733_1050 105
658 3300050508 nmdc:mga09592_378498_c1 nmdc:mga09592_378498_c1_779_1096 105
659 3300050508 nmdc:mga09592_408842_c1 nmdc:mga09592_408842_c1_470_787 105
660 3300050508 nmdc:mga09592_427372_c1 nmdc:mga09592_427372_c1_294_611 105
661 3300050508 nmdc:mga09592_81921_c1 nmdc:mga09592_81921_c1_1770_2087 105
662 3300050509 nmdc:mga0qj67_1107898_c1 nmdc:mga0qj67_1107898_c1_79_396 105
663 3300050509 nmdc:mga0qj67_113311_c1 nmdc:mga0qj67_113311_c1_727_1044 105
664 3300050509 nmdc:mga0qj67_135467_c1 nmdc:mga0qj67_135467_c1_266_583 105
665 3300050509 nmdc:mga0qj67_146257_c1 nmdc:mga0qj67_146257_c1_419_736 105
666 3300050509 nmdc:mga0qj67_16602_c1 nmdc:mga0qj67_16602_c1_1960_2277 105
667 3300050509 nmdc:mga0qj67_167202_c1 nmdc:mga0qj67_167202_c1_1194_1511 105
668 3300050509 nmdc:mga0qj67_228681_c1 nmdc:mga0qj67_228681_c1_1093_1410 105
669 3300050509 nmdc:mga0qj67_366079_c1 nmdc:mga0qj67_366079_c1_425_742 105
670 3300050509 nmdc:mga0qj67_98787_c1 nmdc:mga0qj67_98787_c1_135_452 105
671 3300050510 nmdc:mga06r32_1029249_c1 nmdc:mga06r32_1029249_c1_436_753 105
672 3300050510 nmdc:mga06r32_1122475_c1 nmdc:mga06r32_1122475_c1_288_605 105
673 3300050510 nmdc:mga06r32_274274_c1 nmdc:mga06r32_274274_c1_446_763 105
674 3300050510 nmdc:mga06r32_337699_c2 nmdc:mga06r32_337699_c2_436_753 105
675 3300050510 nmdc:mga06r32_344546_c1 nmdc:mga06r32_344546_c1_1121_1438 105
676 3300050510 nmdc:mga06r32_45043_c1 nmdc:mga06r32_45043_c1_1761_2078 105
677 3300050510 nmdc:mga06r32_45468_c1 nmdc:mga06r32_45468_c1_960_1277 105
678 3300050510 nmdc:mga06r32_514225_c1 nmdc:mga06r32_514225_c1_108_425 105
679 3300050510 nmdc:mga06r32_766039_c1 nmdc:mga06r32_766039_c1_373_690 105
680 3300050510 nmdc:mga06r32_78412_c1 nmdc:mga06r32_78412_c1_1001_1318 105
681 3300050511 nmdc:mga08y16_270272_c1 nmdc:mga08y16_270272_c1_1353_1670 105
682 3300050511 nmdc:mga08y16_281809_c1 nmdc:mga08y16_281809_c1_789_1106 105
683 3300050511 nmdc:mga08y16_349213_c1 nmdc:mga08y16_349213_c1_858_1175 105
684 3300050511 nmdc:mga08y16_37314_c1 nmdc:mga08y16_37314_c1_1574_1891 105
685 3300050511 nmdc:mga08y16_7108_c1 nmdc:mga08y16_7108_c1_4689_5006 105
686 3300050512 nmdc:mga0n895_4655_c1 nmdc:mga0n895_4655_c1_9636_9953 105
687 3300050512 nmdc:mga0n895_674464_c1 nmdc:mga0n895_674464_c1_513_830 105
688 3300050512 nmdc:mga0n895_71307_c1 nmdc:mga0n895_71307_c1_1035_1352 105
689 3300050514 nmdc:mga08x19_362816_c1 nmdc:mga08x19_362816_c1_408_725 105
690 3300050515 nmdc:mga0a205_163153_c1 nmdc:mga0a205_163153_c1_1617_1934 105
691 3300050515 nmdc:mga0a205_237574_c1 nmdc:mga0a205_237574_c1_1246_1563 105
692 3300050515 nmdc:mga0a205_81225_c1 nmdc:mga0a205_81225_c1_1047_1364 105
693 3300053735 Ga0500596_023171 Ga0500596_023171_88_405 105
694 3300054114 Ga0501084_0453819 Ga0501084_0453819_157_474 105
695 3300059421 Ga0590071_065344 Ga0590071_065344_270_587 105
696 3300059424 Ga0590075_101676 Ga0590075_101676_51_368 105
697 3300059424 Ga0590075_123137 Ga0590075_123137_204_521 105
698 3300059623 Ga0587101_113173 Ga0587101_113173_192_509 105
699 3300059642 Ga0587069_156213 Ga0587069_156213_46_363 105
700 3300060353 Ga0501082_0110816 Ga0501082_0110816_1859_2176 105
701 3300061734 Ga0530510_0351048 Ga0530510_0351048_680_997 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

6

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ane-assembly1.cif.gz_L leishmania major mitochondrial ribosome 0.8931 2 102
7p7u-assembly1.cif.gz_U e. faecalis 70s ribosome with p-trna, state iv 0.8927 3 103
7aoi-assembly1.cif.gz_AV trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.8901 2 103
8cgd-assembly1.cif.gz_q clindamycin bound to the 50s subunit 0.8864 3 103
6ys3-assembly1.cif.gz_r cryo-em structure of the 50s ribosomal subunit at 2.58 angstroms with modeled gbc secm peptide 0.8806 3 103
ID Description Score Start End Superfamily
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.92 3 101 2.40.10.190
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9029 3 101 2.40.10.190
af_Q4DUK1_23_123_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8976 3 101 2.40.50.140
af_Q54IF0_61_161_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.887 3 100 2.40.10.190
af_P0AG48_1_101_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8826 3 101 2.40.10.190
ID Description Score Start End GO Terms
AF-A0A419ECN3-F1-model_v4 Large ribosomal subunit protein bL21 0.9327 1 103 GO:0000166
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1J4RLY2-F1-model_v4 Large ribosomal subunit protein bL21 0.9265 1 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0F7GCB6-F1-model_v4 Large ribosomal subunit protein bL21 0.9238 2 103 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A522U108-F1-model_v4 Large ribosomal subunit protein bL21 0.9237 2 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A838HF75-F1-model_v4 Large ribosomal subunit protein bL21 0.9234 3 105 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.8 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map