F476183
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 325 | 701 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300049541|Ga0501325_046257|Ga0501325_046257_194_526 |
| Length | 110 |
| Sequence | MRTNQMTYAIIRTGGMQFRAEPGKTLRVPTIEGDVGASITFDEVLLGSDGTNVQTGTPLVSGAKVSGEIVRHGKGDKIIVFKFKRRKNYARKQGHRQPFTEVKINDITLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 95 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 96 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 217 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 218 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 221 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 222 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 223 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 228 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 229 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 267 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 298 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 306 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 307 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.44 |
| Metatranscriptomes | 7.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 1.71 |
| Rhizosphere | 96.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_11979178 | 3300004800 | Bacteria | 815 |
| 2 | Ga0058860_12185004 | 3300004801 | Bacteria | 587 |
| 3 | Ga0058862_12385096 | 3300004803 | Bacteria | 701 |
| 4 | Ga0065714_10290611 | 3300005288 | Bacteria | 709 |
| 5 | Ga0065712_10509946 | 3300005290 | Bacteria | 643 |
| 6 | Ga0065715_10742786 | 3300005293 | Bacteria | 634 |
| 7 | Ga0065707_10105958 | 3300005295 | Bacteria | 2621 |
| 8 | Ga0065707_10187658 | 3300005295 | Bacteria | 1379 |
| 9 | Ga0065707_10502070 | 3300005295 | Bacteria | 756 |
| 10 | Ga0070658_10185468 | 3300005327 | Bacteria | 1752 |
| 11 | Ga0070658_11061393 | 3300005327 | Bacteria | 705 |
| 12 | Ga0070676_10000666 | 3300005328 | Bacteria | 16721 |
| 13 | Ga0070676_10441942 | 3300005328 | Bacteria | 913 |
| 14 | Ga0070683_100100136 | 3300005329 | Bacteria | 2728 |
| 15 | Ga0070683_100324044 | 3300005329 | Bacteria | 1466 |
| 16 | Ga0070683_100673603 | 3300005329 | Bacteria | 990 |
| 17 | Ga0070683_101514691 | 3300005329 | Bacteria | 645 |
| 18 | Ga0070670_100004241 | 3300005331 | Bacteria | 11994 |
| 19 | Ga0070670_100034433 | 3300005331 | Bacteria | 4358 |
| 20 | Ga0068869_100003748 | 3300005334 | Bacteria | 9353 |
| 21 | Ga0068869_100274889 | 3300005334 | Bacteria | 1353 |
| 22 | Ga0070666_10844697 | 3300005335 | Bacteria | 675 |
| 23 | Ga0070680_100116536 | 3300005336 | Bacteria | 2227 |
| 24 | Ga0070680_100504342 | 3300005336 | Bacteria | 1035 |
| 25 | Ga0070680_100670910 | 3300005336 | Bacteria | 891 |
| 26 | Ga0070680_101675901 | 3300005336 | Bacteria | 551 |
| 27 | Ga0070682_100377140 | 3300005337 | Bacteria | 1065 |
| 28 | Ga0070682_101683680 | 3300005337 | Bacteria | 550 |
| 29 | Ga0068868_100009898 | 3300005338 | Bacteria | 6884 |
| 30 | Ga0070660_100247680 | 3300005339 | Bacteria | 1452 |
| 31 | Ga0070660_100837262 | 3300005339 | Bacteria | 775 |
| 32 | Ga0070689_100775909 | 3300005340 | Bacteria | 841 |
| 33 | Ga0070687_100637913 | 3300005343 | Bacteria | 737 |
| 34 | Ga0070661_100007955 | 3300005344 | Bacteria | 7323 |
| 35 | Ga0070661_100024757 | 3300005344 | Bacteria | 4307 |
| 36 | Ga0070661_100220389 | 3300005344 | Bacteria | 1455 |
| 37 | Ga0070661_101437120 | 3300005344 | Bacteria | 581 |
| 38 | Ga0070692_10031795 | 3300005345 | Bacteria | 2648 |
| 39 | Ga0070692_10862983 | 3300005345 | Bacteria | 623 |
| 40 | Ga0070668_100000088 | 3300005347 | Bacteria | 57110 |
| 41 | Ga0070668_100041916 | 3300005347 | Bacteria | 3508 |
| 42 | Ga0070669_100009001 | 3300005353 | Bacteria | 7123 |
| 43 | Ga0070669_100047960 | 3300005353 | Bacteria | 3117 |
| 44 | Ga0070675_100000328 | 3300005354 | Bacteria | 32107 |
| 45 | Ga0070675_100002241 | 3300005354 | Bacteria | 14347 |
| 46 | Ga0070675_100027429 | 3300005354 | Bacteria | 4575 |
| 47 | Ga0070675_100519902 | 3300005354 | Bacteria | 1074 |
| 48 | Ga0070671_100293752 | 3300005355 | Bacteria | 1383 |
| 49 | Ga0070671_101348664 | 3300005355 | Bacteria | 629 |
| 50 | Ga0070674_100018717 | 3300005356 | Bacteria | 4386 |
| 51 | Ga0070674_100273136 | 3300005356 | Bacteria | 1337 |
| 52 | Ga0070674_100335802 | 3300005356 | Bacteria | 1216 |
| 53 | Ga0070673_100060549 | 3300005364 | Bacteria | 3000 |
| 54 | Ga0070673_100535481 | 3300005364 | Bacteria | 1062 |
| 55 | Ga0070688_100560433 | 3300005365 | Bacteria | 870 |
| 56 | Ga0070659_100036048 | 3300005366 | Bacteria | 3854 |
| 57 | Ga0070659_100597009 | 3300005366 | Bacteria | 948 |
| 58 | Ga0070659_100841104 | 3300005366 | Bacteria | 800 |
| 59 | Ga0070667_100369803 | 3300005367 | Bacteria | 1300 |
| 60 | Ga0070714_100015926 | 3300005435 | Bacteria | 6062 |
| 61 | Ga0070713_101857413 | 3300005436 | Bacteria | 585 |
| 62 | Ga0070701_10041132 | 3300005438 | Bacteria | 2354 |
| 63 | Ga0070711_100327879 | 3300005439 | Bacteria | 1225 |
| 64 | Ga0070711_101776120 | 3300005439 | Bacteria | 541 |
| 65 | Ga0070700_100132825 | 3300005441 | Bacteria | 1682 |
| 66 | Ga0070700_100310967 | 3300005441 | Bacteria | 1154 |
| 67 | Ga0070700_100372416 | 3300005441 | Bacteria | 1065 |
| 68 | Ga0070694_100287012 | 3300005444 | Bacteria | 1256 |
| 69 | Ga0070694_100552695 | 3300005444 | Bacteria | 922 |
| 70 | Ga0070663_100396185 | 3300005455 | Bacteria | 1128 |
| 71 | Ga0070663_100723148 | 3300005455 | Bacteria | 848 |
| 72 | Ga0070678_100918497 | 3300005456 | Bacteria | 801 |
| 73 | Ga0070681_10002847 | 3300005458 | Bacteria | 15988 |
| 74 | Ga0070681_10007035 | 3300005458 | Bacteria | 10954 |
| 75 | Ga0070681_11083830 | 3300005458 | Bacteria | 722 |
| 76 | Ga0068867_100044387 | 3300005459 | Bacteria | 3256 |
| 77 | Ga0068867_100122521 | 3300005459 | Bacteria | 2011 |
| 78 | Ga0068867_100697422 | 3300005459 | Bacteria | 895 |
| 79 | Ga0068867_100852247 | 3300005459 | Bacteria | 816 |
| 80 | Ga0070685_10751585 | 3300005466 | Bacteria | 715 |
| 81 | Ga0070698_100125314 | 3300005471 | Bacteria | 2526 |
| 82 | Ga0070698_101020200 | 3300005471 | Bacteria | 775 |
| 83 | Ga0070699_100069961 | 3300005518 | Bacteria | 3050 |
| 84 | Ga0070699_100783128 | 3300005518 | Bacteria | 873 |
| 85 | Ga0070679_100004546 | 3300005530 | Bacteria | 12806 |
| 86 | Ga0070679_100078270 | 3300005530 | Bacteria | 3295 |
| 87 | Ga0070679_100222680 | 3300005530 | Bacteria | 1847 |
| 88 | Ga0070679_100241220 | 3300005530 | Bacteria | 1765 |
| 89 | Ga0070684_100727938 | 3300005535 | Bacteria | 925 |
| 90 | Ga0070684_101138049 | 3300005535 | Bacteria | 734 |
| 91 | Ga0070684_101266194 | 3300005535 | Bacteria | 694 |
| 92 | Ga0070672_100017873 | 3300005543 | Bacteria | 5112 |
| 93 | Ga0070672_100281799 | 3300005543 | Bacteria | 1405 |
| 94 | Ga0070686_101091735 | 3300005544 | Bacteria | 659 |
| 95 | Ga0070695_100124752 | 3300005545 | Bacteria | 1767 |
| 96 | Ga0070696_101624484 | 3300005546 | Bacteria | 556 |
| 97 | Ga0070693_100751795 | 3300005547 | Bacteria | 718 |
| 98 | Ga0070665_100147926 | 3300005548 | Bacteria | 2351 |
| 99 | Ga0070665_102486293 | 3300005548 | Bacteria | 519 |
| 100 | Ga0068855_100177571 | 3300005563 | Bacteria | 2409 |
| 101 | Ga0068855_100194092 | 3300005563 | Bacteria | 2288 |
| 102 | Ga0068855_100258116 | 3300005563 | Bacteria | 1942 |
| 103 | Ga0070664_100161510 | 3300005564 | Bacteria | 1983 |
| 104 | Ga0070664_100245315 | 3300005564 | Bacteria | 1609 |
| 105 | Ga0070664_100388531 | 3300005564 | Bacteria | 1275 |
| 106 | Ga0068857_100012292 | 3300005577 | Bacteria | 7448 |
| 107 | Ga0068857_100088541 | 3300005577 | Bacteria | 2770 |
| 108 | Ga0068857_100994719 | 3300005577 | Bacteria | 807 |
| 109 | Ga0068857_101491151 | 3300005577 | Bacteria | 659 |
| 110 | Ga0068854_100236815 | 3300005578 | Bacteria | 1452 |
| 111 | Ga0068854_100444324 | 3300005578 | Bacteria | 1082 |
| 112 | Ga0068856_100391783 | 3300005614 | Bacteria | 1409 |
| 113 | Ga0070702_100343351 | 3300005615 | Bacteria | 1049 |
| 114 | Ga0068852_100030369 | 3300005616 | Bacteria | 4447 |
| 115 | Ga0068852_101086993 | 3300005616 | Bacteria | 820 |
| 116 | Ga0068859_102739279 | 3300005617 | Unclassified | 542 |
| 117 | Ga0068864_100004940 | 3300005618 | Bacteria | 10925 |
| 118 | Ga0068864_100046580 | 3300005618 | Bacteria | 3721 |
| 119 | Ga0068864_102004914 | 3300005618 | Bacteria | 585 |
| 120 | Ga0068866_10022515 | 3300005718 | Bacteria | 2917 |
| 121 | Ga0068866_10686445 | 3300005718 | Bacteria | 701 |
| 122 | Ga0068861_100011511 | 3300005719 | Bacteria | 6154 |
| 123 | Ga0068861_100044307 | 3300005719 | Bacteria | 3345 |
| 124 | Ga0068861_100447043 | 3300005719 | Bacteria | 1157 |
| 125 | Ga0068851_10188458 | 3300005834 | Bacteria | 1146 |
| 126 | Ga0068851_10444059 | 3300005834 | Bacteria | 770 |
| 127 | Ga0068870_10020296 | 3300005840 | Bacteria | 3233 |
| 128 | Ga0068870_10827334 | 3300005840 | Bacteria | 649 |
| 129 | Ga0068863_100283541 | 3300005841 | Bacteria | 1605 |
| 130 | Ga0068863_100466958 | 3300005841 | Bacteria | 1240 |
| 131 | Ga0068858_100019838 | 3300005842 | Bacteria | 6286 |
| 132 | Ga0068860_100051139 | 3300005843 | Bacteria | 3932 |
| 133 | Ga0068862_100000439 | 3300005844 | Bacteria | 45176 |
| 134 | Ga0068862_100099960 | 3300005844 | Bacteria | 2536 |
| 135 | Ga0070715_10285590 | 3300006163 | Bacteria | 877 |
| 136 | Ga0097621_100203309 | 3300006237 | Bacteria | 1720 |
| 137 | Ga0068871_100046217 | 3300006358 | Bacteria | 3506 |
| 138 | Ga0075428_100036025 | 3300006844 | Bacteria | 5452 |
| 139 | Ga0075428_100416937 | 3300006844 | Bacteria | 1439 |
| 140 | Ga0075428_100912410 | 3300006844 | Bacteria | 932 |
| 141 | Ga0075428_101513693 | 3300006844 | Bacteria | 703 |
| 142 | Ga0075428_101568469 | 3300006844 | Bacteria | 689 |
| 143 | Ga0075430_100002964 | 3300006846 | Bacteria | 14214 |
| 144 | Ga0075430_100030331 | 3300006846 | Bacteria | 4591 |
| 145 | Ga0075430_100047699 | 3300006846 | Bacteria | 3617 |
| 146 | Ga0075430_100171261 | 3300006846 | Unclassified | 1806 |
| 147 | Ga0075430_100179147 | 3300006846 | Bacteria | 1763 |
| 148 | Ga0075430_100350685 | 3300006846 | Bacteria | 1219 |
| 149 | Ga0075430_100444132 | 3300006846 | Bacteria | 1070 |
| 150 | Ga0075430_100789544 | 3300006846 | Bacteria | 782 |
| 151 | Ga0075431_100006993 | 3300006847 | Bacteria | 11219 |
| 152 | Ga0075431_100037078 | 3300006847 | Bacteria | 5023 |
| 153 | Ga0075431_100051551 | 3300006847 | Bacteria | 4243 |
| 154 | Ga0075431_100094367 | 3300006847 | Bacteria | 3088 |
| 155 | Ga0075431_100098764 | 3300006847 | Bacteria | 3014 |
| 156 | Ga0075431_100099565 | 3300006847 | Bacteria | 2999 |
| 157 | Ga0075431_100306706 | 3300006847 | Bacteria | 1603 |
| 158 | Ga0075431_100333627 | 3300006847 | Bacteria | 1527 |
| 159 | Ga0075431_100389265 | 3300006847 | Bacteria | 1397 |
| 160 | Ga0075433_10172312 | 3300006852 | Bacteria | 1926 |
| 161 | Ga0075433_11581711 | 3300006852 | Bacteria | 566 |
| 162 | Ga0075434_100008029 | 3300006871 | Bacteria | 9783 |
| 163 | Ga0075434_100118312 | 3300006871 | Bacteria | 2663 |
| 164 | Ga0075434_102138665 | 3300006871 | Bacteria | 564 |
| 165 | Ga0075429_100020126 | 3300006880 | Bacteria | 5787 |
| 166 | Ga0075429_100082655 | 3300006880 | Bacteria | 2799 |
| 167 | Ga0075429_100134757 | 3300006880 | Bacteria | 2161 |
| 168 | Ga0075429_100372749 | 3300006880 | Bacteria | 1250 |
| 169 | Ga0075429_100584425 | 3300006880 | Bacteria | 979 |
| 170 | Ga0075429_100971503 | 3300006880 | Bacteria | 743 |
| 171 | Ga0075429_101657338 | 3300006880 | Bacteria | 556 |
| 172 | Ga0068865_100041912 | 3300006881 | Bacteria | 3118 |
| 173 | Ga0068865_101233206 | 3300006881 | Bacteria | 663 |
| 174 | Ga0075436_100119156 | 3300006914 | Bacteria | 1846 |
| 175 | Ga0105251_10494005 | 3300009011 | Bacteria | 571 |
| 176 | Ga0105240_10008731 | 3300009093 | Bacteria | 14447 |
| 177 | Ga0105240_10615211 | 3300009093 | Unclassified | 1194 |
| 178 | Ga0105240_10630839 | 3300009093 | Bacteria | 1177 |
| 179 | Ga0105240_11353442 | 3300009093 | Unclassified | 749 |
| 180 | Ga0111539_10004741 | 3300009094 | Bacteria | 17756 |
| 181 | Ga0111539_10154945 | 3300009094 | Bacteria | 2681 |
| 182 | Ga0111539_10252059 | 3300009094 | Bacteria | 2055 |
| 183 | Ga0111539_10443618 | 3300009094 | Bacteria | 1511 |
| 184 | Ga0111539_12819393 | 3300009094 | Bacteria | 563 |
| 185 | Ga0111539_13071017 | 3300009094 | Bacteria | 539 |
| 186 | Ga0105245_10247062 | 3300009098 | Bacteria | 1732 |
| 187 | Ga0105245_12087009 | 3300009098 | Bacteria | 620 |
| 188 | Ga0114129_10006882 | 3300009147 | Bacteria | 16169 |
| 189 | Ga0114129_10578255 | 3300009147 | Bacteria | 1458 |
| 190 | Ga0114129_10681504 | 3300009147 | Bacteria | 1323 |
| 191 | Ga0114129_10705780 | 3300009147 | Bacteria | 1296 |
| 192 | Ga0114129_10769922 | 3300009147 | Bacteria | 1230 |
| 193 | Ga0105243_10417915 | 3300009148 | Bacteria | 1250 |
| 194 | Ga0105241_11657672 | 3300009174 | Bacteria | 620 |
| 195 | Ga0105242_10234283 | 3300009176 | Bacteria | 1647 |
| 196 | Ga0105242_11494123 | 3300009176 | Bacteria | 706 |
| 197 | Ga0105248_10053267 | 3300009177 | Bacteria | 4540 |
| 198 | Ga0105248_10106115 | 3300009177 | Bacteria | 3167 |
| 199 | Ga0105237_10625398 | 3300009545 | Bacteria | 1084 |
| 200 | Ga0105238_11252027 | 3300009551 | Bacteria | 767 |
| 201 | Ga0105249_10000083 | 3300009553 | Bacteria | 135844 |
| 202 | Ga0105249_10006364 | 3300009553 | Bacteria | 10270 |
| 203 | Ga0105239_11149910 | 3300010375 | Bacteria | 894 |
| 204 | Ga0105239_12596143 | 3300010375 | Bacteria | 591 |
| 205 | Ga0105246_12576138 | 3300011119 | Bacteria | 502 |
| 206 | Ga0157337_1015725 | 3300012483 | Bacteria | 648 |
| 207 | Ga0157323_1007640 | 3300012495 | Bacteria | 785 |
| 208 | Ga0157314_1045705 | 3300012500 | Bacteria | 544 |
| 209 | Ga0157373_10120462 | 3300013100 | Bacteria | 1844 |
| 210 | Ga0157373_10130484 | 3300013100 | Bacteria | 1767 |
| 211 | Ga0157373_10266933 | 3300013100 | Bacteria | 1211 |
| 212 | Ga0157373_11416421 | 3300013100 | Bacteria | 529 |
| 213 | Ga0157371_10008381 | 3300013102 | Bacteria | 8242 |
| 214 | Ga0157370_10007729 | 3300013104 | Bacteria | 11656 |
| 215 | Ga0157370_10062261 | 3300013104 | Bacteria | 3539 |
| 216 | Ga0157370_10606067 | 3300013104 | Bacteria | 1002 |
| 217 | Ga0157369_10070156 | 3300013105 | Bacteria | 3765 |
| 218 | Ga0157369_10697951 | 3300013105 | Bacteria | 1045 |
| 219 | Ga0157369_11334046 | 3300013105 | Unclassified | 731 |
| 220 | Ga0157369_11385673 | 3300013105 | Bacteria | 716 |
| 221 | Ga0157374_10699950 | 3300013296 | Bacteria | 1026 |
| 222 | Ga0157374_11047859 | 3300013296 | Bacteria | 835 |
| 223 | Ga0157378_10531260 | 3300013297 | Bacteria | 1179 |
| 224 | Ga0163162_10045978 | 3300013306 | Bacteria | 4375 |
| 225 | Ga0157372_10029595 | 3300013307 | Bacteria | 5982 |
| 226 | Ga0157372_11466587 | 3300013307 | Bacteria | 786 |
| 227 | Ga0157372_11721060 | 3300013307 | Unclassified | 721 |
| 228 | Ga0157372_11735926 | 3300013307 | Unclassified | 718 |
| 229 | Ga0157372_12131002 | 3300013307 | Bacteria | 644 |
| 230 | Ga0157375_10042107 | 3300013308 | Bacteria | 4417 |
| 231 | Ga0157375_10104987 | 3300013308 | Bacteria | 2915 |
| 232 | Ga0157375_10552745 | 3300013308 | Bacteria | 1313 |
| 233 | Ga0163163_10114086 | 3300014325 | Bacteria | 2732 |
| 234 | Ga0157380_10008461 | 3300014326 | Bacteria | 7349 |
| 235 | Ga0157380_10156116 | 3300014326 | Bacteria | 1978 |
| 236 | Ga0157380_11039160 | 3300014326 | Bacteria | 855 |
| 237 | Ga0157380_11625068 | 3300014326 | Bacteria | 702 |
| 238 | Ga0157377_10030937 | 3300014745 | Bacteria | 2905 |
| 239 | Ga0157377_10409003 | 3300014745 | Bacteria | 926 |
| 240 | Ga0157377_10482971 | 3300014745 | Bacteria | 862 |
| 241 | Ga0157379_10019627 | 3300014968 | Bacteria | 5971 |
| 242 | Ga0157376_11163100 | 3300014969 | Bacteria | 799 |
| 243 | Ga0182007_10171056 | 3300015262 | Bacteria | 747 |
| 244 | Ga0182007_10204021 | 3300015262 | Bacteria | 692 |
| 245 | Ga0182005_1016162 | 3300015265 | Bacteria | 2077 |
| 246 | Ga0163161_10132325 | 3300017792 | Bacteria | 1883 |
| 247 | Ga0197907_10774304 | 3300020069 | Unclassified | 759 |
| 248 | Ga0206356_10536816 | 3300020070 | Bacteria | 800 |
| 249 | Ga0206352_10030481 | 3300020078 | Bacteria | 642 |
| 250 | Ga0206352_11245330 | 3300020078 | Bacteria | 636 |
| 251 | Ga0206350_10734957 | 3300020080 | Bacteria | 886 |
| 252 | Ga0206354_10034601 | 3300020081 | Bacteria | 771 |
| 253 | Ga0206354_10488864 | 3300020081 | Bacteria | 551 |
| 254 | Ga0206353_10399243 | 3300020082 | Bacteria | 893 |
| 255 | Ga0213876_10016407 | 3300021384 | Bacteria | 3915 |
| 256 | Ga0213875_10370117 | 3300021388 | Bacteria | 682 |
| 257 | Ga0224712_10669014 | 3300022467 | Bacteria | 510 |
| 258 | Ga0207666_1013693 | 3300025271 | Bacteria | 1141 |
| 259 | Ga0207697_10009810 | 3300025315 | Bacteria | 4117 |
| 260 | Ga0207697_10171690 | 3300025315 | Bacteria | 948 |
| 261 | Ga0207656_10085403 | 3300025321 | Bacteria | 1425 |
| 262 | Ga0207656_10307138 | 3300025321 | Bacteria | 786 |
| 263 | Ga0207682_10253876 | 3300025893 | Bacteria | 819 |
| 264 | Ga0207642_10368154 | 3300025899 | Bacteria | 852 |
| 265 | Ga0207688_10033228 | 3300025901 | Bacteria | 2853 |
| 266 | Ga0207688_10581282 | 3300025901 | Bacteria | 705 |
| 267 | Ga0207647_10081279 | 3300025904 | Bacteria | 1942 |
| 268 | Ga0207645_10000813 | 3300025907 | Bacteria | 26129 |
| 269 | Ga0207645_10107170 | 3300025907 | Bacteria | 1807 |
| 270 | Ga0207643_10014953 | 3300025908 | Bacteria | 4223 |
| 271 | Ga0207643_10765288 | 3300025908 | Bacteria | 625 |
| 272 | Ga0207705_10047586 | 3300025909 | Bacteria | 3084 |
| 273 | Ga0207705_10592480 | 3300025909 | Bacteria | 862 |
| 274 | Ga0207654_10561254 | 3300025911 | Bacteria | 812 |
| 275 | Ga0207707_10025067 | 3300025912 | Bacteria | 5217 |
| 276 | Ga0207707_10077339 | 3300025912 | Bacteria | 2905 |
| 277 | Ga0207707_10418479 | 3300025912 | Bacteria | 1149 |
| 278 | Ga0207695_10048163 | 3300025913 | Bacteria | 4503 |
| 279 | Ga0207695_10143001 | 3300025913 | Bacteria | 2339 |
| 280 | Ga0207695_10223272 | 3300025913 | Bacteria | 1791 |
| 281 | Ga0207695_10603483 | 3300025913 | Bacteria | 979 |
| 282 | Ga0207695_10978990 | 3300025913 | Bacteria | 726 |
| 283 | Ga0207671_10632156 | 3300025914 | Bacteria | 853 |
| 284 | Ga0207663_10889315 | 3300025916 | Bacteria | 712 |
| 285 | Ga0207660_10366131 | 3300025917 | Bacteria | 1157 |
| 286 | Ga0207660_10605864 | 3300025917 | Bacteria | 892 |
| 287 | Ga0207660_11300898 | 3300025917 | Bacteria | 590 |
| 288 | Ga0207662_10010413 | 3300025918 | Bacteria | 5135 |
| 289 | Ga0207657_10025256 | 3300025919 | Bacteria | 5482 |
| 290 | Ga0207657_10564447 | 3300025919 | Bacteria | 889 |
| 291 | Ga0207649_10006820 | 3300025920 | Bacteria | 6205 |
| 292 | Ga0207649_10643537 | 3300025920 | Bacteria | 819 |
| 293 | Ga0207649_10757528 | 3300025920 | Bacteria | 756 |
| 294 | Ga0207652_10006003 | 3300025921 | Bacteria | 9828 |
| 295 | Ga0207652_10123696 | 3300025921 | Bacteria | 2303 |
| 296 | Ga0207652_10139989 | 3300025921 | Bacteria | 2163 |
| 297 | Ga0207681_10008207 | 3300025923 | Bacteria | 6388 |
| 298 | Ga0207681_10171369 | 3300025923 | Bacteria | 1645 |
| 299 | Ga0207650_10009391 | 3300025925 | Bacteria | 6684 |
| 300 | Ga0207650_10121511 | 3300025925 | Bacteria | 2034 |
| 301 | Ga0207659_10017789 | 3300025926 | Bacteria | 4649 |
| 302 | Ga0207659_10062230 | 3300025926 | Bacteria | 2693 |
| 303 | Ga0207659_10345034 | 3300025926 | Bacteria | 1234 |
| 304 | Ga0207687_11677649 | 3300025927 | Bacteria | 545 |
| 305 | Ga0207700_10140605 | 3300025928 | Bacteria | 1983 |
| 306 | Ga0207664_10744436 | 3300025929 | Bacteria | 881 |
| 307 | Ga0207644_10176798 | 3300025931 | Bacteria | 1670 |
| 308 | Ga0207644_10655688 | 3300025931 | Bacteria | 874 |
| 309 | Ga0207690_10142139 | 3300025932 | Bacteria | 1770 |
| 310 | Ga0207690_10294363 | 3300025932 | Bacteria | 1268 |
| 311 | Ga0207690_10438095 | 3300025932 | Bacteria | 1048 |
| 312 | Ga0207706_10000055 | 3300025933 | Bacteria | 114144 |
| 313 | Ga0207686_10259107 | 3300025934 | Bacteria | 1274 |
| 314 | Ga0207709_11551942 | 3300025935 | Bacteria | 550 |
| 315 | Ga0207669_11502260 | 3300025937 | Bacteria | 574 |
| 316 | Ga0207704_10065856 | 3300025938 | Bacteria | 2271 |
| 317 | Ga0207691_10000129 | 3300025940 | Bacteria | 69176 |
| 318 | Ga0207691_10000708 | 3300025940 | Bacteria | 33044 |
| 319 | Ga0207691_10286580 | 3300025940 | Bacteria | 1417 |
| 320 | Ga0207711_10164840 | 3300025941 | Bacteria | 2008 |
| 321 | Ga0207689_10000623 | 3300025942 | Bacteria | 33879 |
| 322 | Ga0207661_10070781 | 3300025944 | Bacteria | 2848 |
| 323 | Ga0207661_10085002 | 3300025944 | Bacteria | 2622 |
| 324 | Ga0207661_12046887 | 3300025944 | Bacteria | 518 |
| 325 | Ga0207679_10005300 | 3300025945 | Bacteria | 8090 |
| 326 | Ga0207679_10067306 | 3300025945 | Bacteria | 2687 |
| 327 | Ga0207679_10091968 | 3300025945 | Bacteria | 2349 |
| 328 | Ga0207679_10171210 | 3300025945 | Bacteria | 1788 |
| 329 | Ga0207679_10262278 | 3300025945 | Bacteria | 1474 |
| 330 | Ga0207667_10136146 | 3300025949 | Bacteria | 2529 |
| 331 | Ga0207667_10645141 | 3300025949 | Bacteria | 1065 |
| 332 | Ga0207667_10768010 | 3300025949 | Bacteria | 962 |
| 333 | Ga0207667_11044152 | 3300025949 | Unclassified | 803 |
| 334 | Ga0207651_10606391 | 3300025960 | Bacteria | 957 |
| 335 | Ga0207712_10004764 | 3300025961 | Bacteria | 8567 |
| 336 | Ga0207712_10010311 | 3300025961 | Bacteria | 5932 |
| 337 | Ga0207668_10006867 | 3300025972 | Bacteria | 6752 |
| 338 | Ga0207668_10031111 | 3300025972 | Bacteria | 3512 |
| 339 | Ga0207640_10179150 | 3300025981 | Bacteria | 1587 |
| 340 | Ga0207640_11142032 | 3300025981 | Bacteria | 691 |
| 341 | Ga0207658_10036343 | 3300025986 | Bacteria | 3531 |
| 342 | Ga0207677_10009665 | 3300026023 | Bacteria | 5431 |
| 343 | Ga0207703_10186178 | 3300026035 | Bacteria | 1835 |
| 344 | Ga0207639_10308648 | 3300026041 | Unclassified | 1401 |
| 345 | Ga0207639_11287389 | 3300026041 | Bacteria | 686 |
| 346 | Ga0207678_10469863 | 3300026067 | Bacteria | 1095 |
| 347 | Ga0207708_10006119 | 3300026075 | Bacteria | 8923 |
| 348 | Ga0207708_10040492 | 3300026075 | Bacteria | 3552 |
| 349 | Ga0207708_10136664 | 3300026075 | Bacteria | 1920 |
| 350 | Ga0207702_10373275 | 3300026078 | Bacteria | 1370 |
| 351 | Ga0207641_10373898 | 3300026088 | Bacteria | 1363 |
| 352 | Ga0207641_11677590 | 3300026088 | Bacteria | 637 |
| 353 | Ga0207648_10068620 | 3300026089 | Bacteria | 3089 |
| 354 | Ga0207648_10289950 | 3300026089 | Bacteria | 1465 |
| 355 | Ga0207676_10050921 | 3300026095 | Bacteria | 3231 |
| 356 | Ga0207676_10222073 | 3300026095 | Bacteria | 1683 |
| 357 | Ga0207676_11660565 | 3300026095 | Bacteria | 637 |
| 358 | Ga0207674_10001035 | 3300026116 | Bacteria | 36267 |
| 359 | Ga0207674_10118805 | 3300026116 | Bacteria | 2613 |
| 360 | Ga0207674_10539156 | 3300026116 | Bacteria | 1127 |
| 361 | Ga0207674_11076565 | 3300026116 | Bacteria | 773 |
| 362 | Ga0207675_100000096 | 3300026118 | Bacteria | 69990 |
| 363 | Ga0207675_100026113 | 3300026118 | Bacteria | 5436 |
| 364 | Ga0207675_100490929 | 3300026118 | Bacteria | 1221 |
| 365 | Ga0207683_10386683 | 3300026121 | Bacteria | 1286 |
| 366 | Ga0207698_10774152 | 3300026142 | Bacteria | 960 |
| 367 | Ga0207698_11277730 | 3300026142 | Bacteria | 748 |
| 368 | Ga0209995_1057867 | 3300027471 | Bacteria | 659 |
| 369 | Ga0209999_1089319 | 3300027543 | Bacteria | 597 |
| 370 | Ga0207428_10067090 | 3300027907 | Bacteria | 2825 |
| 371 | Ga0207428_10285211 | 3300027907 | Bacteria | 1225 |
| 372 | Ga0268266_10201093 | 3300028379 | Bacteria | 1823 |
| 373 | Ga0268266_11774115 | 3300028379 | Bacteria | 592 |
| 374 | Ga0268265_10005621 | 3300028380 | Bacteria | 8562 |
| 375 | Ga0268265_10033945 | 3300028380 | Bacteria | 3714 |
| 376 | Ga0268264_10039846 | 3300028381 | Bacteria | 3881 |
| 377 | Ga0265332_10051168 | 3300031238 | Bacteria | 1774 |
| 378 | Ga0265332_10069970 | 3300031238 | Bacteria | 1495 |
| 379 | Ga0265328_10298553 | 3300031239 | Bacteria | 622 |
| 380 | Ga0265327_10216607 | 3300031251 | Bacteria | 862 |
| 381 | Ga0307408_100008719 | 3300031548 | Bacteria | 6698 |
| 382 | Ga0307408_100577648 | 3300031548 | Bacteria | 995 |
| 383 | Ga0307408_100603677 | 3300031548 | Bacteria | 975 |
| 384 | Ga0307408_100800662 | 3300031548 | Bacteria | 855 |
| 385 | Ga0307408_101027248 | 3300031548 | Bacteria | 761 |
| 386 | Ga0307408_102076855 | 3300031548 | Bacteria | 547 |
| 387 | Ga0307408_102241963 | 3300031548 | Bacteria | 528 |
| 388 | Ga0265314_10018388 | 3300031711 | Bacteria | 5449 |
| 389 | Ga0307405_10003488 | 3300031731 | Bacteria | 7233 |
| 390 | Ga0307405_10015147 | 3300031731 | Bacteria | 4167 |
| 391 | Ga0307405_10021094 | 3300031731 | Bacteria | 3657 |
| 392 | Ga0307405_10191339 | 3300031731 | Bacteria | 1478 |
| 393 | Ga0307405_10204548 | 3300031731 | Bacteria | 1436 |
| 394 | Ga0307405_10298957 | 3300031731 | Bacteria | 1220 |
| 395 | Ga0307405_10398100 | 3300031731 | Bacteria | 1077 |
| 396 | Ga0307405_10510021 | 3300031731 | Bacteria | 966 |
| 397 | Ga0307405_10524649 | 3300031731 | Bacteria | 954 |
| 398 | Ga0307405_10710270 | 3300031731 | Bacteria | 833 |
| 399 | Ga0307405_10881685 | 3300031731 | Bacteria | 755 |
| 400 | Ga0307405_10892810 | 3300031731 | Bacteria | 751 |
| 401 | Ga0307405_11880934 | 3300031731 | Bacteria | 533 |
| 402 | Ga0307413_10004067 | 3300031824 | Bacteria | 6295 |
| 403 | Ga0307413_10005147 | 3300031824 | Bacteria | 5795 |
| 404 | Ga0307413_10009962 | 3300031824 | Bacteria | 4580 |
| 405 | Ga0307413_10185529 | 3300031824 | Bacteria | 1488 |
| 406 | Ga0307413_10237077 | 3300031824 | Unclassified | 1344 |
| 407 | Ga0307413_10257657 | 3300031824 | Bacteria | 1298 |
| 408 | Ga0307410_10001921 | 3300031852 | Bacteria | 9736 |
| 409 | Ga0307410_10010973 | 3300031852 | Bacteria | 5159 |
| 410 | Ga0307410_10111297 | 3300031852 | Bacteria | 1981 |
| 411 | Ga0307410_10448865 | 3300031852 | Bacteria | 1051 |
| 412 | Ga0307410_10462379 | 3300031852 | Bacteria | 1037 |
| 413 | Ga0307406_10002061 | 3300031901 | Bacteria | 10970 |
| 414 | Ga0307406_10046761 | 3300031901 | Bacteria | 2724 |
| 415 | Ga0307406_10074050 | 3300031901 | Bacteria | 2241 |
| 416 | Ga0307406_10079318 | 3300031901 | Bacteria | 2177 |
| 417 | Ga0307406_10279601 | 3300031901 | Bacteria | 1272 |
| 418 | Ga0307406_11080811 | 3300031901 | Bacteria | 692 |
| 419 | Ga0307406_11190484 | 3300031901 | Bacteria | 661 |
| 420 | Ga0307406_11595015 | 3300031901 | Bacteria | 576 |
| 421 | Ga0307406_11764845 | 3300031901 | Bacteria | 549 |
| 422 | Ga0307407_10006252 | 3300031903 | Bacteria | 5266 |
| 423 | Ga0307407_10047689 | 3300031903 | Bacteria | 2433 |
| 424 | Ga0307407_10066940 | 3300031903 | Bacteria | 2120 |
| 425 | Ga0307407_10124938 | 3300031903 | Bacteria | 1637 |
| 426 | Ga0307407_10132612 | 3300031903 | Bacteria | 1596 |
| 427 | Ga0307407_10164967 | 3300031903 | Bacteria | 1453 |
| 428 | Ga0307407_10167174 | 3300031903 | Bacteria | 1445 |
| 429 | Ga0307407_10187927 | 3300031903 | Bacteria | 1374 |
| 430 | Ga0307407_10188373 | 3300031903 | Bacteria | 1373 |
| 431 | Ga0307407_10247799 | 3300031903 | Bacteria | 1219 |
| 432 | Ga0307412_10004189 | 3300031911 | Bacteria | 8042 |
| 433 | Ga0307412_10056309 | 3300031911 | Bacteria | 2620 |
| 434 | Ga0307412_10057189 | 3300031911 | Bacteria | 2602 |
| 435 | Ga0307412_10269731 | 3300031911 | Bacteria | 1331 |
| 436 | Ga0307412_10462896 | 3300031911 | Bacteria | 1048 |
| 437 | Ga0307412_10813606 | 3300031911 | Bacteria | 812 |
| 438 | Ga0307412_11065774 | 3300031911 | Bacteria | 717 |
| 439 | Ga0307412_11551149 | 3300031911 | Bacteria | 603 |
| 440 | Ga0307412_11806072 | 3300031911 | Bacteria | 562 |
| 441 | Ga0307409_100020322 | 3300031995 | Bacteria | 4522 |
| 442 | Ga0307409_100100836 | 3300031995 | Bacteria | 2394 |
| 443 | Ga0307409_100103730 | 3300031995 | Bacteria | 2366 |
| 444 | Ga0307409_100125976 | 3300031995 | Bacteria | 2179 |
| 445 | Ga0307409_100126402 | 3300031995 | Bacteria | 2175 |
| 446 | Ga0307409_100207681 | 3300031995 | Bacteria | 1757 |
| 447 | Ga0307409_100258459 | 3300031995 | Bacteria | 1596 |
| 448 | Ga0307409_100722594 | 3300031995 | Bacteria | 997 |
| 449 | Ga0307409_101178673 | 3300031995 | Bacteria | 789 |
| 450 | Ga0307409_101626096 | 3300031995 | Bacteria | 674 |
| 451 | Ga0307409_102612802 | 3300031995 | Bacteria | 533 |
| 452 | Ga0307416_100001374 | 3300032002 | Bacteria | 13144 |
| 453 | Ga0307416_100045974 | 3300032002 | Bacteria | 3442 |
| 454 | Ga0307416_100194563 | 3300032002 | Bacteria | 1917 |
| 455 | Ga0307416_100219520 | 3300032002 | Bacteria | 1822 |
| 456 | Ga0307416_100344585 | 3300032002 | Bacteria | 1505 |
| 457 | Ga0307416_100646770 | 3300032002 | Bacteria | 1142 |
| 458 | Ga0307416_100675996 | 3300032002 | Bacteria | 1119 |
| 459 | Ga0307416_100859835 | 3300032002 | Bacteria | 1005 |
| 460 | Ga0307416_100869152 | 3300032002 | Bacteria | 1000 |
| 461 | Ga0307416_101090166 | 3300032002 | Bacteria | 903 |
| 462 | Ga0307416_101540252 | 3300032002 | Bacteria | 770 |
| 463 | Ga0307416_101913201 | 3300032002 | Bacteria | 696 |
| 464 | Ga0307416_102311727 | 3300032002 | Bacteria | 638 |
| 465 | Ga0307414_10004020 | 3300032004 | Bacteria | 7938 |
| 466 | Ga0307414_10006097 | 3300032004 | Bacteria | 6690 |
| 467 | Ga0307414_10019404 | 3300032004 | Bacteria | 4213 |
| 468 | Ga0307414_10328168 | 3300032004 | Bacteria | 1305 |
| 469 | Ga0307414_10519541 | 3300032004 | Bacteria | 1056 |
| 470 | Ga0307414_12124560 | 3300032004 | Bacteria | 524 |
| 471 | Ga0307411_10006107 | 3300032005 | Bacteria | 5991 |
| 472 | Ga0307411_10015880 | 3300032005 | Bacteria | 4244 |
| 473 | Ga0307411_10033989 | 3300032005 | Bacteria | 3168 |
| 474 | Ga0307411_10132289 | 3300032005 | Bacteria | 1825 |
| 475 | Ga0307411_10612387 | 3300032005 | Bacteria | 938 |
| 476 | Ga0307411_10845375 | 3300032005 | Bacteria | 809 |
| 477 | Ga0307411_11063695 | 3300032005 | Bacteria | 727 |
| 478 | Ga0307411_11673406 | 3300032005 | Bacteria | 588 |
| 479 | Ga0307411_11961591 | 3300032005 | Bacteria | 546 |
| 480 | Ga0307415_100001757 | 3300032126 | Bacteria | 10581 |
| 481 | Ga0307415_100004233 | 3300032126 | Bacteria | 7417 |
| 482 | Ga0307415_100017602 | 3300032126 | Bacteria | 4288 |
| 483 | Ga0307415_100088340 | 3300032126 | Bacteria | 2236 |
| 484 | Ga0307415_100317734 | 3300032126 | Bacteria | 1297 |
| 485 | Ga0307415_100860697 | 3300032126 | Bacteria | 832 |
| 486 | Ga0307415_100985764 | 3300032126 | Bacteria | 782 |
| 487 | Ga0307415_101421413 | 3300032126 | Bacteria | 661 |
| 488 | Ga0307415_101944873 | 3300032126 | Bacteria | 572 |
| 489 | Ga0307415_102263701 | 3300032126 | Bacteria | 533 |
| 490 | Ga0316593_10428655 | 3300032168 | Unclassified | 514 |
| 491 | Ga0373941_0330408 | 3300035115 | Bacteria | 615 |
| 492 | Ga0373960_0053465 | 3300035121 | Bacteria | 1205 |
| 493 | Ga0373943_0901666 | 3300035170 | Bacteria | 528 |
| 494 | Ga0373927_0492188 | 3300035695 | Bacteria | 810 |
| 495 | Ga0373947_0048833 | 3300035725 | Bacteria | 2540 |
| 496 | Ga0373925_0326833 | 3300037068 | Bacteria | 1242 |
| 497 | Ga0395899_0403869 | 3300037312 | Bacteria | 903 |
| 498 | Ga0395900_0014431 | 3300037418 | Bacteria | 8063 |
| 499 | Ga0395900_1331782 | 3300037418 | Bacteria | 632 |
| 500 | Ga0395898_0311808 | 3300037466 | Bacteria | 1501 |
| 501 | Ga0395905_0058720 | 3300037471 | Bacteria | 3597 |
| 502 | Ga0395905_0085674 | 3300037471 | Bacteria | 2952 |
| 503 | Ga0395905_0150743 | 3300037471 | Bacteria | 2188 |
| 504 | Ga0436364_0538146 | 3300037853 | Bacteria | 666 |
| 505 | Ga0395901_0017032 | 3300038443 | Bacteria | 7406 |
| 506 | Ga0436365_0850895 | 3300039437 | Bacteria | 503 |
| 507 | Ga0436365_1844771 | 3300039437 | Bacteria | 7246 |
| 508 | Ga0439439_0033131 | 3300041406 | Bacteria | 1321 |
| 509 | Ga0439461_0030902 | 3300041410 | Bacteria | 1116 |
| 510 | Ga0451795_0359709 | 3300041456 | Bacteria | 1065 |
| 511 | Ga0451795_0917223 | 3300041456 | Unclassified | 620 |
| 512 | Ga0451795_1201529 | 3300041456 | Bacteria | 518 |
| 513 | Ga0451807_0575583 | 3300041486 | Bacteria | 1210 |
| 514 | Ga0451807_1859592 | 3300041486 | Unclassified | 828 |
| 515 | Ga0451847_0137072 | 3300041503 | Bacteria | 539 |
| 516 | Ga0451849_0318348 | 3300041505 | Bacteria | 570 |
| 517 | Ga0451852_08252 | 3300041508 | Bacteria | 559 |
| 518 | Ga0451852_10316 | 3300041508 | Bacteria | 945 |
| 519 | Ga0451855_0755153 | 3300041511 | Bacteria | 632 |
| 520 | Ga0451855_0792323 | 3300041511 | Bacteria | 532 |
| 521 | Ga0439448_0214404 | 3300042005 | Bacteria | 676 |
| 522 | Ga0439449_0295991 | 3300042007 | Bacteria | 611 |
| 523 | Ga0439462_0099275 | 3300042015 | Bacteria | 802 |
| 524 | Ga0450898_106729 | 3300042134 | Bacteria | 589 |
| 525 | Ga0439446_0066878 | 3300042156 | Bacteria | 1094 |
| 526 | Ga0439434_0007176 | 3300042435 | Bacteria | 3263 |
| 527 | Ga0439434_0042988 | 3300042435 | Bacteria | 1390 |
| 528 | Ga0439434_0159439 | 3300042435 | Bacteria | 749 |
| 529 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 530 | Ga0451577_0003423 | 3300042876 | Bacteria | 17680 |
| 531 | Ga0451577_0051202 | 3300042876 | Bacteria | 3686 |
| 532 | Ga0451577_0059655 | 3300042876 | Bacteria | 3402 |
| 533 | Ga0439440_0241150 | 3300042993 | Bacteria | 548 |
| 534 | Ga0466966_0647004 | 3300044684 | Bacteria | 637 |
| 535 | Ga0466963_0547068 | 3300044694 | Bacteria | 818 |
| 536 | Ga0453684_0000368 | 3300044712 | Bacteria | 185018 |
| 537 | Ga0453684_0021439 | 3300044712 | Bacteria | 9652 |
| 538 | Ga0453684_1532475 | 3300044712 | Bacteria | 687 |
| 539 | Ga0466971_0417250 | 3300044719 | Bacteria | 656 |
| 540 | Ga0466970_0789667 | 3300044765 | Bacteria | 556 |
| 541 | Ga0466957_0620818 | 3300044842 | Bacteria | 758 |
| 542 | Ga0466960_0326110 | 3300044901 | Bacteria | 871 |
| 543 | Ga0466960_0914535 | 3300044901 | Bacteria | 536 |
| 544 | Ga0451576_0108438 | 3300045051 | Bacteria | 2889 |
| 545 | Ga0451576_1920053 | 3300045051 | Bacteria | 611 |
| 546 | Ga0466958_0113324 | 3300045836 | Bacteria | 1694 |
| 547 | Ga0466958_0332616 | 3300045836 | Bacteria | 977 |
| 548 | Ga0466967_1248514 | 3300045976 | Bacteria | 740 |
| 549 | Ga0495629_0450646 | 3300046459 | Bacteria | 871 |
| 550 | Ga0495638_0090498 | 3300046460 | Bacteria | 1844 |
| 551 | Ga0495584_0429383 | 3300046491 | Bacteria | 672 |
| 552 | Ga0495586_0226495 | 3300046535 | Bacteria | 1063 |
| 553 | Ga0495658_0255284 | 3300046683 | Bacteria | 1103 |
| 554 | Ga0495670_0152955 | 3300046691 | Bacteria | 1210 |
| 555 | Ga0495581_0706503 | 3300047315 | Bacteria | 581 |
| 556 | Ga0495684_0626998 | 3300047471 | Bacteria | 722 |
| 557 | Ga0496108_0733952 | 3300048911 | Bacteria | 855 |
| 558 | Ga0496109_0035287 | 3300048912 | Bacteria | 4510 |
| 559 | Ga0496110_0081019 | 3300048913 | Bacteria | 2894 |
| 560 | Ga0496111_1115855 | 3300048914 | Bacteria | 562 |
| 561 | Ga0496112_0097418 | 3300048915 | Bacteria | 2912 |
| 562 | Ga0496113_0411128 | 3300048916 | Bacteria | 1087 |
| 563 | Ga0496115_0147084 | 3300048918 | Bacteria | 1945 |
| 564 | Ga0496119_0521290 | 3300048922 | Bacteria | 550 |
| 565 | Ga0496122_0007634 | 3300048925 | Bacteria | 11943 |
| 566 | Ga0496126_0316966 | 3300048929 | Bacteria | 1283 |
| 567 | Ga0501306_049350 | 3300049127 | Bacteria | 672 |
| 568 | Ga0501306_062587 | 3300049127 | Bacteria | 615 |
| 569 | Ga0501306_083539 | 3300049127 | Bacteria | 554 |
| 570 | Ga0501308_045481 | 3300049128 | Bacteria | 630 |
| 571 | Ga0501309_045884 | 3300049129 | Bacteria | 677 |
| 572 | Ga0501309_076740 | 3300049129 | Bacteria | 556 |
| 573 | Ga0501343_005378 | 3300049132 | Bacteria | 981 |
| 574 | Ga0501305_053789 | 3300049161 | Bacteria | 681 |
| 575 | Ga0501305_085581 | 3300049161 | Bacteria | 571 |
| 576 | Ga0501305_107219 | 3300049161 | Bacteria | 525 |
| 577 | Ga0501307_048006 | 3300049162 | Bacteria | 636 |
| 578 | Ga0501307_073541 | 3300049162 | Bacteria | 548 |
| 579 | Ga0501298_156461 | 3300049521 | Bacteria | 560 |
| 580 | Ga0501311_022577 | 3300049527 | Bacteria | 866 |
| 581 | Ga0501311_039956 | 3300049527 | Bacteria | 708 |
| 582 | Ga0501311_071707 | 3300049527 | Bacteria | 576 |
| 583 | Ga0501311_094503 | 3300049527 | Bacteria | 523 |
| 584 | Ga0501312_059348 | 3300049528 | Bacteria | 660 |
| 585 | Ga0501312_060263 | 3300049528 | Bacteria | 656 |
| 586 | Ga0501312_100111 | 3300049528 | Bacteria | 543 |
| 587 | Ga0501315_043692 | 3300049531 | Bacteria | 686 |
| 588 | Ga0501315_044570 | 3300049531 | Bacteria | 681 |
| 589 | Ga0501315_053100 | 3300049531 | Bacteria | 640 |
| 590 | Ga0501315_098890 | 3300049531 | Bacteria | 513 |
| 591 | Ga0501316_034865 | 3300049532 | Bacteria | 685 |
| 592 | Ga0501316_043899 | 3300049532 | Bacteria | 629 |
| 593 | Ga0501316_076530 | 3300049532 | Bacteria | 513 |
| 594 | Ga0501318_043664 | 3300049534 | Bacteria | 648 |
| 595 | Ga0501321_017999 | 3300049537 | Bacteria | 854 |
| 596 | Ga0501321_053394 | 3300049537 | Bacteria | 596 |
| 597 | Ga0501321_079279 | 3300049537 | Bacteria | 521 |
| 598 | Ga0501323_013111 | 3300049539 | Bacteria | 1021 |
| 599 | Ga0501323_050108 | 3300049539 | Bacteria | 632 |
| 600 | Ga0501324_024502 | 3300049540 | Bacteria | 633 |
| 601 | Ga0501325_046257 | 3300049541 | Bacteria | 543 |
| 602 | Ga0501330_020228 | 3300049546 | Bacteria | 532 |
| 603 | Ga0501340_010805 | 3300049556 | Bacteria | 674 |
| 604 | Ga0501031_0211048 | 3300049568 | Bacteria | 1265 |
| 605 | Ga0501031_1031803 | 3300049568 | Bacteria | 525 |
| 606 | Ga0501033_1064523 | 3300049570 | Bacteria | 539 |
| 607 | Ga0501036_0441044 | 3300049572 | Bacteria | 1085 |
| 608 | Ga0501040_0010487 | 3300049576 | Bacteria | 6061 |
| 609 | Ga0501069_0577419 | 3300049585 | Bacteria | 674 |
| 610 | Ga0501070_0913506 | 3300049586 | Bacteria | 684 |
| 611 | Ga0501071_1046458 | 3300049587 | Bacteria | 631 |
| 612 | Ga0501072_0589649 | 3300049588 | Bacteria | 877 |
| 613 | Ga0501074_0532383 | 3300049590 | Bacteria | 832 |
| 614 | Ga0501074_1171464 | 3300049590 | Bacteria | 539 |
| 615 | Ga0501075_1359786 | 3300049591 | Bacteria | 538 |
| 616 | Ga0501076_0810111 | 3300049592 | Bacteria | 773 |
| 617 | Ga0501202_213777 | 3300049652 | Bacteria | 532 |
| 618 | Ga0501209_271436 | 3300049656 | Bacteria | 532 |
| 619 | Ga0501235_155420 | 3300049669 | Bacteria | 595 |
| 620 | Ga0501239_018431 | 3300049672 | Bacteria | 839 |
| 621 | Ga0501242_032787 | 3300049674 | Bacteria | 710 |
| 622 | Ga0501242_082764 | 3300049674 | Bacteria | 517 |
| 623 | Ga0501242_086688 | 3300049674 | Bacteria | 509 |
| 624 | Ga0501243_091552 | 3300049675 | Bacteria | 604 |
| 625 | Ga0501249_087286 | 3300049679 | Bacteria | 737 |
| 626 | Ga0501250_019078 | 3300049680 | Bacteria | 874 |
| 627 | Ga0501257_178400 | 3300049686 | Bacteria | 600 |
| 628 | Ga0501260_023056 | 3300049689 | Bacteria | 684 |
| 629 | Ga0501225_0199298 | 3300049705 | Bacteria | 634 |
| 630 | Ga0501225_0349274 | 3300049705 | Bacteria | 511 |
| 631 | Ga0501079_0058235 | 3300049741 | Bacteria | 2981 |
| 632 | Ga0501079_0759944 | 3300049741 | Bacteria | 763 |
| 633 | Ga0501079_1548245 | 3300049741 | Bacteria | 521 |
| 634 | Ga0501080_0526591 | 3300049742 | Bacteria | 1054 |
| 635 | Ga0501080_1391630 | 3300049742 | Bacteria | 599 |
| 636 | Ga0501081_0434671 | 3300049743 | Bacteria | 974 |
| 637 | Ga0501083_0648515 | 3300049744 | Bacteria | 687 |
| 638 | Ga0501268_089851 | 3300049765 | Bacteria | 645 |
| 639 | Ga0501268_154304 | 3300049765 | Bacteria | 532 |
| 640 | Ga0501271_028867 | 3300049768 | Bacteria | 677 |
| 641 | Ga0501274_019228 | 3300049771 | Bacteria | 698 |
| 642 | Ga0501283_025389 | 3300049779 | Bacteria | 970 |
| 643 | Ga0501035_0773208 | 3300049822 | Bacteria | 769 |
| 644 | Ga0501045_0349186 | 3300049824 | Bacteria | 1101 |
| 645 | Ga0501045_1252635 | 3300049824 | Bacteria | 540 |
| 646 | nmdc:mga05p37_1010845_c1 | 3300050507 | Bacteria | 882 |
| 647 | nmdc:mga05p37_1339780_c1 | 3300050507 | Bacteria | 726 |
| 648 | nmdc:mga05p37_155008_c1 | 3300050507 | Bacteria | 2800 |
| 649 | nmdc:mga05p37_2182248_c1 | 3300050507 | Bacteria | 515 |
| 650 | nmdc:mga05p37_243241_c1 | 3300050507 | Bacteria | 2162 |
| 651 | nmdc:mga05p37_618127_c1 | 3300050507 | Bacteria | 1220 |
| 652 | nmdc:mga09592_1154112_c1 | 3300050508 | Bacteria | 642 |
| 653 | nmdc:mga09592_1368866_c1 | 3300050508 | Bacteria | 580 |
| 654 | nmdc:mga09592_1486150_c1 | 3300050508 | Bacteria | 552 |
| 655 | nmdc:mga09592_278139_c1 | 3300050508 | Bacteria | 1452 |
| 656 | nmdc:mga09592_333116_c1 | 3300050508 | Bacteria | 1314 |
| 657 | nmdc:mga09592_378498_c1 | 3300050508 | Bacteria | 1224 |
| 658 | nmdc:mga09592_408842_c1 | 3300050508 | Unclassified | 1173 |
| 659 | nmdc:mga09592_427372_c1 | 3300050508 | Bacteria | 1144 |
| 660 | nmdc:mga09592_81921_c1 | 3300050508 | Bacteria | 2750 |
| 661 | nmdc:mga0qj67_1107898_c1 | 3300050509 | Bacteria | 618 |
| 662 | nmdc:mga0qj67_113311_c1 | 3300050509 | Bacteria | 2190 |
| 663 | nmdc:mga0qj67_135467_c1 | 3300050509 | Bacteria | 1996 |
| 664 | nmdc:mga0qj67_146257_c1 | 3300050509 | Bacteria | 1916 |
| 665 | nmdc:mga0qj67_16602_c1 | 3300050509 | Bacteria | 5587 |
| 666 | nmdc:mga0qj67_167202_c1 | 3300050509 | Bacteria | 1786 |
| 667 | nmdc:mga0qj67_228681_c1 | 3300050509 | Bacteria | 1509 |
| 668 | nmdc:mga0qj67_366079_c1 | 3300050509 | Bacteria | 1165 |
| 669 | nmdc:mga0qj67_98787_c1 | 3300050509 | Bacteria | 2352 |
| 670 | nmdc:mga06r32_1029249_c1 | 3300050510 | Bacteria | 775 |
| 671 | nmdc:mga06r32_1122475_c1 | 3300050510 | Bacteria | 735 |
| 672 | nmdc:mga06r32_274274_c1 | 3300050510 | Bacteria | 1674 |
| 673 | nmdc:mga06r32_337699_c2 | 3300050510 | Bacteria | 875 |
| 674 | nmdc:mga06r32_344546_c1 | 3300050510 | Bacteria | 1475 |
| 675 | nmdc:mga06r32_45043_c1 | 3300050510 | Bacteria | 4204 |
| 676 | nmdc:mga06r32_45468_c1 | 3300050510 | Bacteria | 4185 |
| 677 | nmdc:mga06r32_514225_c1 | 3300050510 | Bacteria | 1173 |
| 678 | nmdc:mga06r32_766039_c1 | 3300050510 | Bacteria | 927 |
| 679 | nmdc:mga06r32_78412_c1 | 3300050510 | Bacteria | 3211 |
| 680 | nmdc:mga08y16_1952111_c1 | 3300050511 | Bacteria | 537 |
| 681 | nmdc:mga08y16_270272_c1 | 3300050511 | Bacteria | 1755 |
| 682 | nmdc:mga08y16_281809_c1 | 3300050511 | Bacteria | 1714 |
| 683 | nmdc:mga08y16_349213_c1 | 3300050511 | Bacteria | 1520 |
| 684 | nmdc:mga08y16_37314_c1 | 3300050511 | Bacteria | 5104 |
| 685 | nmdc:mga08y16_7108_c1 | 3300050511 | Bacteria | 11751 |
| 686 | nmdc:mga0n895_4655_c1 | 3300050512 | Bacteria | 11316 |
| 687 | nmdc:mga0n895_674464_c1 | 3300050512 | Bacteria | 1031 |
| 688 | nmdc:mga0n895_71307_c1 | 3300050512 | Bacteria | 3445 |
| 689 | nmdc:mga08x19_362816_c1 | 3300050514 | Bacteria | 1013 |
| 690 | nmdc:mga0a205_163153_c1 | 3300050515 | Bacteria | 2124 |
| 691 | nmdc:mga0a205_237574_c1 | 3300050515 | Bacteria | 1704 |
| 692 | nmdc:mga0a205_81225_c1 | 3300050515 | Bacteria | 3131 |
| 693 | Ga0500596_023171 | 3300053735 | Bacteria | 941 |
| 694 | Ga0501084_0453819 | 3300054114 | Bacteria | 1084 |
| 695 | Ga0590071_065344 | 3300059421 | Bacteria | 892 |
| 696 | Ga0590075_101676 | 3300059424 | Bacteria | 749 |
| 697 | Ga0590075_123137 | 3300059424 | Bacteria | 679 |
| 698 | Ga0587101_113173 | 3300059623 | Bacteria | 553 |
| 699 | Ga0587069_156213 | 3300059642 | Bacteria | 510 |
| 700 | Ga0501082_0110816 | 3300060353 | Bacteria | 2375 |
| 701 | Ga0530510_0351048 | 3300061734 | Bacteria | 1108 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0913506 | Ga0501070_0913506_104_391 | 95 |
| 2 | 3300041511 | Ga0451855_0755153 | Ga0451855_0755153_178_501 | 99 |
| 3 | 3300032168 | Ga0316593_10428655 | Ga0316593_104286552 | 103 |
| 4 | 3300041456 | Ga0451795_0359709 | Ga0451795_0359709_456_767 | 103 |
| 5 | 3300041456 | Ga0451795_0917223 | Ga0451795_0917223_57_368 | 103 |
| 6 | 3300041456 | Ga0451795_1201529 | Ga0451795_1201529_155_466 | 103 |
| 7 | 3300041508 | Ga0451852_10316 | Ga0451852_10316_70_381 | 103 |
| 8 | 3300048913 | Ga0496110_0081019 | Ga0496110_0081019_884_1195 | 103 |
| 9 | 3300048914 | Ga0496111_1115855 | Ga0496111_1115855_205_516 | 103 |
| 10 | 3300048922 | Ga0496119_0521290 | Ga0496119_0521290_139_450 | 103 |
| 11 | 3300048925 | Ga0496122_0007634 | Ga0496122_0007634_2973_3284 | 103 |
| 12 | 3300048929 | Ga0496126_0316966 | Ga0496126_0316966_362_673 | 103 |
| 13 | 3300049132 | Ga0501343_005378 | Ga0501343_005378_226_537 | 103 |
| 14 | 3300049537 | Ga0501321_017999 | Ga0501321_017999_98_409 | 103 |
| 15 | 3300049539 | Ga0501323_013111 | Ga0501323_013111_109_420 | 103 |
| 16 | 3300049546 | Ga0501330_020228 | Ga0501330_020228_52_363 | 103 |
| 17 | 3300005327 | Ga0070658_10185468 | Ga0070658_101854682 | 104 |
| 18 | 3300005328 | Ga0070676_10441942 | Ga0070676_104419422 | 104 |
| 19 | 3300005329 | Ga0070683_100100136 | Ga0070683_1001001362 | 104 |
| 20 | 3300005331 | Ga0070670_100004241 | Ga0070670_1000042415 | 104 |
| 21 | 3300005343 | Ga0070687_100637913 | Ga0070687_1006379132 | 104 |
| 22 | 3300005344 | Ga0070661_100220389 | Ga0070661_1002203893 | 104 |
| 23 | 3300005345 | Ga0070692_10862983 | Ga0070692_108629832 | 104 |
| 24 | 3300005353 | Ga0070669_100047960 | Ga0070669_1000479602 | 104 |
| 25 | 3300005354 | Ga0070675_100002241 | Ga0070675_10000224114 | 104 |
| 26 | 3300005355 | Ga0070671_100293752 | Ga0070671_1002937521 | 104 |
| 27 | 3300005356 | Ga0070674_100273136 | Ga0070674_1002731362 | 104 |
| 28 | 3300005356 | Ga0070674_100335802 | Ga0070674_1003358022 | 104 |
| 29 | 3300005364 | Ga0070673_100060549 | Ga0070673_1000605492 | 104 |
| 30 | 3300005365 | Ga0070688_100560433 | Ga0070688_1005604331 | 104 |
| 31 | 3300005456 | Ga0070678_100918497 | Ga0070678_1009184972 | 104 |
| 32 | 3300005459 | Ga0068867_100122521 | Ga0068867_1001225211 | 104 |
| 33 | 3300005543 | Ga0070672_100017873 | Ga0070672_1000178733 | 104 |
| 34 | 3300005564 | Ga0070664_100245315 | Ga0070664_1002453153 | 104 |
| 35 | 3300005616 | Ga0068852_101086993 | Ga0068852_1010869932 | 104 |
| 36 | 3300005618 | Ga0068864_100046580 | Ga0068864_1000465804 | 104 |
| 37 | 3300005718 | Ga0068866_10686445 | Ga0068866_106864452 | 104 |
| 38 | 3300005719 | Ga0068861_100447043 | Ga0068861_1004470432 | 104 |
| 39 | 3300005834 | Ga0068851_10444059 | Ga0068851_104440592 | 104 |
| 40 | 3300005840 | Ga0068870_10827334 | Ga0068870_108273342 | 104 |
| 41 | 3300005841 | Ga0068863_100466958 | Ga0068863_1004669582 | 104 |
| 42 | 3300006881 | Ga0068865_101233206 | Ga0068865_1012332062 | 104 |
| 43 | 3300009094 | Ga0111539_13071017 | Ga0111539_130710171 | 104 |
| 44 | 3300009098 | Ga0105245_12087009 | Ga0105245_120870092 | 104 |
| 45 | 3300009177 | Ga0105248_10053267 | Ga0105248_100532676 | 104 |
| 46 | 3300013100 | Ga0157373_11416421 | Ga0157373_114164212 | 104 |
| 47 | 3300013308 | Ga0157375_10552745 | Ga0157375_105527453 | 104 |
| 48 | 3300014745 | Ga0157377_10482971 | Ga0157377_104829712 | 104 |
| 49 | 3300014969 | Ga0157376_11163100 | Ga0157376_111631002 | 104 |
| 50 | 3300025315 | Ga0207697_10171690 | Ga0207697_101716902 | 104 |
| 51 | 3300025321 | Ga0207656_10307138 | Ga0207656_103071382 | 104 |
| 52 | 3300025901 | Ga0207688_10581282 | Ga0207688_105812821 | 104 |
| 53 | 3300025907 | Ga0207645_10107170 | Ga0207645_101071703 | 104 |
| 54 | 3300025908 | Ga0207643_10765288 | Ga0207643_107652882 | 104 |
| 55 | 3300025909 | Ga0207705_10592480 | Ga0207705_105924802 | 104 |
| 56 | 3300025920 | Ga0207649_10643537 | Ga0207649_106435372 | 104 |
| 57 | 3300025923 | Ga0207681_10171369 | Ga0207681_101713692 | 104 |
| 58 | 3300025925 | Ga0207650_10009391 | Ga0207650_100093917 | 104 |
| 59 | 3300025926 | Ga0207659_10017789 | Ga0207659_100177892 | 104 |
| 60 | 3300025931 | Ga0207644_10655688 | Ga0207644_106556882 | 104 |
| 61 | 3300025932 | Ga0207690_10294363 | Ga0207690_102943633 | 104 |
| 62 | 3300025937 | Ga0207669_11502260 | Ga0207669_115022601 | 104 |
| 63 | 3300025940 | Ga0207691_10000708 | Ga0207691_1000070811 | 104 |
| 64 | 3300025940 | Ga0207691_10286580 | Ga0207691_102865803 | 104 |
| 65 | 3300025941 | Ga0207711_10164840 | Ga0207711_101648402 | 104 |
| 66 | 3300025944 | Ga0207661_10085002 | Ga0207661_100850022 | 104 |
| 67 | 3300025945 | Ga0207679_10171210 | Ga0207679_101712102 | 104 |
| 68 | 3300025981 | Ga0207640_11142032 | Ga0207640_111420322 | 104 |
| 69 | 3300026088 | Ga0207641_10373898 | Ga0207641_103738984 | 104 |
| 70 | 3300026089 | Ga0207648_10068620 | Ga0207648_100686203 | 104 |
| 71 | 3300026095 | Ga0207676_10222073 | Ga0207676_102220732 | 104 |
| 72 | 3300026095 | Ga0207676_11660565 | Ga0207676_116605652 | 104 |
| 73 | 3300026118 | Ga0207675_100490929 | Ga0207675_1004909292 | 104 |
| 74 | 3300026121 | Ga0207683_10386683 | Ga0207683_103866832 | 104 |
| 75 | 3300041410 | Ga0439461_0030902 | Ga0439461_0030902_317_631 | 104 |
| 76 | 3300041486 | Ga0451807_0575583 | Ga0451807_0575583_113_427 | 104 |
| 77 | 3300041503 | Ga0451847_0137072 | Ga0451847_0137072_193_507 | 104 |
| 78 | 3300041505 | Ga0451849_0318348 | Ga0451849_0318348_194_508 | 104 |
| 79 | 3300041508 | Ga0451852_08252 | Ga0451852_08252_181_513 | 104 |
| 80 | 3300041511 | Ga0451855_0792323 | Ga0451855_0792323_72_386 | 104 |
| 81 | 3300042156 | Ga0439446_0066878 | Ga0439446_0066878_401_715 | 104 |
| 82 | 3300042435 | Ga0439434_0007176 | Ga0439434_0007176_2834_3148 | 104 |
| 83 | 3300050511 | nmdc:mga08y16_1952111_c1 | nmdc:mga08y16_1952111_c1_201_515 | 104 |
| 84 | 3300004800 | Ga0058861_11979178 | Ga0058861_119791782 | 105 |
| 85 | 3300004801 | Ga0058860_12185004 | Ga0058860_121850041 | 105 |
| 86 | 3300004803 | Ga0058862_12385096 | Ga0058862_123850962 | 105 |
| 87 | 3300005288 | Ga0065714_10290611 | Ga0065714_102906111 | 105 |
| 88 | 3300005290 | Ga0065712_10509946 | Ga0065712_105099461 | 105 |
| 89 | 3300005293 | Ga0065715_10742786 | Ga0065715_107427862 | 105 |
| 90 | 3300005295 | Ga0065707_10105958 | Ga0065707_101059581 | 105 |
| 91 | 3300005295 | Ga0065707_10187658 | Ga0065707_101876581 | 105 |
| 92 | 3300005295 | Ga0065707_10502070 | Ga0065707_105020702 | 105 |
| 93 | 3300005327 | Ga0070658_11061393 | Ga0070658_110613931 | 105 |
| 94 | 3300005328 | Ga0070676_10000666 | Ga0070676_100006666 | 105 |
| 95 | 3300005329 | Ga0070683_100324044 | Ga0070683_1003240444 | 105 |
| 96 | 3300005329 | Ga0070683_100673603 | Ga0070683_1006736031 | 105 |
| 97 | 3300005329 | Ga0070683_101514691 | Ga0070683_1015146912 | 105 |
| 98 | 3300005331 | Ga0070670_100034433 | Ga0070670_1000344334 | 105 |
| 99 | 3300005334 | Ga0068869_100003748 | Ga0068869_1000037486 | 105 |
| 100 | 3300005334 | Ga0068869_100274889 | Ga0068869_1002748892 | 105 |
| 101 | 3300005335 | Ga0070666_10844697 | Ga0070666_108446971 | 105 |
| 102 | 3300005336 | Ga0070680_100116536 | Ga0070680_1001165362 | 105 |
| 103 | 3300005336 | Ga0070680_100504342 | Ga0070680_1005043422 | 105 |
| 104 | 3300005336 | Ga0070680_100670910 | Ga0070680_1006709101 | 105 |
| 105 | 3300005336 | Ga0070680_101675901 | Ga0070680_1016759012 | 105 |
| 106 | 3300005337 | Ga0070682_100377140 | Ga0070682_1003771402 | 105 |
| 107 | 3300005337 | Ga0070682_101683680 | Ga0070682_1016836801 | 105 |
| 108 | 3300005338 | Ga0068868_100009898 | Ga0068868_10000989810 | 105 |
| 109 | 3300005339 | Ga0070660_100247680 | Ga0070660_1002476801 | 105 |
| 110 | 3300005339 | Ga0070660_100837262 | Ga0070660_1008372621 | 105 |
| 111 | 3300005340 | Ga0070689_100775909 | Ga0070689_1007759092 | 105 |
| 112 | 3300005344 | Ga0070661_100007955 | Ga0070661_1000079555 | 105 |
| 113 | 3300005344 | Ga0070661_100024757 | Ga0070661_1000247574 | 105 |
| 114 | 3300005344 | Ga0070661_101437120 | Ga0070661_1014371201 | 105 |
| 115 | 3300005345 | Ga0070692_10031795 | Ga0070692_100317951 | 105 |
| 116 | 3300005347 | Ga0070668_100000088 | Ga0070668_10000008823 | 105 |
| 117 | 3300005347 | Ga0070668_100041916 | Ga0070668_1000419162 | 105 |
| 118 | 3300005353 | Ga0070669_100009001 | Ga0070669_1000090015 | 105 |
| 119 | 3300005354 | Ga0070675_100000328 | Ga0070675_10000032822 | 105 |
| 120 | 3300005354 | Ga0070675_100027429 | Ga0070675_1000274293 | 105 |
| 121 | 3300005354 | Ga0070675_100519902 | Ga0070675_1005199022 | 105 |
| 122 | 3300005355 | Ga0070671_101348664 | Ga0070671_1013486642 | 105 |
| 123 | 3300005356 | Ga0070674_100018717 | Ga0070674_1000187175 | 105 |
| 124 | 3300005364 | Ga0070673_100535481 | Ga0070673_1005354813 | 105 |
| 125 | 3300005366 | Ga0070659_100036048 | Ga0070659_1000360484 | 105 |
| 126 | 3300005366 | Ga0070659_100597009 | Ga0070659_1005970092 | 105 |
| 127 | 3300005366 | Ga0070659_100841104 | Ga0070659_1008411041 | 105 |
| 128 | 3300005367 | Ga0070667_100369803 | Ga0070667_1003698033 | 105 |
| 129 | 3300005435 | Ga0070714_100015926 | Ga0070714_1000159267 | 105 |
| 130 | 3300005436 | Ga0070713_101857413 | Ga0070713_1018574131 | 105 |
| 131 | 3300005438 | Ga0070701_10041132 | Ga0070701_100411322 | 105 |
| 132 | 3300005439 | Ga0070711_100327879 | Ga0070711_1003278791 | 105 |
| 133 | 3300005439 | Ga0070711_101776120 | Ga0070711_1017761201 | 105 |
| 134 | 3300005441 | Ga0070700_100132825 | Ga0070700_1001328252 | 105 |
| 135 | 3300005441 | Ga0070700_100310967 | Ga0070700_1003109673 | 105 |
| 136 | 3300005441 | Ga0070700_100372416 | Ga0070700_1003724161 | 105 |
| 137 | 3300005444 | Ga0070694_100287012 | Ga0070694_1002870121 | 105 |
| 138 | 3300005444 | Ga0070694_100552695 | Ga0070694_1005526952 | 105 |
| 139 | 3300005455 | Ga0070663_100396185 | Ga0070663_1003961851 | 105 |
| 140 | 3300005455 | Ga0070663_100723148 | Ga0070663_1007231482 | 105 |
| 141 | 3300005458 | Ga0070681_10002847 | Ga0070681_100028472 | 105 |
| 142 | 3300005458 | Ga0070681_10007035 | Ga0070681_100070354 | 105 |
| 143 | 3300005458 | Ga0070681_11083830 | Ga0070681_110838302 | 105 |
| 144 | 3300005459 | Ga0068867_100044387 | Ga0068867_1000443875 | 105 |
| 145 | 3300005459 | Ga0068867_100697422 | Ga0068867_1006974222 | 105 |
| 146 | 3300005459 | Ga0068867_100852247 | Ga0068867_1008522472 | 105 |
| 147 | 3300005466 | Ga0070685_10751585 | Ga0070685_107515851 | 105 |
| 148 | 3300005471 | Ga0070698_100125314 | Ga0070698_1001253145 | 105 |
| 149 | 3300005471 | Ga0070698_101020200 | Ga0070698_1010202001 | 105 |
| 150 | 3300005518 | Ga0070699_100069961 | Ga0070699_1000699613 | 105 |
| 151 | 3300005518 | Ga0070699_100783128 | Ga0070699_1007831281 | 105 |
| 152 | 3300005530 | Ga0070679_100004546 | Ga0070679_1000045467 | 105 |
| 153 | 3300005530 | Ga0070679_100078270 | Ga0070679_1000782703 | 105 |
| 154 | 3300005530 | Ga0070679_100222680 | Ga0070679_1002226803 | 105 |
| 155 | 3300005530 | Ga0070679_100241220 | Ga0070679_1002412201 | 105 |
| 156 | 3300005535 | Ga0070684_100727938 | Ga0070684_1007279381 | 105 |
| 157 | 3300005535 | Ga0070684_101138049 | Ga0070684_1011380492 | 105 |
| 158 | 3300005535 | Ga0070684_101266194 | Ga0070684_1012661942 | 105 |
| 159 | 3300005543 | Ga0070672_100281799 | Ga0070672_1002817993 | 105 |
| 160 | 3300005544 | Ga0070686_101091735 | Ga0070686_1010917351 | 105 |
| 161 | 3300005545 | Ga0070695_100124752 | Ga0070695_1001247523 | 105 |
| 162 | 3300005546 | Ga0070696_101624484 | Ga0070696_1016244842 | 105 |
| 163 | 3300005547 | Ga0070693_100751795 | Ga0070693_1007517952 | 105 |
| 164 | 3300005548 | Ga0070665_100147926 | Ga0070665_1001479262 | 105 |
| 165 | 3300005548 | Ga0070665_102486293 | Ga0070665_1024862931 | 105 |
| 166 | 3300005563 | Ga0068855_100177571 | Ga0068855_1001775714 | 105 |
| 167 | 3300005563 | Ga0068855_100194092 | Ga0068855_1001940923 | 105 |
| 168 | 3300005563 | Ga0068855_100258116 | Ga0068855_1002581162 | 105 |
| 169 | 3300005564 | Ga0070664_100161510 | Ga0070664_1001615104 | 105 |
| 170 | 3300005564 | Ga0070664_100388531 | Ga0070664_1003885312 | 105 |
| 171 | 3300005577 | Ga0068857_100012292 | Ga0068857_1000122927 | 105 |
| 172 | 3300005577 | Ga0068857_100088541 | Ga0068857_1000885412 | 105 |
| 173 | 3300005577 | Ga0068857_100994719 | Ga0068857_1009947192 | 105 |
| 174 | 3300005577 | Ga0068857_101491151 | Ga0068857_1014911512 | 105 |
| 175 | 3300005578 | Ga0068854_100236815 | Ga0068854_1002368152 | 105 |
| 176 | 3300005578 | Ga0068854_100444324 | Ga0068854_1004443241 | 105 |
| 177 | 3300005614 | Ga0068856_100391783 | Ga0068856_1003917833 | 105 |
| 178 | 3300005615 | Ga0070702_100343351 | Ga0070702_1003433512 | 105 |
| 179 | 3300005616 | Ga0068852_100030369 | Ga0068852_1000303696 | 105 |
| 180 | 3300005617 | Ga0068859_102739279 | Ga0068859_1027392791 | 105 |
| 181 | 3300005618 | Ga0068864_100004940 | Ga0068864_1000049406 | 105 |
| 182 | 3300005618 | Ga0068864_102004914 | Ga0068864_1020049141 | 105 |
| 183 | 3300005718 | Ga0068866_10022515 | Ga0068866_100225152 | 105 |
| 184 | 3300005719 | Ga0068861_100011511 | Ga0068861_1000115112 | 105 |
| 185 | 3300005719 | Ga0068861_100044307 | Ga0068861_1000443075 | 105 |
| 186 | 3300005834 | Ga0068851_10188458 | Ga0068851_101884581 | 105 |
| 187 | 3300005840 | Ga0068870_10020296 | Ga0068870_100202961 | 105 |
| 188 | 3300005841 | Ga0068863_100283541 | Ga0068863_1002835414 | 105 |
| 189 | 3300005842 | Ga0068858_100019838 | Ga0068858_1000198388 | 105 |
| 190 | 3300005843 | Ga0068860_100051139 | Ga0068860_1000511393 | 105 |
| 191 | 3300005844 | Ga0068862_100000439 | Ga0068862_10000043939 | 105 |
| 192 | 3300005844 | Ga0068862_100099960 | Ga0068862_1000999602 | 105 |
| 193 | 3300006163 | Ga0070715_10285590 | Ga0070715_102855901 | 105 |
| 194 | 3300006237 | Ga0097621_100203309 | Ga0097621_1002033092 | 105 |
| 195 | 3300006358 | Ga0068871_100046217 | Ga0068871_1000462172 | 105 |
| 196 | 3300006844 | Ga0075428_100036025 | Ga0075428_1000360257 | 105 |
| 197 | 3300006844 | Ga0075428_100416937 | Ga0075428_1004169371 | 105 |
| 198 | 3300006844 | Ga0075428_100912410 | Ga0075428_1009124102 | 105 |
| 199 | 3300006844 | Ga0075428_101513693 | Ga0075428_1015136932 | 105 |
| 200 | 3300006844 | Ga0075428_101568469 | Ga0075428_1015684691 | 105 |
| 201 | 3300006846 | Ga0075430_100002964 | Ga0075430_10000296411 | 105 |
| 202 | 3300006846 | Ga0075430_100030331 | Ga0075430_1000303313 | 105 |
| 203 | 3300006846 | Ga0075430_100047699 | Ga0075430_1000476994 | 105 |
| 204 | 3300006846 | Ga0075430_100171261 | Ga0075430_1001712614 | 105 |
| 205 | 3300006846 | Ga0075430_100179147 | Ga0075430_1001791472 | 105 |
| 206 | 3300006846 | Ga0075430_100350685 | Ga0075430_1003506854 | 105 |
| 207 | 3300006846 | Ga0075430_100444132 | Ga0075430_1004441322 | 105 |
| 208 | 3300006846 | Ga0075430_100789544 | Ga0075430_1007895442 | 105 |
| 209 | 3300006847 | Ga0075431_100006993 | Ga0075431_1000069939 | 105 |
| 210 | 3300006847 | Ga0075431_100037078 | Ga0075431_1000370782 | 105 |
| 211 | 3300006847 | Ga0075431_100051551 | Ga0075431_1000515514 | 105 |
| 212 | 3300006847 | Ga0075431_100094367 | Ga0075431_1000943672 | 105 |
| 213 | 3300006847 | Ga0075431_100098764 | Ga0075431_1000987642 | 105 |
| 214 | 3300006847 | Ga0075431_100099565 | Ga0075431_1000995655 | 105 |
| 215 | 3300006847 | Ga0075431_100306706 | Ga0075431_1003067063 | 105 |
| 216 | 3300006847 | Ga0075431_100333627 | Ga0075431_1003336272 | 105 |
| 217 | 3300006847 | Ga0075431_100389265 | Ga0075431_1003892651 | 105 |
| 218 | 3300006852 | Ga0075433_10172312 | Ga0075433_101723124 | 105 |
| 219 | 3300006852 | Ga0075433_11581711 | Ga0075433_115817111 | 105 |
| 220 | 3300006871 | Ga0075434_100008029 | Ga0075434_1000080294 | 105 |
| 221 | 3300006871 | Ga0075434_100118312 | Ga0075434_1001183122 | 105 |
| 222 | 3300006871 | Ga0075434_102138665 | Ga0075434_1021386651 | 105 |
| 223 | 3300006880 | Ga0075429_100020126 | Ga0075429_1000201263 | 105 |
| 224 | 3300006880 | Ga0075429_100082655 | Ga0075429_1000826553 | 105 |
| 225 | 3300006880 | Ga0075429_100134757 | Ga0075429_1001347572 | 105 |
| 226 | 3300006880 | Ga0075429_100372749 | Ga0075429_1003727493 | 105 |
| 227 | 3300006880 | Ga0075429_100584425 | Ga0075429_1005844252 | 105 |
| 228 | 3300006880 | Ga0075429_100971503 | Ga0075429_1009715032 | 105 |
| 229 | 3300006880 | Ga0075429_101657338 | Ga0075429_1016573381 | 105 |
| 230 | 3300006881 | Ga0068865_100041912 | Ga0068865_1000419125 | 105 |
| 231 | 3300006914 | Ga0075436_100119156 | Ga0075436_1001191561 | 105 |
| 232 | 3300009011 | Ga0105251_10494005 | Ga0105251_104940051 | 105 |
| 233 | 3300009093 | Ga0105240_10008731 | Ga0105240_1000873115 | 105 |
| 234 | 3300009093 | Ga0105240_10615211 | Ga0105240_106152112 | 105 |
| 235 | 3300009093 | Ga0105240_10630839 | Ga0105240_106308393 | 105 |
| 236 | 3300009093 | Ga0105240_11353442 | Ga0105240_113534421 | 105 |
| 237 | 3300009094 | Ga0111539_10004741 | Ga0111539_100047415 | 105 |
| 238 | 3300009094 | Ga0111539_10154945 | Ga0111539_101549453 | 105 |
| 239 | 3300009094 | Ga0111539_10252059 | Ga0111539_102520593 | 105 |
| 240 | 3300009094 | Ga0111539_10443618 | Ga0111539_104436182 | 105 |
| 241 | 3300009094 | Ga0111539_12819393 | Ga0111539_128193931 | 105 |
| 242 | 3300009098 | Ga0105245_10247062 | Ga0105245_102470622 | 105 |
| 243 | 3300009147 | Ga0114129_10006882 | Ga0114129_100068827 | 105 |
| 244 | 3300009147 | Ga0114129_10578255 | Ga0114129_105782554 | 105 |
| 245 | 3300009147 | Ga0114129_10681504 | Ga0114129_106815042 | 105 |
| 246 | 3300009147 | Ga0114129_10705780 | Ga0114129_107057801 | 105 |
| 247 | 3300009147 | Ga0114129_10769922 | Ga0114129_107699223 | 105 |
| 248 | 3300009148 | Ga0105243_10417915 | Ga0105243_104179153 | 105 |
| 249 | 3300009174 | Ga0105241_11657672 | Ga0105241_116576721 | 105 |
| 250 | 3300009176 | Ga0105242_10234283 | Ga0105242_102342831 | 105 |
| 251 | 3300009176 | Ga0105242_11494123 | Ga0105242_114941231 | 105 |
| 252 | 3300009177 | Ga0105248_10106115 | Ga0105248_101061152 | 105 |
| 253 | 3300009545 | Ga0105237_10625398 | Ga0105237_106253982 | 105 |
| 254 | 3300009551 | Ga0105238_11252027 | Ga0105238_112520272 | 105 |
| 255 | 3300009553 | Ga0105249_10000083 | Ga0105249_100000835 | 105 |
| 256 | 3300009553 | Ga0105249_10006364 | Ga0105249_1000636414 | 105 |
| 257 | 3300010375 | Ga0105239_11149910 | Ga0105239_111499101 | 105 |
| 258 | 3300010375 | Ga0105239_12596143 | Ga0105239_125961431 | 105 |
| 259 | 3300011119 | Ga0105246_12576138 | Ga0105246_125761381 | 105 |
| 260 | 3300012483 | Ga0157337_1015725 | Ga0157337_10157251 | 105 |
| 261 | 3300012495 | Ga0157323_1007640 | Ga0157323_10076402 | 105 |
| 262 | 3300012500 | Ga0157314_1045705 | Ga0157314_10457052 | 105 |
| 263 | 3300013100 | Ga0157373_10120462 | Ga0157373_101204623 | 105 |
| 264 | 3300013100 | Ga0157373_10130484 | Ga0157373_101304842 | 105 |
| 265 | 3300013100 | Ga0157373_10266933 | Ga0157373_102669332 | 105 |
| 266 | 3300013102 | Ga0157371_10008381 | Ga0157371_100083812 | 105 |
| 267 | 3300013104 | Ga0157370_10007729 | Ga0157370_100077297 | 105 |
| 268 | 3300013104 | Ga0157370_10062261 | Ga0157370_100622611 | 105 |
| 269 | 3300013104 | Ga0157370_10606067 | Ga0157370_106060673 | 105 |
| 270 | 3300013105 | Ga0157369_10070156 | Ga0157369_100701564 | 105 |
| 271 | 3300013105 | Ga0157369_10697951 | Ga0157369_106979511 | 105 |
| 272 | 3300013105 | Ga0157369_11334046 | Ga0157369_113340461 | 105 |
| 273 | 3300013105 | Ga0157369_11385673 | Ga0157369_113856732 | 105 |
| 274 | 3300013296 | Ga0157374_10699950 | Ga0157374_106999502 | 105 |
| 275 | 3300013296 | Ga0157374_11047859 | Ga0157374_110478592 | 105 |
| 276 | 3300013297 | Ga0157378_10531260 | Ga0157378_105312603 | 105 |
| 277 | 3300013306 | Ga0163162_10045978 | Ga0163162_100459782 | 105 |
| 278 | 3300013307 | Ga0157372_10029595 | Ga0157372_100295953 | 105 |
| 279 | 3300013307 | Ga0157372_11466587 | Ga0157372_114665872 | 105 |
| 280 | 3300013307 | Ga0157372_11721060 | Ga0157372_117210602 | 105 |
| 281 | 3300013307 | Ga0157372_11735926 | Ga0157372_117359261 | 105 |
| 282 | 3300013307 | Ga0157372_12131002 | Ga0157372_121310022 | 105 |
| 283 | 3300013308 | Ga0157375_10042107 | Ga0157375_100421072 | 105 |
| 284 | 3300013308 | Ga0157375_10104987 | Ga0157375_101049872 | 105 |
| 285 | 3300014325 | Ga0163163_10114086 | Ga0163163_101140861 | 105 |
| 286 | 3300014326 | Ga0157380_10008461 | Ga0157380_100084616 | 105 |
| 287 | 3300014326 | Ga0157380_10156116 | Ga0157380_101561164 | 105 |
| 288 | 3300014326 | Ga0157380_11039160 | Ga0157380_110391602 | 105 |
| 289 | 3300014326 | Ga0157380_11625068 | Ga0157380_116250681 | 105 |
| 290 | 3300014745 | Ga0157377_10030937 | Ga0157377_100309373 | 105 |
| 291 | 3300014745 | Ga0157377_10409003 | Ga0157377_104090031 | 105 |
| 292 | 3300014968 | Ga0157379_10019627 | Ga0157379_100196278 | 105 |
| 293 | 3300015262 | Ga0182007_10171056 | Ga0182007_101710561 | 105 |
| 294 | 3300015262 | Ga0182007_10204021 | Ga0182007_102040211 | 105 |
| 295 | 3300015265 | Ga0182005_1016162 | Ga0182005_10161624 | 105 |
| 296 | 3300017792 | Ga0163161_10132325 | Ga0163161_101323252 | 105 |
| 297 | 3300020069 | Ga0197907_10774304 | Ga0197907_107743041 | 105 |
| 298 | 3300020070 | Ga0206356_10536816 | Ga0206356_105368162 | 105 |
| 299 | 3300020078 | Ga0206352_10030481 | Ga0206352_100304811 | 105 |
| 300 | 3300020078 | Ga0206352_11245330 | Ga0206352_112453302 | 105 |
| 301 | 3300020080 | Ga0206350_10734957 | Ga0206350_107349572 | 105 |
| 302 | 3300020081 | Ga0206354_10034601 | Ga0206354_100346012 | 105 |
| 303 | 3300020081 | Ga0206354_10488864 | Ga0206354_104888641 | 105 |
| 304 | 3300020082 | Ga0206353_10399243 | Ga0206353_103992431 | 105 |
| 305 | 3300021384 | Ga0213876_10016407 | Ga0213876_100164075 | 105 |
| 306 | 3300021388 | Ga0213875_10370117 | Ga0213875_103701171 | 105 |
| 307 | 3300022467 | Ga0224712_10669014 | Ga0224712_106690141 | 105 |
| 308 | 3300025271 | Ga0207666_1013693 | Ga0207666_10136931 | 105 |
| 309 | 3300025315 | Ga0207697_10009810 | Ga0207697_100098105 | 105 |
| 310 | 3300025321 | Ga0207656_10085403 | Ga0207656_100854034 | 105 |
| 311 | 3300025893 | Ga0207682_10253876 | Ga0207682_102538762 | 105 |
| 312 | 3300025899 | Ga0207642_10368154 | Ga0207642_103681542 | 105 |
| 313 | 3300025901 | Ga0207688_10033228 | Ga0207688_100332282 | 105 |
| 314 | 3300025904 | Ga0207647_10081279 | Ga0207647_100812791 | 105 |
| 315 | 3300025907 | Ga0207645_10000813 | Ga0207645_1000081314 | 105 |
| 316 | 3300025908 | Ga0207643_10014953 | Ga0207643_100149532 | 105 |
| 317 | 3300025909 | Ga0207705_10047586 | Ga0207705_100475862 | 105 |
| 318 | 3300025911 | Ga0207654_10561254 | Ga0207654_105612542 | 105 |
| 319 | 3300025912 | Ga0207707_10025067 | Ga0207707_100250674 | 105 |
| 320 | 3300025912 | Ga0207707_10077339 | Ga0207707_100773394 | 105 |
| 321 | 3300025912 | Ga0207707_10418479 | Ga0207707_104184792 | 105 |
| 322 | 3300025913 | Ga0207695_10048163 | Ga0207695_100481631 | 105 |
| 323 | 3300025913 | Ga0207695_10143001 | Ga0207695_101430011 | 105 |
| 324 | 3300025913 | Ga0207695_10223272 | Ga0207695_102232723 | 105 |
| 325 | 3300025913 | Ga0207695_10603483 | Ga0207695_106034831 | 105 |
| 326 | 3300025913 | Ga0207695_10978990 | Ga0207695_109789901 | 105 |
| 327 | 3300025914 | Ga0207671_10632156 | Ga0207671_106321562 | 105 |
| 328 | 3300025916 | Ga0207663_10889315 | Ga0207663_108893152 | 105 |
| 329 | 3300025917 | Ga0207660_10366131 | Ga0207660_103661312 | 105 |
| 330 | 3300025917 | Ga0207660_10605864 | Ga0207660_106058642 | 105 |
| 331 | 3300025917 | Ga0207660_11300898 | Ga0207660_113008982 | 105 |
| 332 | 3300025918 | Ga0207662_10010413 | Ga0207662_100104134 | 105 |
| 333 | 3300025919 | Ga0207657_10025256 | Ga0207657_100252564 | 105 |
| 334 | 3300025919 | Ga0207657_10564447 | Ga0207657_105644472 | 105 |
| 335 | 3300025920 | Ga0207649_10006820 | Ga0207649_100068205 | 105 |
| 336 | 3300025920 | Ga0207649_10757528 | Ga0207649_107575281 | 105 |
| 337 | 3300025921 | Ga0207652_10006003 | Ga0207652_100060035 | 105 |
| 338 | 3300025921 | Ga0207652_10123696 | Ga0207652_101236963 | 105 |
| 339 | 3300025921 | Ga0207652_10139989 | Ga0207652_101399891 | 105 |
| 340 | 3300025923 | Ga0207681_10008207 | Ga0207681_100082075 | 105 |
| 341 | 3300025925 | Ga0207650_10121511 | Ga0207650_101215112 | 105 |
| 342 | 3300025926 | Ga0207659_10062230 | Ga0207659_100622304 | 105 |
| 343 | 3300025926 | Ga0207659_10345034 | Ga0207659_103450342 | 105 |
| 344 | 3300025927 | Ga0207687_11677649 | Ga0207687_116776492 | 105 |
| 345 | 3300025928 | Ga0207700_10140605 | Ga0207700_101406051 | 105 |
| 346 | 3300025929 | Ga0207664_10744436 | Ga0207664_107444361 | 105 |
| 347 | 3300025931 | Ga0207644_10176798 | Ga0207644_101767981 | 105 |
| 348 | 3300025932 | Ga0207690_10142139 | Ga0207690_101421394 | 105 |
| 349 | 3300025932 | Ga0207690_10438095 | Ga0207690_104380952 | 105 |
| 350 | 3300025933 | Ga0207706_10000055 | Ga0207706_1000005535 | 105 |
| 351 | 3300025934 | Ga0207686_10259107 | Ga0207686_102591073 | 105 |
| 352 | 3300025935 | Ga0207709_11551942 | Ga0207709_115519422 | 105 |
| 353 | 3300025938 | Ga0207704_10065856 | Ga0207704_100658564 | 105 |
| 354 | 3300025940 | Ga0207691_10000129 | Ga0207691_1000012934 | 105 |
| 355 | 3300025942 | Ga0207689_10000623 | Ga0207689_100006232 | 105 |
| 356 | 3300025944 | Ga0207661_10070781 | Ga0207661_100707812 | 105 |
| 357 | 3300025944 | Ga0207661_12046887 | Ga0207661_120468871 | 105 |
| 358 | 3300025945 | Ga0207679_10005300 | Ga0207679_100053005 | 105 |
| 359 | 3300025945 | Ga0207679_10067306 | Ga0207679_100673062 | 105 |
| 360 | 3300025945 | Ga0207679_10091968 | Ga0207679_100919682 | 105 |
| 361 | 3300025945 | Ga0207679_10262278 | Ga0207679_102622782 | 105 |
| 362 | 3300025949 | Ga0207667_10136146 | Ga0207667_101361462 | 105 |
| 363 | 3300025949 | Ga0207667_10645141 | Ga0207667_106451412 | 105 |
| 364 | 3300025949 | Ga0207667_10768010 | Ga0207667_107680102 | 105 |
| 365 | 3300025949 | Ga0207667_11044152 | Ga0207667_110441521 | 105 |
| 366 | 3300025960 | Ga0207651_10606391 | Ga0207651_106063913 | 105 |
| 367 | 3300025961 | Ga0207712_10004764 | Ga0207712_100047645 | 105 |
| 368 | 3300025961 | Ga0207712_10010311 | Ga0207712_100103111 | 105 |
| 369 | 3300025972 | Ga0207668_10006867 | Ga0207668_100068672 | 105 |
| 370 | 3300025972 | Ga0207668_10031111 | Ga0207668_100311112 | 105 |
| 371 | 3300025981 | Ga0207640_10179150 | Ga0207640_101791503 | 105 |
| 372 | 3300025986 | Ga0207658_10036343 | Ga0207658_100363432 | 105 |
| 373 | 3300026023 | Ga0207677_10009665 | Ga0207677_100096651 | 105 |
| 374 | 3300026035 | Ga0207703_10186178 | Ga0207703_101861783 | 105 |
| 375 | 3300026041 | Ga0207639_10308648 | Ga0207639_103086481 | 105 |
| 376 | 3300026041 | Ga0207639_11287389 | Ga0207639_112873891 | 105 |
| 377 | 3300026067 | Ga0207678_10469863 | Ga0207678_104698632 | 105 |
| 378 | 3300026075 | Ga0207708_10006119 | Ga0207708_100061195 | 105 |
| 379 | 3300026075 | Ga0207708_10040492 | Ga0207708_100404922 | 105 |
| 380 | 3300026075 | Ga0207708_10136664 | Ga0207708_101366642 | 105 |
| 381 | 3300026078 | Ga0207702_10373275 | Ga0207702_103732752 | 105 |
| 382 | 3300026088 | Ga0207641_11677590 | Ga0207641_116775902 | 105 |
| 383 | 3300026089 | Ga0207648_10289950 | Ga0207648_102899502 | 105 |
| 384 | 3300026095 | Ga0207676_10050921 | Ga0207676_100509212 | 105 |
| 385 | 3300026116 | Ga0207674_10001035 | Ga0207674_100010351 | 105 |
| 386 | 3300026116 | Ga0207674_10118805 | Ga0207674_101188052 | 105 |
| 387 | 3300026116 | Ga0207674_10539156 | Ga0207674_105391561 | 105 |
| 388 | 3300026116 | Ga0207674_11076565 | Ga0207674_110765651 | 105 |
| 389 | 3300026118 | Ga0207675_100000096 | Ga0207675_10000009618 | 105 |
| 390 | 3300026118 | Ga0207675_100026113 | Ga0207675_1000261132 | 105 |
| 391 | 3300026142 | Ga0207698_10774152 | Ga0207698_107741522 | 105 |
| 392 | 3300026142 | Ga0207698_11277730 | Ga0207698_112777302 | 105 |
| 393 | 3300027471 | Ga0209995_1057867 | Ga0209995_10578672 | 105 |
| 394 | 3300027543 | Ga0209999_1089319 | Ga0209999_10893192 | 105 |
| 395 | 3300027907 | Ga0207428_10067090 | Ga0207428_100670905 | 105 |
| 396 | 3300027907 | Ga0207428_10285211 | Ga0207428_102852113 | 105 |
| 397 | 3300028379 | Ga0268266_10201093 | Ga0268266_102010934 | 105 |
| 398 | 3300028379 | Ga0268266_11774115 | Ga0268266_117741151 | 105 |
| 399 | 3300028380 | Ga0268265_10005621 | Ga0268265_100056215 | 105 |
| 400 | 3300028380 | Ga0268265_10033945 | Ga0268265_100339454 | 105 |
| 401 | 3300028381 | Ga0268264_10039846 | Ga0268264_100398463 | 105 |
| 402 | 3300031238 | Ga0265332_10051168 | Ga0265332_100511682 | 105 |
| 403 | 3300031238 | Ga0265332_10069970 | Ga0265332_100699701 | 105 |
| 404 | 3300031239 | Ga0265328_10298553 | Ga0265328_102985531 | 105 |
| 405 | 3300031251 | Ga0265327_10216607 | Ga0265327_102166071 | 105 |
| 406 | 3300031548 | Ga0307408_100008719 | Ga0307408_1000087194 | 105 |
| 407 | 3300031548 | Ga0307408_100577648 | Ga0307408_1005776483 | 105 |
| 408 | 3300031548 | Ga0307408_100603677 | Ga0307408_1006036773 | 105 |
| 409 | 3300031548 | Ga0307408_100800662 | Ga0307408_1008006621 | 105 |
| 410 | 3300031548 | Ga0307408_101027248 | Ga0307408_1010272482 | 105 |
| 411 | 3300031548 | Ga0307408_102076855 | Ga0307408_1020768551 | 105 |
| 412 | 3300031548 | Ga0307408_102241963 | Ga0307408_1022419632 | 105 |
| 413 | 3300031711 | Ga0265314_10018388 | Ga0265314_100183889 | 105 |
| 414 | 3300031731 | Ga0307405_10003488 | Ga0307405_100034885 | 105 |
| 415 | 3300031731 | Ga0307405_10015147 | Ga0307405_100151474 | 105 |
| 416 | 3300031731 | Ga0307405_10021094 | Ga0307405_100210942 | 105 |
| 417 | 3300031731 | Ga0307405_10191339 | Ga0307405_101913393 | 105 |
| 418 | 3300031731 | Ga0307405_10204548 | Ga0307405_102045484 | 105 |
| 419 | 3300031731 | Ga0307405_10298957 | Ga0307405_102989573 | 105 |
| 420 | 3300031731 | Ga0307405_10398100 | Ga0307405_103981002 | 105 |
| 421 | 3300031731 | Ga0307405_10510021 | Ga0307405_105100213 | 105 |
| 422 | 3300031731 | Ga0307405_10524649 | Ga0307405_105246491 | 105 |
| 423 | 3300031731 | Ga0307405_10710270 | Ga0307405_107102702 | 105 |
| 424 | 3300031731 | Ga0307405_10881685 | Ga0307405_108816852 | 105 |
| 425 | 3300031731 | Ga0307405_10892810 | Ga0307405_108928102 | 105 |
| 426 | 3300031731 | Ga0307405_11880934 | Ga0307405_118809341 | 105 |
| 427 | 3300031824 | Ga0307413_10004067 | Ga0307413_100040675 | 105 |
| 428 | 3300031824 | Ga0307413_10005147 | Ga0307413_100051473 | 105 |
| 429 | 3300031824 | Ga0307413_10009962 | Ga0307413_100099622 | 105 |
| 430 | 3300031824 | Ga0307413_10185529 | Ga0307413_101855292 | 105 |
| 431 | 3300031824 | Ga0307413_10237077 | Ga0307413_102370772 | 105 |
| 432 | 3300031824 | Ga0307413_10257657 | Ga0307413_102576572 | 105 |
| 433 | 3300031852 | Ga0307410_10001921 | Ga0307410_100019216 | 105 |
| 434 | 3300031852 | Ga0307410_10010973 | Ga0307410_100109734 | 105 |
| 435 | 3300031852 | Ga0307410_10111297 | Ga0307410_101112972 | 105 |
| 436 | 3300031852 | Ga0307410_10448865 | Ga0307410_104488652 | 105 |
| 437 | 3300031852 | Ga0307410_10462379 | Ga0307410_104623792 | 105 |
| 438 | 3300031901 | Ga0307406_10002061 | Ga0307406_100020616 | 105 |
| 439 | 3300031901 | Ga0307406_10046761 | Ga0307406_100467612 | 105 |
| 440 | 3300031901 | Ga0307406_10074050 | Ga0307406_100740503 | 105 |
| 441 | 3300031901 | Ga0307406_10079318 | Ga0307406_100793182 | 105 |
| 442 | 3300031901 | Ga0307406_10279601 | Ga0307406_102796012 | 105 |
| 443 | 3300031901 | Ga0307406_11080811 | Ga0307406_110808111 | 105 |
| 444 | 3300031901 | Ga0307406_11190484 | Ga0307406_111904841 | 105 |
| 445 | 3300031901 | Ga0307406_11595015 | Ga0307406_115950151 | 105 |
| 446 | 3300031901 | Ga0307406_11764845 | Ga0307406_117648452 | 105 |
| 447 | 3300031903 | Ga0307407_10006252 | Ga0307407_100062523 | 105 |
| 448 | 3300031903 | Ga0307407_10047689 | Ga0307407_100476892 | 105 |
| 449 | 3300031903 | Ga0307407_10066940 | Ga0307407_100669402 | 105 |
| 450 | 3300031903 | Ga0307407_10124938 | Ga0307407_101249381 | 105 |
| 451 | 3300031903 | Ga0307407_10132612 | Ga0307407_101326121 | 105 |
| 452 | 3300031903 | Ga0307407_10164967 | Ga0307407_101649672 | 105 |
| 453 | 3300031903 | Ga0307407_10167174 | Ga0307407_101671741 | 105 |
| 454 | 3300031903 | Ga0307407_10187927 | Ga0307407_101879273 | 105 |
| 455 | 3300031903 | Ga0307407_10188373 | Ga0307407_101883732 | 105 |
| 456 | 3300031903 | Ga0307407_10247799 | Ga0307407_102477992 | 105 |
| 457 | 3300031911 | Ga0307412_10004189 | Ga0307412_100041896 | 105 |
| 458 | 3300031911 | Ga0307412_10056309 | Ga0307412_100563092 | 105 |
| 459 | 3300031911 | Ga0307412_10057189 | Ga0307412_100571893 | 105 |
| 460 | 3300031911 | Ga0307412_10269731 | Ga0307412_102697312 | 105 |
| 461 | 3300031911 | Ga0307412_10462896 | Ga0307412_104628962 | 105 |
| 462 | 3300031911 | Ga0307412_10813606 | Ga0307412_108136062 | 105 |
| 463 | 3300031911 | Ga0307412_11065774 | Ga0307412_110657741 | 105 |
| 464 | 3300031911 | Ga0307412_11551149 | Ga0307412_115511492 | 105 |
| 465 | 3300031911 | Ga0307412_11806072 | Ga0307412_118060721 | 105 |
| 466 | 3300031995 | Ga0307409_100020322 | Ga0307409_1000203224 | 105 |
| 467 | 3300031995 | Ga0307409_100100836 | Ga0307409_1001008362 | 105 |
| 468 | 3300031995 | Ga0307409_100103730 | Ga0307409_1001037302 | 105 |
| 469 | 3300031995 | Ga0307409_100125976 | Ga0307409_1001259762 | 105 |
| 470 | 3300031995 | Ga0307409_100126402 | Ga0307409_1001264024 | 105 |
| 471 | 3300031995 | Ga0307409_100207681 | Ga0307409_1002076812 | 105 |
| 472 | 3300031995 | Ga0307409_100258459 | Ga0307409_1002584593 | 105 |
| 473 | 3300031995 | Ga0307409_100722594 | Ga0307409_1007225942 | 105 |
| 474 | 3300031995 | Ga0307409_101178673 | Ga0307409_1011786732 | 105 |
| 475 | 3300031995 | Ga0307409_101626096 | Ga0307409_1016260962 | 105 |
| 476 | 3300031995 | Ga0307409_102612802 | Ga0307409_1026128022 | 105 |
| 477 | 3300032002 | Ga0307416_100001374 | Ga0307416_1000013744 | 105 |
| 478 | 3300032002 | Ga0307416_100045974 | Ga0307416_1000459743 | 105 |
| 479 | 3300032002 | Ga0307416_100194563 | Ga0307416_1001945634 | 105 |
| 480 | 3300032002 | Ga0307416_100219520 | Ga0307416_1002195202 | 105 |
| 481 | 3300032002 | Ga0307416_100344585 | Ga0307416_1003445852 | 105 |
| 482 | 3300032002 | Ga0307416_100646770 | Ga0307416_1006467702 | 105 |
| 483 | 3300032002 | Ga0307416_100675996 | Ga0307416_1006759963 | 105 |
| 484 | 3300032002 | Ga0307416_100859835 | Ga0307416_1008598352 | 105 |
| 485 | 3300032002 | Ga0307416_100869152 | Ga0307416_1008691521 | 105 |
| 486 | 3300032002 | Ga0307416_101090166 | Ga0307416_1010901661 | 105 |
| 487 | 3300032002 | Ga0307416_101540252 | Ga0307416_1015402521 | 105 |
| 488 | 3300032002 | Ga0307416_101913201 | Ga0307416_1019132012 | 105 |
| 489 | 3300032002 | Ga0307416_102311727 | Ga0307416_1023117272 | 105 |
| 490 | 3300032004 | Ga0307414_10004020 | Ga0307414_100040202 | 105 |
| 491 | 3300032004 | Ga0307414_10006097 | Ga0307414_100060977 | 105 |
| 492 | 3300032004 | Ga0307414_10019404 | Ga0307414_100194045 | 105 |
| 493 | 3300032004 | Ga0307414_10328168 | Ga0307414_103281682 | 105 |
| 494 | 3300032004 | Ga0307414_10519541 | Ga0307414_105195412 | 105 |
| 495 | 3300032004 | Ga0307414_12124560 | Ga0307414_121245601 | 105 |
| 496 | 3300032005 | Ga0307411_10006107 | Ga0307411_100061075 | 105 |
| 497 | 3300032005 | Ga0307411_10015880 | Ga0307411_100158802 | 105 |
| 498 | 3300032005 | Ga0307411_10033989 | Ga0307411_100339892 | 105 |
| 499 | 3300032005 | Ga0307411_10132289 | Ga0307411_101322892 | 105 |
| 500 | 3300032005 | Ga0307411_10612387 | Ga0307411_106123872 | 105 |
| 501 | 3300032005 | Ga0307411_10845375 | Ga0307411_108453752 | 105 |
| 502 | 3300032005 | Ga0307411_11063695 | Ga0307411_110636952 | 105 |
| 503 | 3300032005 | Ga0307411_11673406 | Ga0307411_116734061 | 105 |
| 504 | 3300032005 | Ga0307411_11961591 | Ga0307411_119615911 | 105 |
| 505 | 3300032126 | Ga0307415_100001757 | Ga0307415_1000017573 | 105 |
| 506 | 3300032126 | Ga0307415_100004233 | Ga0307415_1000042334 | 105 |
| 507 | 3300032126 | Ga0307415_100017602 | Ga0307415_1000176022 | 105 |
| 508 | 3300032126 | Ga0307415_100088340 | Ga0307415_1000883404 | 105 |
| 509 | 3300032126 | Ga0307415_100317734 | Ga0307415_1003177342 | 105 |
| 510 | 3300032126 | Ga0307415_100860697 | Ga0307415_1008606972 | 105 |
| 511 | 3300032126 | Ga0307415_100985764 | Ga0307415_1009857641 | 105 |
| 512 | 3300032126 | Ga0307415_101421413 | Ga0307415_1014214131 | 105 |
| 513 | 3300032126 | Ga0307415_101944873 | Ga0307415_1019448731 | 105 |
| 514 | 3300032126 | Ga0307415_102263701 | Ga0307415_1022637012 | 105 |
| 515 | 3300035115 | Ga0373941_0330408 | Ga0373941_0330408_214_531 | 105 |
| 516 | 3300035121 | Ga0373960_0053465 | Ga0373960_0053465_748_1065 | 105 |
| 517 | 3300035170 | Ga0373943_0901666 | Ga0373943_0901666_77_394 | 105 |
| 518 | 3300035695 | Ga0373927_0492188 | Ga0373927_0492188_425_742 | 105 |
| 519 | 3300035725 | Ga0373947_0048833 | Ga0373947_0048833_1614_1931 | 105 |
| 520 | 3300037068 | Ga0373925_0326833 | Ga0373925_0326833_276_593 | 105 |
| 521 | 3300037312 | Ga0395899_0403869 | Ga0395899_0403869_273_593 | 105 |
| 522 | 3300037418 | Ga0395900_0014431 | Ga0395900_0014431_6553_6873 | 105 |
| 523 | 3300037418 | Ga0395900_1331782 | Ga0395900_1331782_85_402 | 105 |
| 524 | 3300037466 | Ga0395898_0311808 | Ga0395898_0311808_860_1180 | 105 |
| 525 | 3300037471 | Ga0395905_0058720 | Ga0395905_0058720_897_1217 | 105 |
| 526 | 3300037471 | Ga0395905_0085674 | Ga0395905_0085674_1755_2072 | 105 |
| 527 | 3300037471 | Ga0395905_0150743 | Ga0395905_0150743_675_992 | 105 |
| 528 | 3300037853 | Ga0436364_0538146 | Ga0436364_0538146_259_579 | 105 |
| 529 | 3300038443 | Ga0395901_0017032 | Ga0395901_0017032_2612_2932 | 105 |
| 530 | 3300039437 | Ga0436365_0850895 | Ga0436365_0850895_163_480 | 105 |
| 531 | 3300039437 | Ga0436365_1844771 | Ga0436365_1844771_4661_4978 | 105 |
| 532 | 3300041406 | Ga0439439_0033131 | Ga0439439_0033131_695_1012 | 105 |
| 533 | 3300041486 | Ga0451807_1859592 | Ga0451807_1859592_346_663 | 105 |
| 534 | 3300042005 | Ga0439448_0214404 | Ga0439448_0214404_255_572 | 105 |
| 535 | 3300042007 | Ga0439449_0295991 | Ga0439449_0295991_193_510 | 105 |
| 536 | 3300042015 | Ga0439462_0099275 | Ga0439462_0099275_91_408 | 105 |
| 537 | 3300042134 | Ga0450898_106729 | Ga0450898_106729_71_388 | 105 |
| 538 | 3300042435 | Ga0439434_0042988 | Ga0439434_0042988_715_1032 | 105 |
| 539 | 3300042435 | Ga0439434_0159439 | Ga0439434_0159439_358_675 | 105 |
| 540 | 3300042876 | Ga0451577_0000016 | Ga0451577_0000016_191826_192143 | 105 |
| 541 | 3300042876 | Ga0451577_0003423 | Ga0451577_0003423_3364_3681 | 105 |
| 542 | 3300042876 | Ga0451577_0051202 | Ga0451577_0051202_1357_1674 | 105 |
| 543 | 3300042876 | Ga0451577_0059655 | Ga0451577_0059655_1197_1514 | 105 |
| 544 | 3300042993 | Ga0439440_0241150 | Ga0439440_0241150_78_395 | 105 |
| 545 | 3300044684 | Ga0466966_0647004 | Ga0466966_0647004_156_473 | 105 |
| 546 | 3300044694 | Ga0466963_0547068 | Ga0466963_0547068_261_578 | 105 |
| 547 | 3300044712 | Ga0453684_0000368 | Ga0453684_0000368_107302_107619 | 105 |
| 548 | 3300044712 | Ga0453684_0021439 | Ga0453684_0021439_6236_6553 | 105 |
| 549 | 3300044712 | Ga0453684_1532475 | Ga0453684_1532475_255_572 | 105 |
| 550 | 3300044719 | Ga0466971_0417250 | Ga0466971_0417250_245_562 | 105 |
| 551 | 3300044765 | Ga0466970_0789667 | Ga0466970_0789667_178_495 | 105 |
| 552 | 3300044842 | Ga0466957_0620818 | Ga0466957_0620818_43_363 | 105 |
| 553 | 3300044901 | Ga0466960_0326110 | Ga0466960_0326110_395_712 | 105 |
| 554 | 3300044901 | Ga0466960_0914535 | Ga0466960_0914535_180_497 | 105 |
| 555 | 3300045051 | Ga0451576_0108438 | Ga0451576_0108438_113_430 | 105 |
| 556 | 3300045051 | Ga0451576_1920053 | Ga0451576_1920053_204_521 | 105 |
| 557 | 3300045836 | Ga0466958_0113324 | Ga0466958_0113324_1053_1370 | 105 |
| 558 | 3300045836 | Ga0466958_0332616 | Ga0466958_0332616_138_455 | 105 |
| 559 | 3300045976 | Ga0466967_1248514 | Ga0466967_1248514_49_369 | 105 |
| 560 | 3300046459 | Ga0495629_0450646 | Ga0495629_0450646_224_541 | 105 |
| 561 | 3300046460 | Ga0495638_0090498 | Ga0495638_0090498_560_877 | 105 |
| 562 | 3300046491 | Ga0495584_0429383 | Ga0495584_0429383_66_383 | 105 |
| 563 | 3300046535 | Ga0495586_0226495 | Ga0495586_0226495_554_871 | 105 |
| 564 | 3300046683 | Ga0495658_0255284 | Ga0495658_0255284_625_942 | 105 |
| 565 | 3300046691 | Ga0495670_0152955 | Ga0495670_0152955_315_632 | 105 |
| 566 | 3300047315 | Ga0495581_0706503 | Ga0495581_0706503_101_418 | 105 |
| 567 | 3300047471 | Ga0495684_0626998 | Ga0495684_0626998_148_465 | 105 |
| 568 | 3300048911 | Ga0496108_0733952 | Ga0496108_0733952_445_762 | 105 |
| 569 | 3300048912 | Ga0496109_0035287 | Ga0496109_0035287_1938_2255 | 105 |
| 570 | 3300048915 | Ga0496112_0097418 | Ga0496112_0097418_1978_2295 | 105 |
| 571 | 3300048916 | Ga0496113_0411128 | Ga0496113_0411128_640_957 | 105 |
| 572 | 3300048918 | Ga0496115_0147084 | Ga0496115_0147084_836_1153 | 105 |
| 573 | 3300049127 | Ga0501306_049350 | Ga0501306_049350_335_652 | 105 |
| 574 | 3300049127 | Ga0501306_062587 | Ga0501306_062587_223_540 | 105 |
| 575 | 3300049127 | Ga0501306_083539 | Ga0501306_083539_14_331 | 105 |
| 576 | 3300049128 | Ga0501308_045481 | Ga0501308_045481_19_336 | 105 |
| 577 | 3300049129 | Ga0501309_045884 | Ga0501309_045884_19_336 | 105 |
| 578 | 3300049129 | Ga0501309_076740 | Ga0501309_076740_214_531 | 105 |
| 579 | 3300049161 | Ga0501305_053789 | Ga0501305_053789_344_661 | 105 |
| 580 | 3300049161 | Ga0501305_085581 | Ga0501305_085581_20_337 | 105 |
| 581 | 3300049161 | Ga0501305_107219 | Ga0501305_107219_191_508 | 105 |
| 582 | 3300049162 | Ga0501307_048006 | Ga0501307_048006_294_611 | 105 |
| 583 | 3300049162 | Ga0501307_073541 | Ga0501307_073541_213_530 | 105 |
| 584 | 3300049521 | Ga0501298_156461 | Ga0501298_156461_214_531 | 105 |
| 585 | 3300049527 | Ga0501311_022577 | Ga0501311_022577_270_587 | 105 |
| 586 | 3300049527 | Ga0501311_039956 | Ga0501311_039956_374_691 | 105 |
| 587 | 3300049527 | Ga0501311_071707 | Ga0501311_071707_242_559 | 105 |
| 588 | 3300049527 | Ga0501311_094503 | Ga0501311_094503_19_336 | 105 |
| 589 | 3300049528 | Ga0501312_059348 | Ga0501312_059348_326_643 | 105 |
| 590 | 3300049528 | Ga0501312_060263 | Ga0501312_060263_318_635 | 105 |
| 591 | 3300049528 | Ga0501312_100111 | Ga0501312_100111_21_338 | 105 |
| 592 | 3300049531 | Ga0501315_043692 | Ga0501315_043692_21_338 | 105 |
| 593 | 3300049531 | Ga0501315_044570 | Ga0501315_044570_342_659 | 105 |
| 594 | 3300049531 | Ga0501315_053100 | Ga0501315_053100_15_332 | 105 |
| 595 | 3300049531 | Ga0501315_098890 | Ga0501315_098890_20_337 | 105 |
| 596 | 3300049532 | Ga0501316_034865 | Ga0501316_034865_341_658 | 105 |
| 597 | 3300049532 | Ga0501316_043899 | Ga0501316_043899_19_336 | 105 |
| 598 | 3300049532 | Ga0501316_076530 | Ga0501316_076530_180_497 | 105 |
| 599 | 3300049534 | Ga0501318_043664 | Ga0501318_043664_18_335 | 105 |
| 600 | 3300049537 | Ga0501321_053394 | Ga0501321_053394_224_541 | 105 |
| 601 | 3300049537 | Ga0501321_079279 | Ga0501321_079279_11_328 | 105 |
| 602 | 3300049539 | Ga0501323_050108 | Ga0501323_050108_293_610 | 105 |
| 603 | 3300049540 | Ga0501324_024502 | Ga0501324_024502_11_328 | 105 |
| 604 | 3300049541 | Ga0501325_046257 | Ga0501325_046257_194_526 | 105 |
| 605 | 3300049556 | Ga0501340_010805 | Ga0501340_010805_10_327 | 105 |
| 606 | 3300049568 | Ga0501031_0211048 | Ga0501031_0211048_766_1083 | 105 |
| 607 | 3300049568 | Ga0501031_1031803 | Ga0501031_1031803_99_416 | 105 |
| 608 | 3300049570 | Ga0501033_1064523 | Ga0501033_1064523_63_380 | 105 |
| 609 | 3300049572 | Ga0501036_0441044 | Ga0501036_0441044_33_350 | 105 |
| 610 | 3300049576 | Ga0501040_0010487 | Ga0501040_0010487_2804_3121 | 105 |
| 611 | 3300049585 | Ga0501069_0577419 | Ga0501069_0577419_294_611 | 105 |
| 612 | 3300049587 | Ga0501071_1046458 | Ga0501071_1046458_62_379 | 105 |
| 613 | 3300049588 | Ga0501072_0589649 | Ga0501072_0589649_173_490 | 105 |
| 614 | 3300049590 | Ga0501074_0532383 | Ga0501074_0532383_100_417 | 105 |
| 615 | 3300049590 | Ga0501074_1171464 | Ga0501074_1171464_158_475 | 105 |
| 616 | 3300049591 | Ga0501075_1359786 | Ga0501075_1359786_157_474 | 105 |
| 617 | 3300049592 | Ga0501076_0810111 | Ga0501076_0810111_96_413 | 105 |
| 618 | 3300049652 | Ga0501202_213777 | Ga0501202_213777_111_428 | 105 |
| 619 | 3300049656 | Ga0501209_271436 | Ga0501209_271436_72_389 | 105 |
| 620 | 3300049669 | Ga0501235_155420 | Ga0501235_155420_196_513 | 105 |
| 621 | 3300049672 | Ga0501239_018431 | Ga0501239_018431_463_780 | 105 |
| 622 | 3300049674 | Ga0501242_032787 | Ga0501242_032787_348_665 | 105 |
| 623 | 3300049674 | Ga0501242_082764 | Ga0501242_082764_72_389 | 105 |
| 624 | 3300049674 | Ga0501242_086688 | Ga0501242_086688_118_435 | 105 |
| 625 | 3300049675 | Ga0501243_091552 | Ga0501243_091552_227_544 | 105 |
| 626 | 3300049679 | Ga0501249_087286 | Ga0501249_087286_60_377 | 105 |
| 627 | 3300049680 | Ga0501250_019078 | Ga0501250_019078_341_658 | 105 |
| 628 | 3300049686 | Ga0501257_178400 | Ga0501257_178400_112_429 | 105 |
| 629 | 3300049689 | Ga0501260_023056 | Ga0501260_023056_169_486 | 105 |
| 630 | 3300049705 | Ga0501225_0199298 | Ga0501225_0199298_45_362 | 105 |
| 631 | 3300049705 | Ga0501225_0349274 | Ga0501225_0349274_130_447 | 105 |
| 632 | 3300049741 | Ga0501079_0058235 | Ga0501079_0058235_2529_2846 | 105 |
| 633 | 3300049741 | Ga0501079_0759944 | Ga0501079_0759944_114_431 | 105 |
| 634 | 3300049741 | Ga0501079_1548245 | Ga0501079_1548245_64_381 | 105 |
| 635 | 3300049742 | Ga0501080_0526591 | Ga0501080_0526591_539_856 | 105 |
| 636 | 3300049742 | Ga0501080_1391630 | Ga0501080_1391630_182_499 | 105 |
| 637 | 3300049743 | Ga0501081_0434671 | Ga0501081_0434671_344_661 | 105 |
| 638 | 3300049744 | Ga0501083_0648515 | Ga0501083_0648515_273_590 | 105 |
| 639 | 3300049765 | Ga0501268_089851 | Ga0501268_089851_202_519 | 105 |
| 640 | 3300049765 | Ga0501268_154304 | Ga0501268_154304_39_356 | 105 |
| 641 | 3300049768 | Ga0501271_028867 | Ga0501271_028867_238_555 | 105 |
| 642 | 3300049771 | Ga0501274_019228 | Ga0501274_019228_317_634 | 105 |
| 643 | 3300049779 | Ga0501283_025389 | Ga0501283_025389_547_864 | 105 |
| 644 | 3300049822 | Ga0501035_0773208 | Ga0501035_0773208_135_452 | 105 |
| 645 | 3300049824 | Ga0501045_0349186 | Ga0501045_0349186_88_405 | 105 |
| 646 | 3300049824 | Ga0501045_1252635 | Ga0501045_1252635_166_483 | 105 |
| 647 | 3300050507 | nmdc:mga05p37_1010845_c1 | nmdc:mga05p37_1010845_c1_94_411 | 105 |
| 648 | 3300050507 | nmdc:mga05p37_1339780_c1 | nmdc:mga05p37_1339780_c1_99_416 | 105 |
| 649 | 3300050507 | nmdc:mga05p37_155008_c1 | nmdc:mga05p37_155008_c1_229_546 | 105 |
| 650 | 3300050507 | nmdc:mga05p37_2182248_c1 | nmdc:mga05p37_2182248_c1_48_365 | 105 |
| 651 | 3300050507 | nmdc:mga05p37_243241_c1 | nmdc:mga05p37_243241_c1_16_333 | 105 |
| 652 | 3300050507 | nmdc:mga05p37_618127_c1 | nmdc:mga05p37_618127_c1_47_364 | 105 |
| 653 | 3300050508 | nmdc:mga09592_1154112_c1 | nmdc:mga09592_1154112_c1_313_630 | 105 |
| 654 | 3300050508 | nmdc:mga09592_1368866_c1 | nmdc:mga09592_1368866_c1_36_353 | 105 |
| 655 | 3300050508 | nmdc:mga09592_1486150_c1 | nmdc:mga09592_1486150_c1_28_345 | 105 |
| 656 | 3300050508 | nmdc:mga09592_278139_c1 | nmdc:mga09592_278139_c1_59_376 | 105 |
| 657 | 3300050508 | nmdc:mga09592_333116_c1 | nmdc:mga09592_333116_c1_733_1050 | 105 |
| 658 | 3300050508 | nmdc:mga09592_378498_c1 | nmdc:mga09592_378498_c1_779_1096 | 105 |
| 659 | 3300050508 | nmdc:mga09592_408842_c1 | nmdc:mga09592_408842_c1_470_787 | 105 |
| 660 | 3300050508 | nmdc:mga09592_427372_c1 | nmdc:mga09592_427372_c1_294_611 | 105 |
| 661 | 3300050508 | nmdc:mga09592_81921_c1 | nmdc:mga09592_81921_c1_1770_2087 | 105 |
| 662 | 3300050509 | nmdc:mga0qj67_1107898_c1 | nmdc:mga0qj67_1107898_c1_79_396 | 105 |
| 663 | 3300050509 | nmdc:mga0qj67_113311_c1 | nmdc:mga0qj67_113311_c1_727_1044 | 105 |
| 664 | 3300050509 | nmdc:mga0qj67_135467_c1 | nmdc:mga0qj67_135467_c1_266_583 | 105 |
| 665 | 3300050509 | nmdc:mga0qj67_146257_c1 | nmdc:mga0qj67_146257_c1_419_736 | 105 |
| 666 | 3300050509 | nmdc:mga0qj67_16602_c1 | nmdc:mga0qj67_16602_c1_1960_2277 | 105 |
| 667 | 3300050509 | nmdc:mga0qj67_167202_c1 | nmdc:mga0qj67_167202_c1_1194_1511 | 105 |
| 668 | 3300050509 | nmdc:mga0qj67_228681_c1 | nmdc:mga0qj67_228681_c1_1093_1410 | 105 |
| 669 | 3300050509 | nmdc:mga0qj67_366079_c1 | nmdc:mga0qj67_366079_c1_425_742 | 105 |
| 670 | 3300050509 | nmdc:mga0qj67_98787_c1 | nmdc:mga0qj67_98787_c1_135_452 | 105 |
| 671 | 3300050510 | nmdc:mga06r32_1029249_c1 | nmdc:mga06r32_1029249_c1_436_753 | 105 |
| 672 | 3300050510 | nmdc:mga06r32_1122475_c1 | nmdc:mga06r32_1122475_c1_288_605 | 105 |
| 673 | 3300050510 | nmdc:mga06r32_274274_c1 | nmdc:mga06r32_274274_c1_446_763 | 105 |
| 674 | 3300050510 | nmdc:mga06r32_337699_c2 | nmdc:mga06r32_337699_c2_436_753 | 105 |
| 675 | 3300050510 | nmdc:mga06r32_344546_c1 | nmdc:mga06r32_344546_c1_1121_1438 | 105 |
| 676 | 3300050510 | nmdc:mga06r32_45043_c1 | nmdc:mga06r32_45043_c1_1761_2078 | 105 |
| 677 | 3300050510 | nmdc:mga06r32_45468_c1 | nmdc:mga06r32_45468_c1_960_1277 | 105 |
| 678 | 3300050510 | nmdc:mga06r32_514225_c1 | nmdc:mga06r32_514225_c1_108_425 | 105 |
| 679 | 3300050510 | nmdc:mga06r32_766039_c1 | nmdc:mga06r32_766039_c1_373_690 | 105 |
| 680 | 3300050510 | nmdc:mga06r32_78412_c1 | nmdc:mga06r32_78412_c1_1001_1318 | 105 |
| 681 | 3300050511 | nmdc:mga08y16_270272_c1 | nmdc:mga08y16_270272_c1_1353_1670 | 105 |
| 682 | 3300050511 | nmdc:mga08y16_281809_c1 | nmdc:mga08y16_281809_c1_789_1106 | 105 |
| 683 | 3300050511 | nmdc:mga08y16_349213_c1 | nmdc:mga08y16_349213_c1_858_1175 | 105 |
| 684 | 3300050511 | nmdc:mga08y16_37314_c1 | nmdc:mga08y16_37314_c1_1574_1891 | 105 |
| 685 | 3300050511 | nmdc:mga08y16_7108_c1 | nmdc:mga08y16_7108_c1_4689_5006 | 105 |
| 686 | 3300050512 | nmdc:mga0n895_4655_c1 | nmdc:mga0n895_4655_c1_9636_9953 | 105 |
| 687 | 3300050512 | nmdc:mga0n895_674464_c1 | nmdc:mga0n895_674464_c1_513_830 | 105 |
| 688 | 3300050512 | nmdc:mga0n895_71307_c1 | nmdc:mga0n895_71307_c1_1035_1352 | 105 |
| 689 | 3300050514 | nmdc:mga08x19_362816_c1 | nmdc:mga08x19_362816_c1_408_725 | 105 |
| 690 | 3300050515 | nmdc:mga0a205_163153_c1 | nmdc:mga0a205_163153_c1_1617_1934 | 105 |
| 691 | 3300050515 | nmdc:mga0a205_237574_c1 | nmdc:mga0a205_237574_c1_1246_1563 | 105 |
| 692 | 3300050515 | nmdc:mga0a205_81225_c1 | nmdc:mga0a205_81225_c1_1047_1364 | 105 |
| 693 | 3300053735 | Ga0500596_023171 | Ga0500596_023171_88_405 | 105 |
| 694 | 3300054114 | Ga0501084_0453819 | Ga0501084_0453819_157_474 | 105 |
| 695 | 3300059421 | Ga0590071_065344 | Ga0590071_065344_270_587 | 105 |
| 696 | 3300059424 | Ga0590075_101676 | Ga0590075_101676_51_368 | 105 |
| 697 | 3300059424 | Ga0590075_123137 | Ga0590075_123137_204_521 | 105 |
| 698 | 3300059623 | Ga0587101_113173 | Ga0587101_113173_192_509 | 105 |
| 699 | 3300059642 | Ga0587069_156213 | Ga0587069_156213_46_363 | 105 |
| 700 | 3300060353 | Ga0501082_0110816 | Ga0501082_0110816_1859_2176 | 105 |
| 701 | 3300061734 | Ga0530510_0351048 | Ga0530510_0351048_680_997 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ane-assembly1.cif.gz_L | leishmania major mitochondrial ribosome | 0.8931 | 2 | 102 |
| 7p7u-assembly1.cif.gz_U | e. faecalis 70s ribosome with p-trna, state iv | 0.8927 | 3 | 103 |
| 7aoi-assembly1.cif.gz_AV | trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate | 0.8901 | 2 | 103 |
| 8cgd-assembly1.cif.gz_q | clindamycin bound to the 50s subunit | 0.8864 | 3 | 103 |
| 6ys3-assembly1.cif.gz_r | cryo-em structure of the 50s ribosomal subunit at 2.58 angstroms with modeled gbc secm peptide | 0.8806 | 3 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0H4Y5_87_186_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.92 | 3 | 101 | 2.40.10.190 |
| af_C0H4Y5_87_186_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9029 | 3 | 101 | 2.40.10.190 |
| af_Q4DUK1_23_123_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8976 | 3 | 101 | 2.40.50.140 |
| af_Q54IF0_61_161_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.887 | 3 | 100 | 2.40.10.190 |
| af_P0AG48_1_101_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.8826 | 3 | 101 | 2.40.10.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A419ECN3-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9327 | 1 | 103 |
GO:0000166
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1J4RLY2-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9265 | 1 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0F7GCB6-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9238 | 2 | 103 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A522U108-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9237 | 2 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A838HF75-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9234 | 3 | 105 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar