F476202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 311 | 692 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100055783|Ga0070667_1000557834 |
| Length | 208 |
| Sequence | VSEAGRSDETEGARARDEHKDAWSAILTWRAHDVPQMESVRVQLSGNRIKAYGRIVAAATPSHPAFSASYDLVTDEAGGTKRLSLTVTLAERERQLSIARDEENMWLVQHHTGESKRAAYDGALDIDVIFSPFFNALPIRRTGLYQRSDSVSVPVVYVRLPELSVEPAVISYSSAPDGIKLHSPVAETTIRVDDEGFILDYPGLAERI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 6 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 7 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 8 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 9 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 10 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 201 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 202 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 203 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 204 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 299 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 305 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 306 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.38 |
| Nodule | 0 |
| Rhizoplane | 12.25 |
| Rhizosphere | 62.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10010695 | 3300001991 | Bacteria | 1641 |
| 2 | JGI24745J21846_1012037 | 3300002073 | Bacteria | 992 |
| 3 | JGI24744J21845_10015454 | 3300002077 | Bacteria | 1525 |
| 4 | JGI24742J22300_10022971 | 3300002244 | Bacteria | 1070 |
| 5 | rootH2_10123861 | 3300003320 | Bacteria | 4360 |
| 6 | Ga0055540_1000127 | 3300003792 | Bacteria | 77764 |
| 7 | Ga0055540_1001246 | 3300003792 | Bacteria | 15622 |
| 8 | Ga0055540_1023150 | 3300003792 | Bacteria | 1570 |
| 9 | Ga0070658_10207606 | 3300005327 | Bacteria | 1654 |
| 10 | Ga0070676_10058193 | 3300005328 | Bacteria | 2290 |
| 11 | Ga0070683_100177618 | 3300005329 | Bacteria | 2021 |
| 12 | Ga0070690_100876520 | 3300005330 | Bacteria | 701 |
| 13 | Ga0070670_100128310 | 3300005331 | Bacteria | 2189 |
| 14 | Ga0068869_100005930 | 3300005334 | Bacteria | 7720 |
| 15 | Ga0068869_100012274 | 3300005334 | Bacteria | 5656 |
| 16 | Ga0070666_10020470 | 3300005335 | Bacteria | 4276 |
| 17 | Ga0070666_10406289 | 3300005335 | Bacteria | 980 |
| 18 | Ga0070682_100021179 | 3300005337 | Bacteria | 3832 |
| 19 | Ga0068868_100008507 | 3300005338 | Bacteria | 7347 |
| 20 | Ga0068868_100128174 | 3300005338 | Bacteria | 2074 |
| 21 | Ga0070689_100342711 | 3300005340 | Bacteria | 1252 |
| 22 | Ga0070691_10112199 | 3300005341 | Bacteria | 1365 |
| 23 | Ga0070692_10156272 | 3300005345 | Bacteria | 1303 |
| 24 | Ga0070668_100007322 | 3300005347 | Bacteria | 8186 |
| 25 | Ga0070668_100021378 | 3300005347 | Bacteria | 4888 |
| 26 | Ga0070668_100065158 | 3300005347 | Bacteria | 2826 |
| 27 | Ga0070668_100413552 | 3300005347 | Bacteria | 1154 |
| 28 | Ga0070668_100726272 | 3300005347 | Bacteria | 878 |
| 29 | Ga0070669_100006373 | 3300005353 | Bacteria | 8500 |
| 30 | Ga0070675_100462980 | 3300005354 | Bacteria | 1138 |
| 31 | Ga0070671_100002188 | 3300005355 | Bacteria | 15095 |
| 32 | Ga0070671_100182455 | 3300005355 | Bacteria | 1777 |
| 33 | Ga0070671_100714731 | 3300005355 | Bacteria | 870 |
| 34 | Ga0070674_100006508 | 3300005356 | Bacteria | 6823 |
| 35 | Ga0070674_100081535 | 3300005356 | Bacteria | 2312 |
| 36 | Ga0070674_100332516 | 3300005356 | Bacteria | 1221 |
| 37 | Ga0070673_100554268 | 3300005364 | Bacteria | 1044 |
| 38 | Ga0070688_100062044 | 3300005365 | Bacteria | 2365 |
| 39 | Ga0070667_100000364 | 3300005367 | Bacteria | 49361 |
| 40 | Ga0070667_100013540 | 3300005367 | Bacteria | 6739 |
| 41 | Ga0070667_100028973 | 3300005367 | Bacteria | 4611 |
| 42 | Ga0070667_100055783 | 3300005367 | Bacteria | 3336 |
| 43 | Ga0070667_100456334 | 3300005367 | Bacteria | 1168 |
| 44 | Ga0070709_10021878 | 3300005434 | Bacteria | 3732 |
| 45 | Ga0070709_10052548 | 3300005434 | Bacteria | 2561 |
| 46 | Ga0070709_10088254 | 3300005434 | Bacteria | 2039 |
| 47 | Ga0070714_100023392 | 3300005435 | Bacteria | 5075 |
| 48 | Ga0070713_100327349 | 3300005436 | Bacteria | 1416 |
| 49 | Ga0070710_10021371 | 3300005437 | Bacteria | 3372 |
| 50 | Ga0070701_10051662 | 3300005438 | Bacteria | 2133 |
| 51 | Ga0070701_10538980 | 3300005438 | Bacteria | 764 |
| 52 | Ga0070711_100003315 | 3300005439 | Bacteria | 9370 |
| 53 | Ga0070705_100035941 | 3300005440 | Bacteria | 2781 |
| 54 | Ga0070700_100017590 | 3300005441 | Bacteria | 4093 |
| 55 | Ga0070700_100110398 | 3300005441 | Bacteria | 1828 |
| 56 | Ga0070700_100203640 | 3300005441 | Bacteria | 1392 |
| 57 | Ga0070694_100019161 | 3300005444 | Bacteria | 4351 |
| 58 | Ga0070663_100006678 | 3300005455 | Bacteria | 6958 |
| 59 | Ga0070663_100047327 | 3300005455 | Bacteria | 3047 |
| 60 | Ga0070663_100162974 | 3300005455 | Bacteria | 1718 |
| 61 | Ga0070678_100052094 | 3300005456 | Bacteria | 2970 |
| 62 | Ga0070678_100233658 | 3300005456 | Bacteria | 1534 |
| 63 | Ga0070678_100847820 | 3300005456 | Bacteria | 832 |
| 64 | Ga0070662_100013113 | 3300005457 | Bacteria | 5509 |
| 65 | Ga0068867_100000767 | 3300005459 | Bacteria | 21667 |
| 66 | Ga0070685_10621468 | 3300005466 | Bacteria | 780 |
| 67 | Ga0068853_100046366 | 3300005539 | Bacteria | 3726 |
| 68 | Ga0068853_100060552 | 3300005539 | Bacteria | 3271 |
| 69 | Ga0068853_100105174 | 3300005539 | Bacteria | 2500 |
| 70 | Ga0068853_100699108 | 3300005539 | Bacteria | 967 |
| 71 | Ga0070672_100081543 | 3300005543 | Bacteria | 2594 |
| 72 | Ga0070672_100819329 | 3300005543 | Bacteria | 820 |
| 73 | Ga0070686_100676517 | 3300005544 | Bacteria | 821 |
| 74 | Ga0070695_100032291 | 3300005545 | Bacteria | 3273 |
| 75 | Ga0070696_100026906 | 3300005546 | Bacteria | 3915 |
| 76 | Ga0070693_100007431 | 3300005547 | Bacteria | 5357 |
| 77 | Ga0070665_100002445 | 3300005548 | Bacteria | 20475 |
| 78 | Ga0070665_100012841 | 3300005548 | Bacteria | 8431 |
| 79 | Ga0070665_100117844 | 3300005548 | Bacteria | 2658 |
| 80 | Ga0070665_100202135 | 3300005548 | Bacteria | 1987 |
| 81 | Ga0070665_100325898 | 3300005548 | Bacteria | 1540 |
| 82 | Ga0070665_100910357 | 3300005548 | Bacteria | 892 |
| 83 | Ga0070704_100016405 | 3300005549 | Bacteria | 4679 |
| 84 | Ga0070704_100486585 | 3300005549 | Bacteria | 1068 |
| 85 | Ga0068855_100566794 | 3300005563 | Bacteria | 1228 |
| 86 | Ga0068854_100018986 | 3300005578 | Bacteria | 4624 |
| 87 | Ga0068854_100117088 | 3300005578 | Bacteria | 2017 |
| 88 | Ga0068856_102139843 | 3300005614 | Bacteria | 569 |
| 89 | Ga0070702_100031316 | 3300005615 | Bacteria | 2908 |
| 90 | Ga0068852_100196294 | 3300005616 | Bacteria | 1907 |
| 91 | Ga0068852_100479936 | 3300005616 | Bacteria | 1235 |
| 92 | Ga0068859_100044940 | 3300005617 | Bacteria | 4438 |
| 93 | Ga0068859_100068346 | 3300005617 | Bacteria | 3587 |
| 94 | Ga0068859_100305109 | 3300005617 | Bacteria | 1685 |
| 95 | Ga0068859_100892695 | 3300005617 | Bacteria | 974 |
| 96 | Ga0068859_101109847 | 3300005617 | Bacteria | 870 |
| 97 | Ga0068864_100453493 | 3300005618 | Bacteria | 1227 |
| 98 | Ga0068864_100699963 | 3300005618 | Bacteria | 990 |
| 99 | Ga0068866_10001343 | 3300005718 | Bacteria | 10632 |
| 100 | Ga0068861_100000969 | 3300005719 | Bacteria | 17503 |
| 101 | Ga0068861_100536425 | 3300005719 | Bacteria | 1064 |
| 102 | Ga0068863_100000579 | 3300005841 | Bacteria | 37331 |
| 103 | Ga0068863_100040179 | 3300005841 | Bacteria | 4448 |
| 104 | Ga0068863_100051223 | 3300005841 | Bacteria | 3914 |
| 105 | Ga0068863_100193559 | 3300005841 | Bacteria | 1955 |
| 106 | Ga0068863_100817012 | 3300005841 | Bacteria | 930 |
| 107 | Ga0068858_100004272 | 3300005842 | Bacteria | 14052 |
| 108 | Ga0068858_100158875 | 3300005842 | Bacteria | 2128 |
| 109 | Ga0068858_100207871 | 3300005842 | Bacteria | 1852 |
| 110 | Ga0068858_100240800 | 3300005842 | Bacteria | 1717 |
| 111 | Ga0068860_100000480 | 3300005843 | Bacteria | 49553 |
| 112 | Ga0068860_100294292 | 3300005843 | Bacteria | 1589 |
| 113 | Ga0068860_100583968 | 3300005843 | Bacteria | 1122 |
| 114 | Ga0068862_100000771 | 3300005844 | Bacteria | 31887 |
| 115 | Ga0068862_100053295 | 3300005844 | Bacteria | 3462 |
| 116 | Ga0068862_100102635 | 3300005844 | Bacteria | 2503 |
| 117 | Ga0068862_100521581 | 3300005844 | Bacteria | 1131 |
| 118 | Ga0081455_10026071 | 3300005937 | Bacteria | 5385 |
| 119 | Ga0081455_10121834 | 3300005937 | Bacteria | 2054 |
| 120 | Ga0081455_10195817 | 3300005937 | Bacteria | 1518 |
| 121 | Ga0081538_10058574 | 3300005981 | Bacteria | 2232 |
| 122 | Ga0081540_1137750 | 3300005983 | Bacteria | 985 |
| 123 | Ga0070717_10154177 | 3300006028 | Bacteria | 1989 |
| 124 | Ga0075365_10006885 | 3300006038 | Bacteria | 6307 |
| 125 | Ga0075365_10021995 | 3300006038 | Bacteria | 3987 |
| 126 | Ga0075365_10056206 | 3300006038 | Bacteria | 2616 |
| 127 | Ga0075365_10084460 | 3300006038 | Bacteria | 2155 |
| 128 | Ga0075365_10205876 | 3300006038 | Bacteria | 1379 |
| 129 | Ga0075368_10129997 | 3300006042 | Bacteria | 1046 |
| 130 | Ga0075363_100002354 | 3300006048 | Bacteria | 7689 |
| 131 | Ga0075363_100006325 | 3300006048 | Bacteria | 5367 |
| 132 | Ga0075363_100007885 | 3300006048 | Bacteria | 4929 |
| 133 | Ga0075363_100011621 | 3300006048 | Bacteria | 4221 |
| 134 | Ga0075363_100023828 | 3300006048 | Bacteria | 3106 |
| 135 | Ga0075363_100107678 | 3300006048 | Bacteria | 1547 |
| 136 | Ga0075363_100274496 | 3300006048 | Bacteria | 974 |
| 137 | Ga0075364_10002891 | 3300006051 | Bacteria | 9683 |
| 138 | Ga0075364_10010306 | 3300006051 | Bacteria | 5642 |
| 139 | Ga0075364_10021217 | 3300006051 | Bacteria | 4093 |
| 140 | Ga0075364_10027745 | 3300006051 | Bacteria | 3619 |
| 141 | Ga0075364_10029642 | 3300006051 | Bacteria | 3510 |
| 142 | Ga0075364_10147839 | 3300006051 | Bacteria | 1583 |
| 143 | Ga0075364_10197896 | 3300006051 | Bacteria | 1362 |
| 144 | Ga0075364_10226318 | 3300006051 | Bacteria | 1270 |
| 145 | Ga0075364_10262257 | 3300006051 | Bacteria | 1174 |
| 146 | Ga0075364_10613602 | 3300006051 | Bacteria | 743 |
| 147 | Ga0070715_10045223 | 3300006163 | Bacteria | 1866 |
| 148 | Ga0070715_10056348 | 3300006163 | Bacteria | 1710 |
| 149 | Ga0070716_100010796 | 3300006173 | Bacteria | 4591 |
| 150 | Ga0070716_100193177 | 3300006173 | Bacteria | 1347 |
| 151 | Ga0070716_100361650 | 3300006173 | Bacteria | 1031 |
| 152 | Ga0070712_100008693 | 3300006175 | Bacteria | 6397 |
| 153 | Ga0070712_100010905 | 3300006175 | Bacteria | 5747 |
| 154 | Ga0070712_100406092 | 3300006175 | Bacteria | 1126 |
| 155 | Ga0075362_10054338 | 3300006177 | Bacteria | 1800 |
| 156 | Ga0075362_10055545 | 3300006177 | Bacteria | 1781 |
| 157 | Ga0075362_10074768 | 3300006177 | Bacteria | 1553 |
| 158 | Ga0075362_10151690 | 3300006177 | Bacteria | 1112 |
| 159 | Ga0075367_10058190 | 3300006178 | Bacteria | 2300 |
| 160 | Ga0075367_10171850 | 3300006178 | Bacteria | 1350 |
| 161 | Ga0075369_10002618 | 3300006186 | Bacteria | 6447 |
| 162 | Ga0075369_10008806 | 3300006186 | Bacteria | 3898 |
| 163 | Ga0075369_10010274 | 3300006186 | Bacteria | 3658 |
| 164 | Ga0075369_10019165 | 3300006186 | Bacteria | 2792 |
| 165 | Ga0075369_10031546 | 3300006186 | Bacteria | 2238 |
| 166 | Ga0075369_10033991 | 3300006186 | Bacteria | 2162 |
| 167 | Ga0075369_10052481 | 3300006186 | Bacteria | 1767 |
| 168 | Ga0097621_100055695 | 3300006237 | Bacteria | 3230 |
| 169 | Ga0075370_10001066 | 3300006353 | Bacteria | 11411 |
| 170 | Ga0075370_10013987 | 3300006353 | Bacteria | 4272 |
| 171 | Ga0075370_10020604 | 3300006353 | Bacteria | 3607 |
| 172 | Ga0075370_10093822 | 3300006353 | Bacteria | 1733 |
| 173 | Ga0075370_10134184 | 3300006353 | Bacteria | 1445 |
| 174 | Ga0075370_10142635 | 3300006353 | Bacteria | 1401 |
| 175 | Ga0068871_100329365 | 3300006358 | Bacteria | 1347 |
| 176 | Ga0075431_100066099 | 3300006847 | Bacteria | 3733 |
| 177 | Ga0075429_101200601 | 3300006880 | Bacteria | 662 |
| 178 | Ga0068865_100009281 | 3300006881 | Bacteria | 6094 |
| 179 | Ga0068865_100068362 | 3300006881 | Bacteria | 2511 |
| 180 | Ga0097620_100044939 | 3300006931 | Bacteria | 4438 |
| 181 | Ga0097620_100068354 | 3300006931 | Bacteria | 3587 |
| 182 | Ga0097620_100305101 | 3300006931 | Bacteria | 1685 |
| 183 | Ga0097620_100892679 | 3300006931 | Bacteria | 974 |
| 184 | Ga0097620_101109851 | 3300006931 | Bacteria | 870 |
| 185 | Ga0099795_10020200 | 3300007788 | Bacteria | 2166 |
| 186 | Ga0099795_10073885 | 3300007788 | Bacteria | 1291 |
| 187 | Ga0105250_10105046 | 3300009092 | Bacteria | 1154 |
| 188 | Ga0111539_10371035 | 3300009094 | Bacteria | 1666 |
| 189 | Ga0105245_10003393 | 3300009098 | Bacteria | 14269 |
| 190 | Ga0105245_10425264 | 3300009098 | Bacteria | 1332 |
| 191 | Ga0105245_10851538 | 3300009098 | Bacteria | 952 |
| 192 | Ga0105245_10992100 | 3300009098 | Bacteria | 884 |
| 193 | Ga0105247_10000046 | 3300009101 | Bacteria | 151843 |
| 194 | Ga0105247_10000785 | 3300009101 | Bacteria | 24322 |
| 195 | Ga0105247_10057261 | 3300009101 | Bacteria | 2409 |
| 196 | Ga0114129_10001921 | 3300009147 | Bacteria | 28370 |
| 197 | Ga0105243_10003766 | 3300009148 | Bacteria | 12156 |
| 198 | Ga0105243_10383645 | 3300009148 | Bacteria | 1300 |
| 199 | Ga0105241_10768780 | 3300009174 | Bacteria | 885 |
| 200 | Ga0105242_10003339 | 3300009176 | Bacteria | 12479 |
| 201 | Ga0105242_11562406 | 3300009176 | Bacteria | 692 |
| 202 | Ga0105248_10002475 | 3300009177 | Bacteria | 20518 |
| 203 | Ga0105248_10077729 | 3300009177 | Bacteria | 3731 |
| 204 | Ga0105248_10848985 | 3300009177 | Bacteria | 1031 |
| 205 | Ga0105237_10004038 | 3300009545 | Bacteria | 17141 |
| 206 | Ga0105237_10090956 | 3300009545 | Bacteria | 3041 |
| 207 | Ga0105237_10272572 | 3300009545 | Bacteria | 1695 |
| 208 | Ga0105238_10103326 | 3300009551 | Bacteria | 2831 |
| 209 | Ga0105238_10987025 | 3300009551 | Bacteria | 863 |
| 210 | Ga0105249_10000282 | 3300009553 | Bacteria | 53256 |
| 211 | Ga0105249_10014945 | 3300009553 | Bacteria | 6865 |
| 212 | Ga0105249_10245996 | 3300009553 | Bacteria | 1771 |
| 213 | Ga0105239_10051118 | 3300010375 | Bacteria | 4531 |
| 214 | Ga0105239_10156290 | 3300010375 | Bacteria | 2547 |
| 215 | Ga0105239_10263466 | 3300010375 | Bacteria | 1937 |
| 216 | Ga0105239_10308586 | 3300010375 | Bacteria | 1783 |
| 217 | Ga0105239_10342199 | 3300010375 | Bacteria | 1688 |
| 218 | Ga0105239_10550104 | 3300010375 | Bacteria | 1314 |
| 219 | Ga0105239_11406331 | 3300010375 | Bacteria | 805 |
| 220 | Ga0105246_10098379 | 3300011119 | Bacteria | 2125 |
| 221 | Ga0105246_10442906 | 3300011119 | Bacteria | 1090 |
| 222 | Ga0157369_10086751 | 3300013105 | Bacteria | 3342 |
| 223 | Ga0157374_11557398 | 3300013296 | Bacteria | 685 |
| 224 | Ga0157378_10011293 | 3300013297 | Bacteria | 7817 |
| 225 | Ga0157378_10112066 | 3300013297 | Bacteria | 2502 |
| 226 | Ga0163162_10009459 | 3300013306 | Bacteria | 9478 |
| 227 | Ga0163162_10979736 | 3300013306 | Bacteria | 955 |
| 228 | Ga0163162_11362295 | 3300013306 | Bacteria | 807 |
| 229 | Ga0157372_10153087 | 3300013307 | Bacteria | 2662 |
| 230 | Ga0157372_11721219 | 3300013307 | Bacteria | 721 |
| 231 | Ga0157375_10001214 | 3300013308 | Bacteria | 22203 |
| 232 | Ga0157375_10155284 | 3300013308 | Bacteria | 2427 |
| 233 | Ga0157375_11051673 | 3300013308 | Bacteria | 952 |
| 234 | Ga0157375_11563410 | 3300013308 | Bacteria | 779 |
| 235 | Ga0163163_10013674 | 3300014325 | Bacteria | 7435 |
| 236 | Ga0163163_10019646 | 3300014325 | Bacteria | 6347 |
| 237 | Ga0163163_11572693 | 3300014325 | Bacteria | 719 |
| 238 | Ga0157380_10441697 | 3300014326 | Bacteria | 1247 |
| 239 | Ga0182008_10191058 | 3300014497 | Bacteria | 1039 |
| 240 | Ga0157377_10201530 | 3300014745 | Bacteria | 1264 |
| 241 | Ga0157379_10065992 | 3300014968 | Bacteria | 3235 |
| 242 | Ga0157379_10100825 | 3300014968 | Bacteria | 2592 |
| 243 | Ga0157379_10597297 | 3300014968 | Bacteria | 1030 |
| 244 | Ga0157376_10013024 | 3300014969 | Bacteria | 6194 |
| 245 | Ga0157376_10584405 | 3300014969 | Bacteria | 1110 |
| 246 | Ga0157376_10826135 | 3300014969 | Bacteria | 941 |
| 247 | Ga0157376_10969667 | 3300014969 | Bacteria | 871 |
| 248 | Ga0163161_10021759 | 3300017792 | Bacteria | 4509 |
| 249 | Ga0213876_10003081 | 3300021384 | Bacteria | 9653 |
| 250 | Ga0213876_10029181 | 3300021384 | Bacteria | 2908 |
| 251 | Ga0209673_1011327 | 3300025273 | Bacteria | 3684 |
| 252 | Ga0209051_1000014 | 3300025303 | Bacteria | 552732 |
| 253 | Ga0209051_1000292 | 3300025303 | Bacteria | 80255 |
| 254 | Ga0209051_1001885 | 3300025303 | Bacteria | 16400 |
| 255 | Ga0209051_1014196 | 3300025303 | Bacteria | 3729 |
| 256 | Ga0209051_1029082 | 3300025303 | Bacteria | 2170 |
| 257 | Ga0207696_1015802 | 3300025711 | Bacteria | 2545 |
| 258 | Ga0207692_10004776 | 3300025898 | Bacteria | 5385 |
| 259 | Ga0207710_10030781 | 3300025900 | Bacteria | 2343 |
| 260 | Ga0207688_10001297 | 3300025901 | Bacteria | 12970 |
| 261 | Ga0207680_10037809 | 3300025903 | Bacteria | 2789 |
| 262 | Ga0207680_10159436 | 3300025903 | Bacteria | 1511 |
| 263 | Ga0207647_10040051 | 3300025904 | Bacteria | 2953 |
| 264 | Ga0207685_10008023 | 3300025905 | Bacteria | 2981 |
| 265 | Ga0207699_10079488 | 3300025906 | Bacteria | 2029 |
| 266 | Ga0207699_10095327 | 3300025906 | Bacteria | 1876 |
| 267 | Ga0207699_10270658 | 3300025906 | Bacteria | 1177 |
| 268 | Ga0207645_10036755 | 3300025907 | Bacteria | 3145 |
| 269 | Ga0207643_10372254 | 3300025908 | Bacteria | 899 |
| 270 | Ga0207671_10058855 | 3300025914 | Bacteria | 2849 |
| 271 | Ga0207671_10318402 | 3300025914 | Bacteria | 1231 |
| 272 | Ga0207693_10001453 | 3300025915 | Bacteria | 20975 |
| 273 | Ga0207693_10013807 | 3300025915 | Bacteria | 6503 |
| 274 | Ga0207693_10062162 | 3300025915 | Bacteria | 2926 |
| 275 | Ga0207663_10018600 | 3300025916 | Bacteria | 3898 |
| 276 | Ga0207662_10394384 | 3300025918 | Bacteria | 937 |
| 277 | Ga0207694_10980209 | 3300025924 | Bacteria | 715 |
| 278 | Ga0207650_10168843 | 3300025925 | Bacteria | 1738 |
| 279 | Ga0207659_10450998 | 3300025926 | Bacteria | 1083 |
| 280 | Ga0207687_10004414 | 3300025927 | Bacteria | 9386 |
| 281 | Ga0207700_11377300 | 3300025928 | Bacteria | 627 |
| 282 | Ga0207664_10145795 | 3300025929 | Bacteria | 2007 |
| 283 | Ga0207664_10341953 | 3300025929 | Bacteria | 1323 |
| 284 | Ga0207644_10049164 | 3300025931 | Bacteria | 3018 |
| 285 | Ga0207644_10251171 | 3300025931 | Bacteria | 1411 |
| 286 | Ga0207706_10015621 | 3300025933 | Bacteria | 6861 |
| 287 | Ga0207706_10241679 | 3300025933 | Bacteria | 1578 |
| 288 | Ga0207686_10005255 | 3300025934 | Bacteria | 6949 |
| 289 | Ga0207709_10295972 | 3300025935 | Bacteria | 1201 |
| 290 | Ga0207670_10039764 | 3300025936 | Bacteria | 3082 |
| 291 | Ga0207665_10013308 | 3300025939 | Bacteria | 5409 |
| 292 | Ga0207665_10084789 | 3300025939 | Bacteria | 2187 |
| 293 | Ga0207665_10180592 | 3300025939 | Bacteria | 1528 |
| 294 | Ga0207691_10118357 | 3300025940 | Bacteria | 2350 |
| 295 | Ga0207711_10063806 | 3300025941 | Bacteria | 3181 |
| 296 | Ga0207689_10011504 | 3300025942 | Bacteria | 7584 |
| 297 | Ga0207689_10027920 | 3300025942 | Bacteria | 4721 |
| 298 | Ga0207689_10521320 | 3300025942 | Bacteria | 997 |
| 299 | Ga0207661_10387164 | 3300025944 | Bacteria | 1266 |
| 300 | Ga0207679_10429282 | 3300025945 | Bacteria | 1168 |
| 301 | Ga0207667_10136474 | 3300025949 | Bacteria | 2526 |
| 302 | Ga0207712_10476985 | 3300025961 | Bacteria | 1063 |
| 303 | Ga0207712_10628270 | 3300025961 | Bacteria | 932 |
| 304 | Ga0207668_10004131 | 3300025972 | Bacteria | 8519 |
| 305 | Ga0207668_10008025 | 3300025972 | Bacteria | 6284 |
| 306 | Ga0207668_10158033 | 3300025972 | Bacteria | 1763 |
| 307 | Ga0207668_10231040 | 3300025972 | Bacteria | 1491 |
| 308 | Ga0207640_10049987 | 3300025981 | Bacteria | 2710 |
| 309 | Ga0207640_10145399 | 3300025981 | Bacteria | 1734 |
| 310 | Ga0207658_10001676 | 3300025986 | Bacteria | 16853 |
| 311 | Ga0207658_10080480 | 3300025986 | Bacteria | 2495 |
| 312 | Ga0207658_10166960 | 3300025986 | Bacteria | 1809 |
| 313 | Ga0207658_10211678 | 3300025986 | Bacteria | 1625 |
| 314 | Ga0207677_10015040 | 3300026023 | Bacteria | 4537 |
| 315 | Ga0207677_10122905 | 3300026023 | Bacteria | 1956 |
| 316 | Ga0207703_10033811 | 3300026035 | Bacteria | 4055 |
| 317 | Ga0207703_10449987 | 3300026035 | Bacteria | 1203 |
| 318 | Ga0207639_10054911 | 3300026041 | Bacteria | 3047 |
| 319 | Ga0207639_10178928 | 3300026041 | Bacteria | 1803 |
| 320 | Ga0207639_10443856 | 3300026041 | Bacteria | 1177 |
| 321 | Ga0207678_10010680 | 3300026067 | Bacteria | 8066 |
| 322 | Ga0207678_10019263 | 3300026067 | Bacteria | 5993 |
| 323 | Ga0207678_10183762 | 3300026067 | Bacteria | 1785 |
| 324 | Ga0207708_10026516 | 3300026075 | Bacteria | 4386 |
| 325 | Ga0207708_10453942 | 3300026075 | Bacteria | 1068 |
| 326 | Ga0207641_10012244 | 3300026088 | Bacteria | 7039 |
| 327 | Ga0207641_10188863 | 3300026088 | Bacteria | 1892 |
| 328 | Ga0207648_10001187 | 3300026089 | Bacteria | 29149 |
| 329 | Ga0207648_10074996 | 3300026089 | Bacteria | 2949 |
| 330 | Ga0207676_10216685 | 3300026095 | Bacteria | 1702 |
| 331 | Ga0207675_100000909 | 3300026118 | Bacteria | 29571 |
| 332 | Ga0207675_100087105 | 3300026118 | Bacteria | 2933 |
| 333 | Ga0207683_10001040 | 3300026121 | Bacteria | 25287 |
| 334 | Ga0207683_10022248 | 3300026121 | Bacteria | 5440 |
| 335 | Ga0207683_10047339 | 3300026121 | Bacteria | 3766 |
| 336 | Ga0207698_10257635 | 3300026142 | Bacteria | 1601 |
| 337 | Ga0209813_10086459 | 3300027866 | Bacteria | 1045 |
| 338 | Ga0268266_10014370 | 3300028379 | Bacteria | 6810 |
| 339 | Ga0268266_10160859 | 3300028379 | Bacteria | 2031 |
| 340 | Ga0268266_10459970 | 3300028379 | Bacteria | 1211 |
| 341 | Ga0268265_10000738 | 3300028380 | Bacteria | 31894 |
| 342 | Ga0268265_10106721 | 3300028380 | Bacteria | 2275 |
| 343 | Ga0268265_10240798 | 3300028380 | Bacteria | 1596 |
| 344 | Ga0265327_10001010 | 3300031251 | Bacteria | 39881 |
| 345 | Ga0307413_10163691 | 3300031824 | Bacteria | 1566 |
| 346 | Ga0307413_10540792 | 3300031824 | Bacteria | 943 |
| 347 | Ga0307410_10024933 | 3300031852 | Bacteria | 3744 |
| 348 | Ga0307407_10080817 | 3300031903 | Bacteria | 1965 |
| 349 | Ga0307407_10246981 | 3300031903 | Bacteria | 1221 |
| 350 | Ga0307409_100134910 | 3300031995 | Bacteria | 2116 |
| 351 | Ga0307409_100566809 | 3300031995 | Bacteria | 1117 |
| 352 | Ga0307416_100513712 | 3300032002 | Bacteria | 1265 |
| 353 | Ga0307416_100858624 | 3300032002 | Bacteria | 1006 |
| 354 | Ga0307414_10179078 | 3300032004 | Bacteria | 1703 |
| 355 | Ga0307414_10300379 | 3300032004 | Bacteria | 1358 |
| 356 | Ga0307415_100004788 | 3300032126 | Bacteria | 7093 |
| 357 | Ga0373939_0010032 | 3300035114 | Bacteria | 2359 |
| 358 | Ga0373961_0273036 | 3300035241 | Bacteria | 618 |
| 359 | Ga0373962_0157848 | 3300035242 | Bacteria | 747 |
| 360 | Ga0373931_0058785 | 3300035691 | Bacteria | 2066 |
| 361 | Ga0373947_0167557 | 3300035725 | Bacteria | 1424 |
| 362 | Ga0316584_0125135 | 3300036712 | Bacteria | 1920 |
| 363 | Ga0395900_1050450 | 3300037418 | Bacteria | 733 |
| 364 | Ga0436364_0359706 | 3300037853 | Bacteria | 4471 |
| 365 | Ga0436364_1063367 | 3300037853 | Bacteria | 1460 |
| 366 | Ga0436364_1525395 | 3300037853 | Bacteria | 2477 |
| 367 | Ga0436365_0831031 | 3300039437 | Bacteria | 35518 |
| 368 | Ga0436365_1107006 | 3300039437 | Bacteria | 21861 |
| 369 | Ga0436365_1605284 | 3300039437 | Bacteria | 14176 |
| 370 | Ga0436363_0743374 | 3300039450 | Bacteria | 3351 |
| 371 | Ga0439461_0008575 | 3300041410 | Bacteria | 1836 |
| 372 | Ga0439466_0000072 | 3300041411 | Bacteria | 40236 |
| 373 | Ga0439466_0002430 | 3300041411 | Bacteria | 7302 |
| 374 | Ga0439466_0013588 | 3300041411 | Bacteria | 2978 |
| 375 | Ga0439466_0051138 | 3300041411 | Bacteria | 1354 |
| 376 | Ga0439465_0002086 | 3300041413 | Bacteria | 6567 |
| 377 | Ga0439465_0008430 | 3300041413 | Bacteria | 3254 |
| 378 | Ga0439465_0019489 | 3300041413 | Bacteria | 2121 |
| 379 | Ga0439465_0062200 | 3300041413 | Bacteria | 1238 |
| 380 | Ga0439465_0112287 | 3300041413 | Bacteria | 949 |
| 381 | Ga0451787_349234 | 3300041441 | Bacteria | 851 |
| 382 | Ga0451789_0786144 | 3300041443 | Bacteria | 1735 |
| 383 | Ga0451795_1067315 | 3300041456 | Bacteria | 979 |
| 384 | Ga0451802_1323411 | 3300041460 | Bacteria | 1274 |
| 385 | Ga0451853_1978743 | 3300041512 | Bacteria | 912 |
| 386 | Ga0439442_010722 | 3300042002 | Bacteria | 1861 |
| 387 | Ga0439442_021607 | 3300042002 | Bacteria | 1335 |
| 388 | Ga0439445_0006958 | 3300042004 | Bacteria | 2613 |
| 389 | Ga0439445_0040336 | 3300042004 | Bacteria | 1239 |
| 390 | Ga0439448_0002154 | 3300042005 | Bacteria | 5305 |
| 391 | Ga0439463_117779 | 3300042016 | Bacteria | 686 |
| 392 | Ga0439434_0010857 | 3300042435 | Bacteria | 2689 |
| 393 | Ga0439434_0022000 | 3300042435 | Bacteria | 1917 |
| 394 | Ga0466969_0015754 | 3300044656 | Bacteria | 3962 |
| 395 | Ga0466969_0015876 | 3300044656 | Bacteria | 3946 |
| 396 | Ga0466969_0053878 | 3300044656 | Bacteria | 1972 |
| 397 | Ga0466972_0005553 | 3300044658 | Bacteria | 6316 |
| 398 | Ga0466972_0024140 | 3300044658 | Bacteria | 3017 |
| 399 | Ga0466965_0061680 | 3300044683 | Bacteria | 1874 |
| 400 | Ga0466965_0068316 | 3300044683 | Bacteria | 1784 |
| 401 | Ga0466965_0353708 | 3300044683 | Bacteria | 805 |
| 402 | Ga0466966_0004047 | 3300044684 | Bacteria | 9679 |
| 403 | Ga0466966_0006045 | 3300044684 | Bacteria | 7994 |
| 404 | Ga0466966_0020123 | 3300044684 | Bacteria | 4392 |
| 405 | Ga0466966_0101098 | 3300044684 | Bacteria | 1783 |
| 406 | Ga0466961_0003994 | 3300044693 | Bacteria | 9230 |
| 407 | Ga0466961_0032568 | 3300044693 | Bacteria | 3350 |
| 408 | Ga0466961_0219032 | 3300044693 | Bacteria | 1173 |
| 409 | Ga0466963_0049093 | 3300044694 | Bacteria | 2790 |
| 410 | Ga0466963_0065942 | 3300044694 | Bacteria | 2428 |
| 411 | Ga0466963_0579409 | 3300044694 | Bacteria | 793 |
| 412 | Ga0466964_0008433 | 3300044706 | Bacteria | 3873 |
| 413 | Ga0466964_0033938 | 3300044706 | Bacteria | 2035 |
| 414 | Ga0466971_0002012 | 3300044719 | Bacteria | 8604 |
| 415 | Ga0466968_0008779 | 3300044735 | Bacteria | 3876 |
| 416 | Ga0466968_0036351 | 3300044735 | Bacteria | 2064 |
| 417 | Ga0466968_0074265 | 3300044735 | Bacteria | 1484 |
| 418 | Ga0466968_0094609 | 3300044735 | Bacteria | 1328 |
| 419 | Ga0466970_0006101 | 3300044765 | Bacteria | 6005 |
| 420 | Ga0466970_0028803 | 3300044765 | Bacteria | 2920 |
| 421 | Ga0466970_0062268 | 3300044765 | Bacteria | 1999 |
| 422 | Ga0466970_0085233 | 3300044765 | Bacteria | 1711 |
| 423 | Ga0466970_0089529 | 3300044765 | Bacteria | 1670 |
| 424 | Ga0466957_0009048 | 3300044842 | Bacteria | 5677 |
| 425 | Ga0466957_0038118 | 3300044842 | Bacteria | 2895 |
| 426 | Ga0466957_0082622 | 3300044842 | Bacteria | 2002 |
| 427 | Ga0466957_0259247 | 3300044842 | Bacteria | 1158 |
| 428 | Ga0466957_0384051 | 3300044842 | Bacteria | 958 |
| 429 | Ga0466960_0006623 | 3300044901 | Bacteria | 4656 |
| 430 | Ga0466960_0011671 | 3300044901 | Bacteria | 3685 |
| 431 | Ga0466959_0004589 | 3300045049 | Bacteria | 9271 |
| 432 | Ga0466959_0015693 | 3300045049 | Bacteria | 5524 |
| 433 | Ga0466959_0035420 | 3300045049 | Bacteria | 3691 |
| 434 | Ga0466959_0054449 | 3300045049 | Bacteria | 2922 |
| 435 | Ga0466959_0082333 | 3300045049 | Bacteria | 2318 |
| 436 | Ga0466959_0175033 | 3300045049 | Bacteria | 1504 |
| 437 | Ga0466958_0000497 | 3300045836 | Bacteria | 16475 |
| 438 | Ga0466958_0007100 | 3300045836 | Bacteria | 6133 |
| 439 | Ga0466958_0059492 | 3300045836 | Bacteria | 2324 |
| 440 | Ga0466967_0016587 | 3300045976 | Bacteria | 5816 |
| 441 | Ga0466967_0031263 | 3300045976 | Bacteria | 4480 |
| 442 | Ga0466967_0343531 | 3300045976 | Bacteria | 1444 |
| 443 | Ga0466967_0361002 | 3300045976 | Bacteria | 1408 |
| 444 | Ga0466967_1254024 | 3300045976 | Bacteria | 738 |
| 445 | Ga0495638_0002231 | 3300046460 | Bacteria | 16096 |
| 446 | Ga0495638_0027079 | 3300046460 | Bacteria | 3712 |
| 447 | Ga0495650_0197241 | 3300046471 | Bacteria | 701 |
| 448 | Ga0495639_0101478 | 3300046475 | Bacteria | 1359 |
| 449 | Ga0495594_0043107 | 3300046499 | Bacteria | 2473 |
| 450 | Ga0495583_0024314 | 3300046506 | Bacteria | 3047 |
| 451 | Ga0495606_0012713 | 3300046507 | Bacteria | 6714 |
| 452 | Ga0495648_0030180 | 3300046524 | Bacteria | 3588 |
| 453 | Ga0495648_0122079 | 3300046524 | Bacteria | 1399 |
| 454 | Ga0495654_0237520 | 3300046530 | Bacteria | 764 |
| 455 | Ga0495668_0019625 | 3300046616 | Bacteria | 3895 |
| 456 | Ga0495625_0104502 | 3300046660 | Bacteria | 1942 |
| 457 | Ga0495599_0578417 | 3300046678 | Bacteria | 656 |
| 458 | Ga0495646_0071267 | 3300046680 | Bacteria | 2045 |
| 459 | Ga0495624_0238464 | 3300046690 | Bacteria | 1101 |
| 460 | Ga0495671_0131728 | 3300046692 | Bacteria | 1219 |
| 461 | Ga0495671_0194947 | 3300046692 | Bacteria | 983 |
| 462 | Ga0495649_0121981 | 3300046694 | Bacteria | 1378 |
| 463 | Ga0495672_0009317 | 3300047320 | Bacteria | 7129 |
| 464 | Ga0495677_0131580 | 3300047445 | Bacteria | 958 |
| 465 | Ga0495673_0001390 | 3300047469 | Bacteria | 19469 |
| 466 | Ga0495686_0001263 | 3300047472 | Bacteria | 28679 |
| 467 | Ga0495686_0059301 | 3300047472 | Bacteria | 2383 |
| 468 | Ga0495593_0032488 | 3300047673 | Bacteria | 2845 |
| 469 | Ga0495602_0598862 | 3300048088 | Bacteria | 758 |
| 470 | Ga0495626_0051366 | 3300048091 | Bacteria | 1902 |
| 471 | Ga0496100_0000352 | 3300048903 | Bacteria | 22372 |
| 472 | Ga0496100_0000705 | 3300048903 | Bacteria | 15943 |
| 473 | Ga0496100_0058311 | 3300048903 | Bacteria | 2533 |
| 474 | Ga0496100_0282630 | 3300048903 | Bacteria | 1237 |
| 475 | Ga0496101_0000043 | 3300048904 | Bacteria | 161643 |
| 476 | Ga0496101_0000334 | 3300048904 | Bacteria | 32314 |
| 477 | Ga0496101_0012446 | 3300048904 | Bacteria | 5678 |
| 478 | Ga0496101_0019852 | 3300048904 | Bacteria | 4595 |
| 479 | Ga0496101_0062885 | 3300048904 | Bacteria | 2700 |
| 480 | Ga0496101_0125414 | 3300048904 | Bacteria | 1945 |
| 481 | Ga0496101_0162900 | 3300048904 | Bacteria | 1711 |
| 482 | Ga0496101_0560099 | 3300048904 | Bacteria | 904 |
| 483 | Ga0496102_0000026 | 3300048905 | Bacteria | 227176 |
| 484 | Ga0496102_0000399 | 3300048905 | Bacteria | 50723 |
| 485 | Ga0496102_0003400 | 3300048905 | Bacteria | 13492 |
| 486 | Ga0496102_0015077 | 3300048905 | Bacteria | 6728 |
| 487 | Ga0496102_0024824 | 3300048905 | Bacteria | 5332 |
| 488 | Ga0496102_0040241 | 3300048905 | Bacteria | 4227 |
| 489 | Ga0496102_0048307 | 3300048905 | Bacteria | 3869 |
| 490 | Ga0496102_0097736 | 3300048905 | Bacteria | 2723 |
| 491 | Ga0496102_0164171 | 3300048905 | Bacteria | 2089 |
| 492 | Ga0496102_0185985 | 3300048905 | Bacteria | 1958 |
| 493 | Ga0496102_0514431 | 3300048905 | Bacteria | 1119 |
| 494 | Ga0496103_0000023 | 3300048906 | Bacteria | 227174 |
| 495 | Ga0496103_0000810 | 3300048906 | Bacteria | 22943 |
| 496 | Ga0496103_0001912 | 3300048906 | Bacteria | 13531 |
| 497 | Ga0496103_0012078 | 3300048906 | Bacteria | 5130 |
| 498 | Ga0496103_0044538 | 3300048906 | Bacteria | 2734 |
| 499 | Ga0496103_0171360 | 3300048906 | Bacteria | 1394 |
| 500 | Ga0496103_0431736 | 3300048906 | Bacteria | 845 |
| 501 | Ga0496103_0839024 | 3300048906 | Bacteria | 578 |
| 502 | Ga0496104_0009859 | 3300048907 | Bacteria | 8525 |
| 503 | Ga0496104_0011789 | 3300048907 | Bacteria | 7844 |
| 504 | Ga0496105_0003671 | 3300048908 | Bacteria | 11418 |
| 505 | Ga0496105_0255170 | 3300048908 | Bacteria | 1420 |
| 506 | Ga0496105_0494012 | 3300048908 | Bacteria | 961 |
| 507 | Ga0496106_0000468 | 3300048909 | Bacteria | 28886 |
| 508 | Ga0496106_0007395 | 3300048909 | Bacteria | 8115 |
| 509 | Ga0496106_0007669 | 3300048909 | Bacteria | 7984 |
| 510 | Ga0496106_0014919 | 3300048909 | Bacteria | 5747 |
| 511 | Ga0496106_0054562 | 3300048909 | Bacteria | 3019 |
| 512 | Ga0496106_0144006 | 3300048909 | Bacteria | 1876 |
| 513 | Ga0496106_1118506 | 3300048909 | Bacteria | 617 |
| 514 | Ga0496107_0002086 | 3300048910 | Bacteria | 12797 |
| 515 | Ga0496107_0006524 | 3300048910 | Bacteria | 8028 |
| 516 | Ga0496107_0024564 | 3300048910 | Bacteria | 4263 |
| 517 | Ga0496107_0035281 | 3300048910 | Bacteria | 3586 |
| 518 | Ga0496107_0404182 | 3300048910 | Bacteria | 1015 |
| 519 | Ga0496107_0727536 | 3300048910 | Bacteria | 729 |
| 520 | Ga0496108_0015094 | 3300048911 | Bacteria | 6305 |
| 521 | Ga0496108_0022472 | 3300048911 | Bacteria | 5185 |
| 522 | Ga0496108_0100835 | 3300048911 | Bacteria | 2462 |
| 523 | Ga0496108_0137539 | 3300048911 | Bacteria | 2103 |
| 524 | Ga0496109_0000145 | 3300048912 | Bacteria | 70505 |
| 525 | Ga0496109_0059123 | 3300048912 | Bacteria | 3502 |
| 526 | Ga0496109_0079556 | 3300048912 | Bacteria | 3020 |
| 527 | Ga0496109_1018847 | 3300048912 | Bacteria | 765 |
| 528 | Ga0496110_0001427 | 3300048913 | Bacteria | 17264 |
| 529 | Ga0496110_0050326 | 3300048913 | Bacteria | 3658 |
| 530 | Ga0496110_0544068 | 3300048913 | Bacteria | 1055 |
| 531 | Ga0496110_0738573 | 3300048913 | Bacteria | 887 |
| 532 | Ga0496111_0025844 | 3300048914 | Bacteria | 4143 |
| 533 | Ga0496111_0141310 | 3300048914 | Bacteria | 1784 |
| 534 | Ga0496112_0015732 | 3300048915 | Bacteria | 7066 |
| 535 | Ga0496112_0032148 | 3300048915 | Bacteria | 5094 |
| 536 | Ga0496112_0080355 | 3300048915 | Bacteria | 3224 |
| 537 | Ga0496112_0128650 | 3300048915 | Bacteria | 2503 |
| 538 | Ga0496112_0198611 | 3300048915 | Bacteria | 1966 |
| 539 | Ga0496112_0489454 | 3300048915 | Bacteria | 1166 |
| 540 | Ga0496113_0014152 | 3300048916 | Bacteria | 5433 |
| 541 | Ga0496113_0086709 | 3300048916 | Bacteria | 2406 |
| 542 | Ga0496113_0608395 | 3300048916 | Bacteria | 875 |
| 543 | Ga0496114_0000114 | 3300048917 | Bacteria | 58128 |
| 544 | Ga0496114_0000219 | 3300048917 | Bacteria | 41685 |
| 545 | Ga0496114_0003519 | 3300048917 | Bacteria | 12020 |
| 546 | Ga0496114_0380880 | 3300048917 | Bacteria | 1249 |
| 547 | Ga0496114_0753973 | 3300048917 | Bacteria | 851 |
| 548 | Ga0496115_0004933 | 3300048918 | Bacteria | 9690 |
| 549 | Ga0496115_0007642 | 3300048918 | Bacteria | 7965 |
| 550 | Ga0496115_0015424 | 3300048918 | Bacteria | 5795 |
| 551 | Ga0496115_0410328 | 3300048918 | Bacteria | 1098 |
| 552 | Ga0496115_0457717 | 3300048918 | Bacteria | 1030 |
| 553 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 554 | Ga0496116_0010244 | 3300048919 | Bacteria | 7881 |
| 555 | Ga0496116_0040893 | 3300048919 | Bacteria | 3186 |
| 556 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 557 | Ga0496117_0000949 | 3300048920 | Bacteria | 44310 |
| 558 | Ga0496117_0043172 | 3300048920 | Bacteria | 3281 |
| 559 | Ga0496117_0087999 | 3300048920 | Bacteria | 2011 |
| 560 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 561 | Ga0496118_0001082 | 3300048921 | Bacteria | 42392 |
| 562 | Ga0496118_0002246 | 3300048921 | Bacteria | 26541 |
| 563 | Ga0496118_0046155 | 3300048921 | Bacteria | 3392 |
| 564 | Ga0496119_0008652 | 3300048922 | Bacteria | 8907 |
| 565 | Ga0496119_0011233 | 3300048922 | Bacteria | 7448 |
| 566 | Ga0496119_0018923 | 3300048922 | Bacteria | 5100 |
| 567 | Ga0496119_0037856 | 3300048922 | Bacteria | 3126 |
| 568 | Ga0496119_0292880 | 3300048922 | Bacteria | 805 |
| 569 | Ga0496120_0001092 | 3300048923 | Bacteria | 35424 |
| 570 | Ga0496120_0004932 | 3300048923 | Bacteria | 10860 |
| 571 | Ga0496120_0008670 | 3300048923 | Bacteria | 7336 |
| 572 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 573 | Ga0496121_0001957 | 3300048924 | Bacteria | 32787 |
| 574 | Ga0496121_0008355 | 3300048924 | Bacteria | 12217 |
| 575 | Ga0496121_0237309 | 3300048924 | Bacteria | 1273 |
| 576 | Ga0496121_0433899 | 3300048924 | Bacteria | 851 |
| 577 | Ga0496122_0001790 | 3300048925 | Bacteria | 32891 |
| 578 | Ga0496122_0027183 | 3300048925 | Bacteria | 4900 |
| 579 | Ga0496123_0004860 | 3300048926 | Bacteria | 13837 |
| 580 | Ga0496123_0035257 | 3300048926 | Bacteria | 3568 |
| 581 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 582 | Ga0496124_0238381 | 3300048927 | Bacteria | 1354 |
| 583 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 584 | Ga0496125_0024576 | 3300048928 | Bacteria | 5537 |
| 585 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 586 | Ga0496126_0001404 | 3300048929 | Bacteria | 38113 |
| 587 | Ga0496126_0005459 | 3300048929 | Bacteria | 14506 |
| 588 | Ga0496126_0007833 | 3300048929 | Bacteria | 11643 |
| 589 | Ga0496126_0009216 | 3300048929 | Bacteria | 10528 |
| 590 | Ga0496126_0029386 | 3300048929 | Bacteria | 5222 |
| 591 | Ga0496126_0674726 | 3300048929 | Bacteria | 806 |
| 592 | Ga0501032_0023689 | 3300049569 | Bacteria | 4238 |
| 593 | Ga0501032_0027334 | 3300049569 | Bacteria | 3921 |
| 594 | Ga0501033_0038422 | 3300049570 | Bacteria | 3578 |
| 595 | Ga0501033_0052864 | 3300049570 | Bacteria | 3010 |
| 596 | Ga0501034_0031795 | 3300049571 | Bacteria | 5360 |
| 597 | Ga0501034_0050343 | 3300049571 | Bacteria | 4202 |
| 598 | Ga0501034_0318956 | 3300049571 | Bacteria | 1487 |
| 599 | Ga0501034_0646412 | 3300049571 | Bacteria | 960 |
| 600 | Ga0501036_0109926 | 3300049572 | Bacteria | 2329 |
| 601 | Ga0501037_0001577 | 3300049573 | Bacteria | 16616 |
| 602 | Ga0501038_0002175 | 3300049574 | Bacteria | 18216 |
| 603 | Ga0501039_0000592 | 3300049575 | Bacteria | 26174 |
| 604 | Ga0501040_0368344 | 3300049576 | Bacteria | 1030 |
| 605 | Ga0501046_0184116 | 3300049580 | Bacteria | 1560 |
| 606 | Ga0501047_0027261 | 3300049581 | Bacteria | 5503 |
| 607 | Ga0501047_0527805 | 3300049581 | Bacteria | 1006 |
| 608 | Ga0501067_0158838 | 3300049583 | Bacteria | 1259 |
| 609 | Ga0501068_0081972 | 3300049584 | Bacteria | 1981 |
| 610 | Ga0501069_0203010 | 3300049585 | Bacteria | 1149 |
| 611 | Ga0501069_0423667 | 3300049585 | Bacteria | 789 |
| 612 | Ga0501070_0052506 | 3300049586 | Bacteria | 3383 |
| 613 | Ga0501070_0081520 | 3300049586 | Bacteria | 2677 |
| 614 | Ga0501070_0115221 | 3300049586 | Bacteria | 2220 |
| 615 | Ga0501070_0230851 | 3300049586 | Bacteria | 1516 |
| 616 | Ga0501070_0698863 | 3300049586 | Bacteria | 802 |
| 617 | Ga0501073_0073091 | 3300049589 | Bacteria | 2388 |
| 618 | Ga0501073_0669089 | 3300049589 | Bacteria | 716 |
| 619 | Ga0501077_0141161 | 3300049593 | Bacteria | 1528 |
| 620 | Ga0501035_0000820 | 3300049822 | Bacteria | 33171 |
| 621 | Ga0501035_0504767 | 3300049822 | Bacteria | 995 |
| 622 | Ga0501044_0001122 | 3300049823 | Bacteria | 31796 |
| 623 | Ga0501044_0016151 | 3300049823 | Bacteria | 8025 |
| 624 | nmdc:mga03683_231739_c1 | 3300050489 | Bacteria | 854 |
| 625 | nmdc:mga03683_97060_c1 | 3300050489 | Bacteria | 1291 |
| 626 | nmdc:mga03n38_139131_c1 | 3300050490 | Bacteria | 1211 |
| 627 | nmdc:mga03n38_166575_c1 | 3300050490 | Bacteria | 1119 |
| 628 | nmdc:mga03n38_173282_c1 | 3300050490 | Bacteria | 1100 |
| 629 | nmdc:mga03n38_251055_c1 | 3300050490 | Bacteria | 934 |
| 630 | nmdc:mga03n38_28527_c1 | 3300050490 | Bacteria | 2328 |
| 631 | nmdc:mga03n38_445760_c1 | 3300050490 | Bacteria | 719 |
| 632 | nmdc:mga03n38_470_c1 | 3300050490 | Bacteria | 10073 |
| 633 | nmdc:mga03n38_62840_c1 | 3300050490 | Bacteria | 1695 |
| 634 | nmdc:mga03n38_65722_c1 | 3300050490 | Bacteria | 1664 |
| 635 | nmdc:mga03n38_68896_c1 | 3300050490 | Bacteria | 1632 |
| 636 | nmdc:mga00v17_11316_c1 | 3300050491 | Bacteria | 4904 |
| 637 | nmdc:mga00v17_137957_c1 | 3300050491 | Bacteria | 1562 |
| 638 | nmdc:mga00v17_17732_c1 | 3300050491 | Bacteria | 4036 |
| 639 | nmdc:mga00v17_193371_c1 | 3300050491 | Bacteria | 1314 |
| 640 | nmdc:mga00v17_5523_c1 | 3300050491 | Bacteria | 6664 |
| 641 | nmdc:mga00v17_57809_c1 | 3300050491 | Bacteria | 2373 |
| 642 | nmdc:mga00v17_6121_c1 | 3300050491 | Bacteria | 6372 |
| 643 | nmdc:mga00v17_6850_c1 | 3300050491 | Bacteria | 6058 |
| 644 | nmdc:mga00v17_72591_c1 | 3300050491 | Bacteria | 2135 |
| 645 | nmdc:mga00v17_77884_c1 | 3300050491 | Bacteria | 2065 |
| 646 | nmdc:mga00v17_90032_c1 | 3300050491 | Bacteria | 1926 |
| 647 | nmdc:mga0yw44_141040_c1 | 3300050492 | Bacteria | 1566 |
| 648 | nmdc:mga0yw44_38071_c1 | 3300050492 | Bacteria | 2843 |
| 649 | nmdc:mga0yw44_417360_c1 | 3300050492 | Bacteria | 908 |
| 650 | nmdc:mga0yw44_48716_c1 | 3300050492 | Bacteria | 2555 |
| 651 | nmdc:mga0yw44_53417_c1 | 3300050492 | Bacteria | 2454 |
| 652 | nmdc:mga0yw44_6091_c1 | 3300050492 | Bacteria | 5785 |
| 653 | nmdc:mga0yw44_707801_c1 | 3300050492 | Bacteria | 684 |
| 654 | nmdc:mga06z11_162782_c1 | 3300050494 | Bacteria | 1276 |
| 655 | nmdc:mga06z11_733581_c1 | 3300050494 | Bacteria | 602 |
| 656 | nmdc:mga06z11_8521_c1 | 3300050494 | Bacteria | 4283 |
| 657 | nmdc:mga06z11_89376_c1 | 3300050494 | Bacteria | 1669 |
| 658 | nmdc:mga04h51_102732_c1 | 3300050495 | Bacteria | 1044 |
| 659 | nmdc:mga07m45_111049_c1 | 3300050496 | Bacteria | 1579 |
| 660 | nmdc:mga07m45_20628_c1 | 3300050496 | Bacteria | 3581 |
| 661 | nmdc:mga07m45_218350_c1 | 3300050496 | Bacteria | 1109 |
| 662 | nmdc:mga07m45_332572_c1 | 3300050496 | Bacteria | 883 |
| 663 | nmdc:mga05p37_353386_c1 | 3300050507 | Bacteria | 1730 |
| 664 | nmdc:mga06r32_34381_c1 | 3300050510 | Bacteria | 4779 |
| 665 | nmdc:mga0sz30_129426_c1 | 3300050516 | Bacteria | 1112 |
| 666 | nmdc:mga0sz30_16957_c1 | 3300050516 | Bacteria | 2899 |
| 667 | nmdc:mga0sz30_21553_c1 | 3300050516 | Bacteria | 2609 |
| 668 | nmdc:mga0sz30_355232_c1 | 3300050516 | Bacteria | 655 |
| 669 | nmdc:mga0sz30_42655_c1 | 3300050516 | Bacteria | 1909 |
| 670 | nmdc:mga0sz30_5891_c1 | 3300050516 | Bacteria | 4522 |
| 671 | nmdc:mga0sz30_83701_c1 | 3300050516 | Bacteria | 1382 |
| 672 | nmdc:mga0sz30_95227_c1 | 3300050516 | Bacteria | 1298 |
| 673 | Ga0500610_0008918 | 3300053079 | Bacteria | 4403 |
| 674 | Ga0500635_0023623 | 3300053080 | Bacteria | 1920 |
| 675 | Ga0500635_0091907 | 3300053080 | Bacteria | 1105 |
| 676 | Ga0495655_0123468 | 3300053083 | Bacteria | 790 |
| 677 | Ga0500643_001848 | 3300053087 | Bacteria | 11550 |
| 678 | Ga0500641_0047920 | 3300053096 | Bacteria | 1749 |
| 679 | Ga0500556_0034498 | 3300053104 | Bacteria | 1741 |
| 680 | Ga0500562_023074 | 3300053108 | Bacteria | 1623 |
| 681 | Ga0500608_201445 | 3300053122 | Bacteria | 822 |
| 682 | Ga0500652_000414 | 3300053131 | Bacteria | 15311 |
| 683 | Ga0500655_021592 | 3300053133 | Bacteria | 1208 |
| 684 | Ga0500559_0181051 | 3300053136 | Bacteria | 993 |
| 685 | Ga0500616_0003901 | 3300053153 | Bacteria | 10973 |
| 686 | Ga0500616_0056012 | 3300053153 | Bacteria | 2059 |
| 687 | Ga0500627_0006781 | 3300053158 | Bacteria | 3931 |
| 688 | Ga0500645_000004 | 3300053730 | Bacteria | 305014 |
| 689 | Ga0500645_072382 | 3300053730 | Bacteria | 988 |
| 690 | Ga0466962_0005499 | 3300061719 | Bacteria | 6088 |
| 691 | Ga0466962_0009015 | 3300061719 | Bacteria | 4778 |
| 692 | Ga0466962_0146567 | 3300061719 | Bacteria | 1145 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005548 | Ga0070665_100117844 | Ga0070665_1001178441 | 167 |
| 2 | 3300005617 | Ga0068859_100068346 | Ga0068859_1000683463 | 167 |
| 3 | 3300005841 | Ga0068863_100000579 | Ga0068863_10000057920 | 167 |
| 4 | 3300005842 | Ga0068858_100004272 | Ga0068858_1000042728 | 167 |
| 5 | 3300005843 | Ga0068860_100000480 | Ga0068860_10000048015 | 167 |
| 6 | 3300006042 | Ga0075368_10129997 | Ga0075368_101299972 | 167 |
| 7 | 3300006048 | Ga0075363_100007885 | Ga0075363_1000078854 | 167 |
| 8 | 3300006048 | Ga0075363_100011621 | Ga0075363_1000116213 | 167 |
| 9 | 3300006177 | Ga0075362_10054338 | Ga0075362_100543383 | 167 |
| 10 | 3300006177 | Ga0075362_10074768 | Ga0075362_100747682 | 167 |
| 11 | 3300006178 | Ga0075367_10058190 | Ga0075367_100581902 | 167 |
| 12 | 3300006186 | Ga0075369_10052481 | Ga0075369_100524812 | 167 |
| 13 | 3300006931 | Ga0097620_100068354 | Ga0097620_1000683543 | 167 |
| 14 | 3300009101 | Ga0105247_10000046 | Ga0105247_1000004610 | 167 |
| 15 | 3300009553 | Ga0105249_10000282 | Ga0105249_1000028238 | 167 |
| 16 | 3300031824 | Ga0307413_10163691 | Ga0307413_101636912 | 167 |
| 17 | iso_pu_bacteria | 2738541264 | 2738663920 | 168 |
| 18 | iso_pu_bacteria | 2738541356 | 2739143055 | 168 |
| 19 | 3300003320 | rootH2_10123861 | rootH2_101238614 | 169 |
| 20 | 3300005434 | Ga0070709_10052548 | Ga0070709_100525484 | 169 |
| 21 | 3300005435 | Ga0070714_100023392 | Ga0070714_1000233926 | 169 |
| 22 | 3300005436 | Ga0070713_100327349 | Ga0070713_1003273491 | 169 |
| 23 | 3300005937 | Ga0081455_10195817 | Ga0081455_101958172 | 169 |
| 24 | 3300006028 | Ga0070717_10154177 | Ga0070717_101541771 | 169 |
| 25 | 3300006051 | Ga0075364_10010306 | Ga0075364_100103065 | 169 |
| 26 | 3300006051 | Ga0075364_10613602 | Ga0075364_106136021 | 169 |
| 27 | 3300006173 | Ga0070716_100361650 | Ga0070716_1003616502 | 169 |
| 28 | 3300006186 | Ga0075369_10002618 | Ga0075369_100026184 | 169 |
| 29 | 3300006353 | Ga0075370_10134184 | Ga0075370_101341842 | 169 |
| 30 | 3300021384 | Ga0213876_10029181 | Ga0213876_100291813 | 169 |
| 31 | 3300025906 | Ga0207699_10270658 | Ga0207699_102706581 | 169 |
| 32 | 3300025928 | Ga0207700_11377300 | Ga0207700_113773001 | 169 |
| 33 | 3300025929 | Ga0207664_10145795 | Ga0207664_101457953 | 169 |
| 34 | 3300025929 | Ga0207664_10341953 | Ga0207664_103419531 | 169 |
| 35 | 3300044694 | Ga0466963_0049093 | Ga0466963_0049093_994_1515 | 169 |
| 36 | 3300049570 | Ga0501033_0052864 | Ga0501033_0052864_898_1419 | 169 |
| 37 | 3300049586 | Ga0501070_0115221 | Ga0501070_0115221_1588_2109 | 169 |
| 38 | 3300049822 | Ga0501035_0504767 | Ga0501035_0504767_166_687 | 169 |
| 39 | 3300005617 | Ga0068859_101109847 | Ga0068859_1011098471 | 171 |
| 40 | 3300006931 | Ga0097620_101109851 | Ga0097620_1011098512 | 171 |
| 41 | 3300007788 | Ga0099795_10073885 | Ga0099795_100738852 | 171 |
| 42 | 3300014326 | Ga0157380_10441697 | Ga0157380_104416972 | 171 |
| 43 | 3300044656 | Ga0466969_0015876 | Ga0466969_0015876_2706_3233 | 171 |
| 44 | 3300044684 | Ga0466966_0020123 | Ga0466966_0020123_3608_4135 | 171 |
| 45 | 3300044684 | Ga0466966_0101098 | Ga0466966_0101098_55_582 | 171 |
| 46 | 3300044693 | Ga0466961_0032568 | Ga0466961_0032568_1095_1622 | 171 |
| 47 | 3300044694 | Ga0466963_0065942 | Ga0466963_0065942_511_1038 | 171 |
| 48 | 3300044765 | Ga0466970_0006101 | Ga0466970_0006101_4518_5045 | 171 |
| 49 | 3300044842 | Ga0466957_0259247 | Ga0466957_0259247_573_1100 | 171 |
| 50 | 3300045049 | Ga0466959_0035420 | Ga0466959_0035420_2654_3181 | 171 |
| 51 | 3300045836 | Ga0466958_0059492 | Ga0466958_0059492_717_1244 | 171 |
| 52 | 3300045976 | Ga0466967_1254024 | Ga0466967_1254024_171_698 | 171 |
| 53 | 3300048929 | Ga0496126_0674726 | Ga0496126_0674726_29_553 | 171 |
| 54 | 3300049569 | Ga0501032_0023689 | Ga0501032_0023689_3583_4098 | 171 |
| 55 | 3300049571 | Ga0501034_0031795 | Ga0501034_0031795_1744_2259 | 171 |
| 56 | 3300049571 | Ga0501034_0646412 | Ga0501034_0646412_111_635 | 171 |
| 57 | 3300049573 | Ga0501037_0001577 | Ga0501037_0001577_13841_14356 | 171 |
| 58 | 3300049574 | Ga0501038_0002175 | Ga0501038_0002175_14016_14531 | 171 |
| 59 | 3300049575 | Ga0501039_0000592 | Ga0501039_0000592_11935_12450 | 171 |
| 60 | 3300049576 | Ga0501040_0368344 | Ga0501040_0368344_140_655 | 171 |
| 61 | 3300049581 | Ga0501047_0527805 | Ga0501047_0527805_30_545 | 171 |
| 62 | 3300049583 | Ga0501067_0158838 | Ga0501067_0158838_462_977 | 171 |
| 63 | 3300049584 | Ga0501068_0081972 | Ga0501068_0081972_971_1486 | 171 |
| 64 | 3300049585 | Ga0501069_0203010 | Ga0501069_0203010_209_733 | 171 |
| 65 | 3300049586 | Ga0501070_0052506 | Ga0501070_0052506_2478_2993 | 171 |
| 66 | 3300049586 | Ga0501070_0081520 | Ga0501070_0081520_96_620 | 171 |
| 67 | 3300049589 | Ga0501073_0669089 | Ga0501073_0669089_17_532 | 171 |
| 68 | 3300049593 | Ga0501077_0141161 | Ga0501077_0141161_177_692 | 171 |
| 69 | 3300053136 | Ga0500559_0181051 | Ga0500559_0181051_451_978 | 171 |
| 70 | 3300003792 | Ga0055540_1000127 | Ga0055540_100012730 | 172 |
| 71 | 3300003792 | Ga0055540_1001246 | Ga0055540_10012465 | 172 |
| 72 | 3300005327 | Ga0070658_10207606 | Ga0070658_102076062 | 172 |
| 73 | 3300005329 | Ga0070683_100177618 | Ga0070683_1001776182 | 172 |
| 74 | 3300005337 | Ga0070682_100021179 | Ga0070682_1000211792 | 172 |
| 75 | 3300005345 | Ga0070692_10156272 | Ga0070692_101562722 | 172 |
| 76 | 3300005347 | Ga0070668_100021378 | Ga0070668_1000213783 | 172 |
| 77 | 3300005367 | Ga0070667_100000364 | Ga0070667_10000036412 | 172 |
| 78 | 3300005367 | Ga0070667_100013540 | Ga0070667_1000135405 | 172 |
| 79 | 3300005367 | Ga0070667_100028973 | Ga0070667_1000289735 | 172 |
| 80 | 3300005438 | Ga0070701_10051662 | Ga0070701_100516623 | 172 |
| 81 | 3300005441 | Ga0070700_100110398 | Ga0070700_1001103982 | 172 |
| 82 | 3300005455 | Ga0070663_100162974 | Ga0070663_1001629742 | 172 |
| 83 | 3300005539 | Ga0068853_100699108 | Ga0068853_1006991082 | 172 |
| 84 | 3300005548 | Ga0070665_100910357 | Ga0070665_1009103571 | 172 |
| 85 | 3300005614 | Ga0068856_102139843 | Ga0068856_1021398431 | 172 |
| 86 | 3300005617 | Ga0068859_100892695 | Ga0068859_1008926952 | 172 |
| 87 | 3300005841 | Ga0068863_100040179 | Ga0068863_1000401792 | 172 |
| 88 | 3300005843 | Ga0068860_100294292 | Ga0068860_1002942922 | 172 |
| 89 | 3300005843 | Ga0068860_100583968 | Ga0068860_1005839682 | 172 |
| 90 | 3300005844 | Ga0068862_100000771 | Ga0068862_10000077128 | 172 |
| 91 | 3300005844 | Ga0068862_100521581 | Ga0068862_1005215812 | 172 |
| 92 | 3300006038 | Ga0075365_10021995 | Ga0075365_100219952 | 172 |
| 93 | 3300006038 | Ga0075365_10056206 | Ga0075365_100562063 | 172 |
| 94 | 3300006038 | Ga0075365_10084460 | Ga0075365_100844602 | 172 |
| 95 | 3300006048 | Ga0075363_100002354 | Ga0075363_1000023549 | 172 |
| 96 | 3300006048 | Ga0075363_100023828 | Ga0075363_1000238282 | 172 |
| 97 | 3300006051 | Ga0075364_10021217 | Ga0075364_100212171 | 172 |
| 98 | 3300006051 | Ga0075364_10029642 | Ga0075364_100296424 | 172 |
| 99 | 3300006051 | Ga0075364_10226318 | Ga0075364_102263182 | 172 |
| 100 | 3300006051 | Ga0075364_10262257 | Ga0075364_102622572 | 172 |
| 101 | 3300006175 | Ga0070712_100406092 | Ga0070712_1004060922 | 172 |
| 102 | 3300006177 | Ga0075362_10055545 | Ga0075362_100555452 | 172 |
| 103 | 3300006178 | Ga0075367_10171850 | Ga0075367_101718501 | 172 |
| 104 | 3300006186 | Ga0075369_10008806 | Ga0075369_100088062 | 172 |
| 105 | 3300006186 | Ga0075369_10033991 | Ga0075369_100339913 | 172 |
| 106 | 3300006353 | Ga0075370_10001066 | Ga0075370_1000106613 | 172 |
| 107 | 3300006353 | Ga0075370_10020604 | Ga0075370_100206044 | 172 |
| 108 | 3300006847 | Ga0075431_100066099 | Ga0075431_1000660993 | 172 |
| 109 | 3300006880 | Ga0075429_101200601 | Ga0075429_1012006011 | 172 |
| 110 | 3300006931 | Ga0097620_100892679 | Ga0097620_1008926792 | 172 |
| 111 | 3300009098 | Ga0105245_10425264 | Ga0105245_104252642 | 172 |
| 112 | 3300009147 | Ga0114129_10001921 | Ga0114129_1000192115 | 172 |
| 113 | 3300009174 | Ga0105241_10768780 | Ga0105241_107687802 | 172 |
| 114 | 3300009176 | Ga0105242_11562406 | Ga0105242_115624061 | 172 |
| 115 | 3300009177 | Ga0105248_10002475 | Ga0105248_1000247513 | 172 |
| 116 | 3300009177 | Ga0105248_10848985 | Ga0105248_108489852 | 172 |
| 117 | 3300009551 | Ga0105238_10103326 | Ga0105238_101033262 | 172 |
| 118 | 3300009553 | Ga0105249_10014945 | Ga0105249_100149454 | 172 |
| 119 | 3300010375 | Ga0105239_10051118 | Ga0105239_100511184 | 172 |
| 120 | 3300011119 | Ga0105246_10442906 | Ga0105246_104429062 | 172 |
| 121 | 3300013296 | Ga0157374_11557398 | Ga0157374_115573981 | 172 |
| 122 | 3300013306 | Ga0163162_10979736 | Ga0163162_109797362 | 172 |
| 123 | 3300013306 | Ga0163162_11362295 | Ga0163162_113622951 | 172 |
| 124 | 3300013307 | Ga0157372_11721219 | Ga0157372_117212191 | 172 |
| 125 | 3300013308 | Ga0157375_11563410 | Ga0157375_115634101 | 172 |
| 126 | 3300014325 | Ga0163163_10019646 | Ga0163163_100196469 | 172 |
| 127 | 3300014497 | Ga0182008_10191058 | Ga0182008_101910582 | 172 |
| 128 | 3300014745 | Ga0157377_10201530 | Ga0157377_102015301 | 172 |
| 129 | 3300014968 | Ga0157379_10597297 | Ga0157379_105972972 | 172 |
| 130 | 3300014969 | Ga0157376_10826135 | Ga0157376_108261351 | 172 |
| 131 | 3300025273 | Ga0209673_1011327 | Ga0209673_10113272 | 172 |
| 132 | 3300025303 | Ga0209051_1000014 | Ga0209051_100001494 | 172 |
| 133 | 3300025303 | Ga0209051_1000292 | Ga0209051_100029216 | 172 |
| 134 | 3300025303 | Ga0209051_1014196 | Ga0209051_10141962 | 172 |
| 135 | 3300025903 | Ga0207680_10159436 | Ga0207680_101594362 | 172 |
| 136 | 3300025914 | Ga0207671_10058855 | Ga0207671_100588554 | 172 |
| 137 | 3300025914 | Ga0207671_10318402 | Ga0207671_103184021 | 172 |
| 138 | 3300025924 | Ga0207694_10980209 | Ga0207694_109802091 | 172 |
| 139 | 3300025933 | Ga0207706_10241679 | Ga0207706_102416792 | 172 |
| 140 | 3300025942 | Ga0207689_10521320 | Ga0207689_105213201 | 172 |
| 141 | 3300025944 | Ga0207661_10387164 | Ga0207661_103871642 | 172 |
| 142 | 3300025972 | Ga0207668_10158033 | Ga0207668_101580332 | 172 |
| 143 | 3300025986 | Ga0207658_10001676 | Ga0207658_100016765 | 172 |
| 144 | 3300025986 | Ga0207658_10080480 | Ga0207658_100804803 | 172 |
| 145 | 3300026041 | Ga0207639_10178928 | Ga0207639_101789283 | 172 |
| 146 | 3300026088 | Ga0207641_10188863 | Ga0207641_101888632 | 172 |
| 147 | 3300028379 | Ga0268266_10459970 | Ga0268266_104599702 | 172 |
| 148 | 3300028380 | Ga0268265_10000738 | Ga0268265_1000073828 | 172 |
| 149 | 3300031251 | Ga0265327_10001010 | Ga0265327_1000101016 | 172 |
| 150 | 3300031824 | Ga0307413_10540792 | Ga0307413_105407922 | 172 |
| 151 | 3300031903 | Ga0307407_10246981 | Ga0307407_102469812 | 172 |
| 152 | 3300032002 | Ga0307416_100858624 | Ga0307416_1008586242 | 172 |
| 153 | 3300032004 | Ga0307414_10179078 | Ga0307414_101790782 | 172 |
| 154 | 3300032004 | Ga0307414_10300379 | Ga0307414_103003792 | 172 |
| 155 | 3300035241 | Ga0373961_0273036 | Ga0373961_0273036_79_597 | 172 |
| 156 | 3300035242 | Ga0373962_0157848 | Ga0373962_0157848_21_539 | 172 |
| 157 | 3300041411 | Ga0439466_0000072 | Ga0439466_0000072_3564_4085 | 172 |
| 158 | 3300041411 | Ga0439466_0013588 | Ga0439466_0013588_2122_2643 | 172 |
| 159 | 3300041413 | Ga0439465_0002086 | Ga0439465_0002086_993_1514 | 172 |
| 160 | 3300041413 | Ga0439465_0008430 | Ga0439465_0008430_2483_3001 | 172 |
| 161 | 3300041413 | Ga0439465_0062200 | Ga0439465_0062200_646_1167 | 172 |
| 162 | 3300041441 | Ga0451787_349234 | Ga0451787_349234_112_636 | 172 |
| 163 | 3300041443 | Ga0451789_0786144 | Ga0451789_0786144_261_785 | 172 |
| 164 | 3300041456 | Ga0451795_1067315 | Ga0451795_1067315_169_693 | 172 |
| 165 | 3300041460 | Ga0451802_1323411 | Ga0451802_1323411_243_767 | 172 |
| 166 | 3300041512 | Ga0451853_1978743 | Ga0451853_1978743_168_686 | 172 |
| 167 | 3300042002 | Ga0439442_021607 | Ga0439442_021607_463_981 | 172 |
| 168 | 3300042004 | Ga0439445_0006958 | Ga0439445_0006958_564_1085 | 172 |
| 169 | 3300042004 | Ga0439445_0040336 | Ga0439445_0040336_447_965 | 172 |
| 170 | 3300042016 | Ga0439463_117779 | Ga0439463_117779_146_676 | 172 |
| 171 | 3300042435 | Ga0439434_0022000 | Ga0439434_0022000_1161_1682 | 172 |
| 172 | 3300044658 | Ga0466972_0024140 | Ga0466972_0024140_231_755 | 172 |
| 173 | 3300044683 | Ga0466965_0061680 | Ga0466965_0061680_152_676 | 172 |
| 174 | 3300044706 | Ga0466964_0033938 | Ga0466964_0033938_1420_1938 | 172 |
| 175 | 3300044735 | Ga0466968_0008779 | Ga0466968_0008779_359_883 | 172 |
| 176 | 3300044735 | Ga0466968_0036351 | Ga0466968_0036351_1038_1556 | 172 |
| 177 | 3300044735 | Ga0466968_0094609 | Ga0466968_0094609_207_725 | 172 |
| 178 | 3300044765 | Ga0466970_0062268 | Ga0466970_0062268_1246_1770 | 172 |
| 179 | 3300044765 | Ga0466970_0085233 | Ga0466970_0085233_49_567 | 172 |
| 180 | 3300044842 | Ga0466957_0082622 | Ga0466957_0082622_959_1483 | 172 |
| 181 | 3300044842 | Ga0466957_0384051 | Ga0466957_0384051_250_768 | 172 |
| 182 | 3300044901 | Ga0466960_0011671 | Ga0466960_0011671_2389_2913 | 172 |
| 183 | 3300045049 | Ga0466959_0004589 | Ga0466959_0004589_1292_1816 | 172 |
| 184 | 3300045049 | Ga0466959_0015693 | Ga0466959_0015693_2001_2519 | 172 |
| 185 | 3300045976 | Ga0466967_0016587 | Ga0466967_0016587_2184_2708 | 172 |
| 186 | 3300045976 | Ga0466967_0031263 | Ga0466967_0031263_3582_4103 | 172 |
| 187 | 3300045976 | Ga0466967_0343531 | Ga0466967_0343531_383_901 | 172 |
| 188 | 3300046471 | Ga0495650_0197241 | Ga0495650_0197241_33_560 | 172 |
| 189 | 3300046524 | Ga0495648_0122079 | Ga0495648_0122079_743_1261 | 172 |
| 190 | 3300046530 | Ga0495654_0237520 | Ga0495654_0237520_46_567 | 172 |
| 191 | 3300046678 | Ga0495599_0578417 | Ga0495599_0578417_11_532 | 172 |
| 192 | 3300048088 | Ga0495602_0598862 | Ga0495602_0598862_152_673 | 172 |
| 193 | 3300048091 | Ga0495626_0051366 | Ga0495626_0051366_490_1008 | 172 |
| 194 | 3300048903 | Ga0496100_0282630 | Ga0496100_0282630_425_943 | 172 |
| 195 | 3300048904 | Ga0496101_0000334 | Ga0496101_0000334_28644_29165 | 172 |
| 196 | 3300048904 | Ga0496101_0019852 | Ga0496101_0019852_1869_2387 | 172 |
| 197 | 3300048904 | Ga0496101_0560099 | Ga0496101_0560099_73_591 | 172 |
| 198 | 3300048905 | Ga0496102_0000026 | Ga0496102_0000026_212191_212712 | 172 |
| 199 | 3300048905 | Ga0496102_0000399 | Ga0496102_0000399_10257_10775 | 172 |
| 200 | 3300048906 | Ga0496103_0000023 | Ga0496103_0000023_14463_14984 | 172 |
| 201 | 3300048906 | Ga0496103_0000810 | Ga0496103_0000810_8010_8528 | 172 |
| 202 | 3300048906 | Ga0496103_0839024 | Ga0496103_0839024_44_562 | 172 |
| 203 | 3300048909 | Ga0496106_0007669 | Ga0496106_0007669_1811_2332 | 172 |
| 204 | 3300048909 | Ga0496106_0144006 | Ga0496106_0144006_873_1391 | 172 |
| 205 | 3300048909 | Ga0496106_1118506 | Ga0496106_1118506_27_545 | 172 |
| 206 | 3300048910 | Ga0496107_0006524 | Ga0496107_0006524_6136_6654 | 172 |
| 207 | 3300048910 | Ga0496107_0727536 | Ga0496107_0727536_163_681 | 172 |
| 208 | 3300048911 | Ga0496108_0015094 | Ga0496108_0015094_1233_1751 | 172 |
| 209 | 3300048912 | Ga0496109_0079556 | Ga0496109_0079556_152_670 | 172 |
| 210 | 3300048912 | Ga0496109_1018847 | Ga0496109_1018847_62_580 | 172 |
| 211 | 3300048913 | Ga0496110_0544068 | Ga0496110_0544068_142_660 | 172 |
| 212 | 3300048914 | Ga0496111_0141310 | Ga0496111_0141310_629_1147 | 172 |
| 213 | 3300048915 | Ga0496112_0015732 | Ga0496112_0015732_1951_2469 | 172 |
| 214 | 3300048915 | Ga0496112_0032148 | Ga0496112_0032148_2828_3346 | 172 |
| 215 | 3300048915 | Ga0496112_0080355 | Ga0496112_0080355_2492_3010 | 172 |
| 216 | 3300048915 | Ga0496112_0128650 | Ga0496112_0128650_1360_1878 | 172 |
| 217 | 3300048915 | Ga0496112_0489454 | Ga0496112_0489454_418_936 | 172 |
| 218 | 3300048916 | Ga0496113_0086709 | Ga0496113_0086709_1130_1648 | 172 |
| 219 | 3300048916 | Ga0496113_0608395 | Ga0496113_0608395_264_782 | 172 |
| 220 | 3300048917 | Ga0496114_0380880 | Ga0496114_0380880_602_1120 | 172 |
| 221 | 3300048917 | Ga0496114_0753973 | Ga0496114_0753973_27_548 | 172 |
| 222 | 3300048919 | Ga0496116_0000018 | Ga0496116_0000018_333166_333687 | 172 |
| 223 | 3300048919 | Ga0496116_0010244 | Ga0496116_0010244_3697_4215 | 172 |
| 224 | 3300048920 | Ga0496117_0000015 | Ga0496117_0000015_212191_212712 | 172 |
| 225 | 3300048920 | Ga0496117_0000949 | Ga0496117_0000949_34725_35243 | 172 |
| 226 | 3300048921 | Ga0496118_0000012 | Ga0496118_0000012_212191_212712 | 172 |
| 227 | 3300048921 | Ga0496118_0002246 | Ga0496118_0002246_24420_24938 | 172 |
| 228 | 3300048922 | Ga0496119_0008652 | Ga0496119_0008652_1317_1835 | 172 |
| 229 | 3300048922 | Ga0496119_0011233 | Ga0496119_0011233_572_1093 | 172 |
| 230 | 3300048922 | Ga0496119_0292880 | Ga0496119_0292880_80_598 | 172 |
| 231 | 3300048923 | Ga0496120_0001092 | Ga0496120_0001092_20235_20756 | 172 |
| 232 | 3300048923 | Ga0496120_0004932 | Ga0496120_0004932_7885_8403 | 172 |
| 233 | 3300048924 | Ga0496121_0001957 | Ga0496121_0001957_16673_17194 | 172 |
| 234 | 3300048924 | Ga0496121_0008355 | Ga0496121_0008355_11511_12029 | 172 |
| 235 | 3300048927 | Ga0496124_0238381 | Ga0496124_0238381_238_756 | 172 |
| 236 | 3300048928 | Ga0496125_0024576 | Ga0496125_0024576_1147_1665 | 172 |
| 237 | 3300048929 | Ga0496126_0007833 | Ga0496126_0007833_7794_8312 | 172 |
| 238 | 3300049571 | Ga0501034_0050343 | Ga0501034_0050343_1292_1810 | 172 |
| 239 | 3300049585 | Ga0501069_0423667 | Ga0501069_0423667_187_717 | 172 |
| 240 | 3300049586 | Ga0501070_0230851 | Ga0501070_0230851_435_953 | 172 |
| 241 | 3300049586 | Ga0501070_0698863 | Ga0501070_0698863_12_530 | 172 |
| 242 | 3300049589 | Ga0501073_0073091 | Ga0501073_0073091_1677_2195 | 172 |
| 243 | 3300050489 | nmdc:mga03683_231739_c1 | nmdc:mga03683_231739_c1_95_616 | 172 |
| 244 | 3300050489 | nmdc:mga03683_97060_c1 | nmdc:mga03683_97060_c1_87_608 | 172 |
| 245 | 3300050490 | nmdc:mga03n38_139131_c1 | nmdc:mga03n38_139131_c1_125_643 | 172 |
| 246 | 3300050490 | nmdc:mga03n38_166575_c1 | nmdc:mga03n38_166575_c1_368_886 | 172 |
| 247 | 3300050490 | nmdc:mga03n38_28527_c1 | nmdc:mga03n38_28527_c1_1449_1970 | 172 |
| 248 | 3300050490 | nmdc:mga03n38_445760_c1 | nmdc:mga03n38_445760_c1_58_576 | 172 |
| 249 | 3300050490 | nmdc:mga03n38_470_c1 | nmdc:mga03n38_470_c1_7144_7662 | 172 |
| 250 | 3300050490 | nmdc:mga03n38_68896_c1 | nmdc:mga03n38_68896_c1_667_1188 | 172 |
| 251 | 3300050491 | nmdc:mga00v17_11316_c1 | nmdc:mga00v17_11316_c1_73_594 | 172 |
| 252 | 3300050491 | nmdc:mga00v17_17732_c1 | nmdc:mga00v17_17732_c1_3403_3921 | 172 |
| 253 | 3300050491 | nmdc:mga00v17_193371_c1 | nmdc:mga00v17_193371_c1_647_1171 | 172 |
| 254 | 3300050491 | nmdc:mga00v17_77884_c1 | nmdc:mga00v17_77884_c1_499_1020 | 172 |
| 255 | 3300050492 | nmdc:mga0yw44_141040_c1 | nmdc:mga0yw44_141040_c1_977_1495 | 172 |
| 256 | 3300050492 | nmdc:mga0yw44_38071_c1 | nmdc:mga0yw44_38071_c1_1823_2344 | 172 |
| 257 | 3300050492 | nmdc:mga0yw44_53417_c1 | nmdc:mga0yw44_53417_c1_1448_1969 | 172 |
| 258 | 3300050492 | nmdc:mga0yw44_707801_c1 | nmdc:mga0yw44_707801_c1_51_569 | 172 |
| 259 | 3300050494 | nmdc:mga06z11_8521_c1 | nmdc:mga06z11_8521_c1_153_674 | 172 |
| 260 | 3300050494 | nmdc:mga06z11_89376_c1 | nmdc:mga06z11_89376_c1_982_1503 | 172 |
| 261 | 3300050496 | nmdc:mga07m45_20628_c1 | nmdc:mga07m45_20628_c1_1984_2505 | 172 |
| 262 | 3300050496 | nmdc:mga07m45_218350_c1 | nmdc:mga07m45_218350_c1_536_1054 | 172 |
| 263 | 3300050496 | nmdc:mga07m45_332572_c1 | nmdc:mga07m45_332572_c1_213_731 | 172 |
| 264 | 3300050507 | nmdc:mga05p37_353386_c1 | nmdc:mga05p37_353386_c1_973_1491 | 172 |
| 265 | 3300050510 | nmdc:mga06r32_34381_c1 | nmdc:mga06r32_34381_c1_2378_2896 | 172 |
| 266 | 3300050516 | nmdc:mga0sz30_16957_c1 | nmdc:mga0sz30_16957_c1_1629_2153 | 172 |
| 267 | 3300050516 | nmdc:mga0sz30_355232_c1 | nmdc:mga0sz30_355232_c1_29_547 | 172 |
| 268 | 3300050516 | nmdc:mga0sz30_83701_c1 | nmdc:mga0sz30_83701_c1_628_1146 | 172 |
| 269 | 3300050516 | nmdc:mga0sz30_95227_c1 | nmdc:mga0sz30_95227_c1_567_1088 | 172 |
| 270 | 3300053083 | Ga0495655_0123468 | Ga0495655_0123468_216_734 | 172 |
| 271 | 3300053096 | Ga0500641_0047920 | Ga0500641_0047920_83_613 | 172 |
| 272 | 3300053153 | Ga0500616_0003901 | Ga0500616_0003901_359_886 | 172 |
| 273 | 3300053153 | Ga0500616_0056012 | Ga0500616_0056012_1286_1804 | 172 |
| 274 | 3300061719 | Ga0466962_0146567 | Ga0466962_0146567_557_1081 | 172 |
| 275 | 3300037853 | Ga0436364_1525395 | Ga0436364_1525395_1106_1657 | 179 |
| 276 | 3300039437 | Ga0436365_1107006 | Ga0436365_1107006_10616_11167 | 179 |
| 277 | 3300021384 | Ga0213876_10003081 | Ga0213876_1000308110 | 180 |
| 278 | 3300037853 | Ga0436364_0359706 | Ga0436364_0359706_3734_4288 | 180 |
| 279 | 3300039437 | Ga0436365_0831031 | Ga0436365_0831031_18398_18952 | 180 |
| 280 | 3300039437 | Ga0436365_1605284 | Ga0436365_1605284_11341_11895 | 180 |
| 281 | 3300044694 | Ga0466963_0579409 | Ga0466963_0579409_117_671 | 180 |
| 282 | 3300045049 | Ga0466959_0175033 | Ga0466959_0175033_137_691 | 180 |
| 283 | 3300048905 | Ga0496102_0024824 | Ga0496102_0024824_591_1145 | 180 |
| 284 | 3300048906 | Ga0496103_0431736 | Ga0496103_0431736_16_570 | 180 |
| 285 | 3300048918 | Ga0496115_0410328 | Ga0496115_0410328_149_703 | 180 |
| 286 | 3300048920 | Ga0496117_0087999 | Ga0496117_0087999_932_1486 | 180 |
| 287 | 3300048921 | Ga0496118_0001082 | Ga0496118_0001082_78_632 | 180 |
| 288 | 3300048929 | Ga0496126_0009216 | Ga0496126_0009216_5507_6061 | 180 |
| 289 | 3300050491 | nmdc:mga00v17_6121_c1 | nmdc:mga00v17_6121_c1_2146_2700 | 180 |
| 290 | 3300050492 | nmdc:mga0yw44_48716_c1 | nmdc:mga0yw44_48716_c1_1423_1977 | 180 |
| 291 | 3300050494 | nmdc:mga06z11_733581_c1 | nmdc:mga06z11_733581_c1_27_581 | 180 |
| 292 | 3300050516 | nmdc:mga0sz30_129426_c1 | nmdc:mga0sz30_129426_c1_340_894 | 180 |
| 293 | 3300061719 | Ga0466962_0005499 | Ga0466962_0005499_4576_5130 | 180 |
| 294 | 3300044656 | Ga0466969_0015754 | Ga0466969_0015754_3290_3847 | 181 |
| 295 | 3300044683 | Ga0466965_0353708 | Ga0466965_0353708_29_586 | 181 |
| 296 | 3300044684 | Ga0466966_0004047 | Ga0466966_0004047_4197_4754 | 181 |
| 297 | 3300044693 | Ga0466961_0003994 | Ga0466961_0003994_8254_8811 | 181 |
| 298 | 3300044842 | Ga0466957_0038118 | Ga0466957_0038118_1753_2310 | 181 |
| 299 | 3300045049 | Ga0466959_0082333 | Ga0466959_0082333_143_700 | 181 |
| 300 | 3300045836 | Ga0466958_0000497 | Ga0466958_0000497_11029_11586 | 181 |
| 301 | 3300006353 | Ga0075370_10013987 | Ga0075370_100139873 | 182 |
| 302 | 3300025915 | Ga0207693_10062162 | Ga0207693_100621625 | 182 |
| 303 | 3300037853 | Ga0436364_1063367 | Ga0436364_1063367_397_957 | 182 |
| 304 | 3300039450 | Ga0436363_0743374 | Ga0436363_0743374_2406_2966 | 182 |
| 305 | 3300049569 | Ga0501032_0027334 | Ga0501032_0027334_2507_3070 | 182 |
| 306 | 3300049570 | Ga0501033_0038422 | Ga0501033_0038422_1402_1965 | 182 |
| 307 | 3300049571 | Ga0501034_0318956 | Ga0501034_0318956_486_1049 | 182 |
| 308 | 3300049572 | Ga0501036_0109926 | Ga0501036_0109926_1006_1569 | 182 |
| 309 | 3300049580 | Ga0501046_0184116 | Ga0501046_0184116_795_1358 | 182 |
| 310 | 3300049581 | Ga0501047_0027261 | Ga0501047_0027261_2185_2748 | 182 |
| 311 | 3300049822 | Ga0501035_0000820 | Ga0501035_0000820_30344_30907 | 182 |
| 312 | 3300049823 | Ga0501044_0001122 | Ga0501044_0001122_28969_29532 | 182 |
| 313 | 3300005456 | Ga0070678_100233658 | Ga0070678_1002336582 | 188 |
| 314 | 3300005616 | Ga0068852_100479936 | Ga0068852_1004799361 | 188 |
| 315 | 3300005842 | Ga0068858_100158875 | Ga0068858_1001588752 | 188 |
| 316 | 3300009098 | Ga0105245_10992100 | Ga0105245_109921002 | 188 |
| 317 | 3300026035 | Ga0207703_10449987 | Ga0207703_104499872 | 188 |
| 318 | 3300048904 | Ga0496101_0125414 | Ga0496101_0125414_813_1406 | 188 |
| 319 | 3300048905 | Ga0496102_0048307 | Ga0496102_0048307_46_639 | 188 |
| 320 | 3300048908 | Ga0496105_0255170 | Ga0496105_0255170_468_1061 | 188 |
| 321 | 3300048910 | Ga0496107_0035281 | Ga0496107_0035281_1054_1647 | 188 |
| 322 | 3300005455 | Ga0070663_100047327 | Ga0070663_1000473274 | 189 |
| 323 | 3300006048 | Ga0075363_100274496 | Ga0075363_1002744962 | 189 |
| 324 | 3300025945 | Ga0207679_10429282 | Ga0207679_104292822 | 189 |
| 325 | 3300026142 | Ga0207698_10257635 | Ga0207698_102576352 | 189 |
| 326 | 3300031995 | Ga0307409_100566809 | Ga0307409_1005668092 | 189 |
| 327 | 3300035725 | Ga0373947_0167557 | Ga0373947_0167557_821_1405 | 189 |
| 328 | 3300046475 | Ga0495639_0101478 | Ga0495639_0101478_476_1060 | 189 |
| 329 | 3300046499 | Ga0495594_0043107 | Ga0495594_0043107_1857_2441 | 189 |
| 330 | 3300046680 | Ga0495646_0071267 | Ga0495646_0071267_1103_1687 | 189 |
| 331 | 3300046690 | Ga0495624_0238464 | Ga0495624_0238464_79_663 | 189 |
| 332 | 3300047673 | Ga0495593_0032488 | Ga0495593_0032488_1167_1751 | 189 |
| 333 | 3300050490 | nmdc:mga03n38_173282_c1 | nmdc:mga03n38_173282_c1_214_798 | 189 |
| 334 | 3300050491 | nmdc:mga00v17_72591_c1 | nmdc:mga00v17_72591_c1_1242_1838 | 189 |
| 335 | 3300013105 | Ga0157369_10086751 | Ga0157369_100867514 | 190 |
| 336 | 3300014969 | Ga0157376_10584405 | Ga0157376_105844052 | 190 |
| 337 | iso_pu_bacteria | 2902792274 | 2902795324 | 190 |
| 338 | 3300003792 | Ga0055540_1023150 | Ga0055540_10231502 | 191 |
| 339 | 3300005328 | Ga0070676_10058193 | Ga0070676_100581931 | 191 |
| 340 | 3300005334 | Ga0068869_100005930 | Ga0068869_1000059306 | 191 |
| 341 | 3300005335 | Ga0070666_10020470 | Ga0070666_100204703 | 191 |
| 342 | 3300005338 | Ga0068868_100008507 | Ga0068868_10000850710 | 191 |
| 343 | 3300005347 | Ga0070668_100007322 | Ga0070668_1000073229 | 191 |
| 344 | 3300005347 | Ga0070668_100726272 | Ga0070668_1007262722 | 191 |
| 345 | 3300005353 | Ga0070669_100006373 | Ga0070669_1000063738 | 191 |
| 346 | 3300005355 | Ga0070671_100714731 | Ga0070671_1007147311 | 191 |
| 347 | 3300005356 | Ga0070674_100006508 | Ga0070674_1000065082 | 191 |
| 348 | 3300005434 | Ga0070709_10088254 | Ga0070709_100882542 | 191 |
| 349 | 3300005440 | Ga0070705_100035941 | Ga0070705_1000359412 | 191 |
| 350 | 3300005441 | Ga0070700_100017590 | Ga0070700_1000175902 | 191 |
| 351 | 3300005444 | Ga0070694_100019161 | Ga0070694_1000191615 | 191 |
| 352 | 3300005455 | Ga0070663_100006678 | Ga0070663_1000066785 | 191 |
| 353 | 3300005456 | Ga0070678_100847820 | Ga0070678_1008478201 | 191 |
| 354 | 3300005457 | Ga0070662_100013113 | Ga0070662_1000131137 | 191 |
| 355 | 3300005459 | Ga0068867_100000767 | Ga0068867_10000076723 | 191 |
| 356 | 3300005466 | Ga0070685_10621468 | Ga0070685_106214681 | 191 |
| 357 | 3300005539 | Ga0068853_100046366 | Ga0068853_1000463661 | 191 |
| 358 | 3300005539 | Ga0068853_100105174 | Ga0068853_1001051742 | 191 |
| 359 | 3300005543 | Ga0070672_100081543 | Ga0070672_1000815433 | 191 |
| 360 | 3300005545 | Ga0070695_100032291 | Ga0070695_1000322913 | 191 |
| 361 | 3300005548 | Ga0070665_100012841 | Ga0070665_1000128417 | 191 |
| 362 | 3300005549 | Ga0070704_100016405 | Ga0070704_1000164054 | 191 |
| 363 | 3300005578 | Ga0068854_100018986 | Ga0068854_1000189865 | 191 |
| 364 | 3300005615 | Ga0070702_100031316 | Ga0070702_1000313164 | 191 |
| 365 | 3300005617 | Ga0068859_100044940 | Ga0068859_1000449404 | 191 |
| 366 | 3300005718 | Ga0068866_10001343 | Ga0068866_1000134310 | 191 |
| 367 | 3300005719 | Ga0068861_100000969 | Ga0068861_10000096919 | 191 |
| 368 | 3300005844 | Ga0068862_100102635 | Ga0068862_1001026354 | 191 |
| 369 | 3300005937 | Ga0081455_10121834 | Ga0081455_101218342 | 191 |
| 370 | 3300006038 | Ga0075365_10006885 | Ga0075365_100068852 | 191 |
| 371 | 3300006038 | Ga0075365_10205876 | Ga0075365_102058763 | 191 |
| 372 | 3300006051 | Ga0075364_10147839 | Ga0075364_101478392 | 191 |
| 373 | 3300006163 | Ga0070715_10056348 | Ga0070715_100563482 | 191 |
| 374 | 3300006175 | Ga0070712_100008693 | Ga0070712_1000086935 | 191 |
| 375 | 3300006186 | Ga0075369_10019165 | Ga0075369_100191652 | 191 |
| 376 | 3300006237 | Ga0097621_100055695 | Ga0097621_1000556952 | 191 |
| 377 | 3300006358 | Ga0068871_100329365 | Ga0068871_1003293652 | 191 |
| 378 | 3300006881 | Ga0068865_100009281 | Ga0068865_1000092812 | 191 |
| 379 | 3300006931 | Ga0097620_100044939 | Ga0097620_1000449394 | 191 |
| 380 | 3300007788 | Ga0099795_10020200 | Ga0099795_100202003 | 191 |
| 381 | 3300009098 | Ga0105245_10003393 | Ga0105245_1000339316 | 191 |
| 382 | 3300009101 | Ga0105247_10000785 | Ga0105247_1000078524 | 191 |
| 383 | 3300009148 | Ga0105243_10003766 | Ga0105243_100037666 | 191 |
| 384 | 3300009176 | Ga0105242_10003339 | Ga0105242_100033396 | 191 |
| 385 | 3300009545 | Ga0105237_10004038 | Ga0105237_1000403821 | 191 |
| 386 | 3300010375 | Ga0105239_10156290 | Ga0105239_101562904 | 191 |
| 387 | 3300010375 | Ga0105239_10263466 | Ga0105239_102634662 | 191 |
| 388 | 3300010375 | Ga0105239_10308586 | Ga0105239_103085863 | 191 |
| 389 | 3300013297 | Ga0157378_10011293 | Ga0157378_100112931 | 191 |
| 390 | 3300013306 | Ga0163162_10009459 | Ga0163162_100094595 | 191 |
| 391 | 3300013308 | Ga0157375_10001214 | Ga0157375_1000121423 | 191 |
| 392 | 3300014968 | Ga0157379_10065992 | Ga0157379_100659924 | 191 |
| 393 | 3300017792 | Ga0163161_10021759 | Ga0163161_100217596 | 191 |
| 394 | 3300025303 | Ga0209051_1001885 | Ga0209051_100188516 | 191 |
| 395 | 3300025303 | Ga0209051_1029082 | Ga0209051_10290822 | 191 |
| 396 | 3300025898 | Ga0207692_10004776 | Ga0207692_100047765 | 191 |
| 397 | 3300025903 | Ga0207680_10037809 | Ga0207680_100378093 | 191 |
| 398 | 3300025906 | Ga0207699_10079488 | Ga0207699_100794882 | 191 |
| 399 | 3300025907 | Ga0207645_10036755 | Ga0207645_100367553 | 191 |
| 400 | 3300025915 | Ga0207693_10001453 | Ga0207693_100014535 | 191 |
| 401 | 3300025927 | Ga0207687_10004414 | Ga0207687_1000441411 | 191 |
| 402 | 3300025931 | Ga0207644_10049164 | Ga0207644_100491642 | 191 |
| 403 | 3300025934 | Ga0207686_10005255 | Ga0207686_100052552 | 191 |
| 404 | 3300025939 | Ga0207665_10084789 | Ga0207665_100847892 | 191 |
| 405 | 3300025940 | Ga0207691_10118357 | Ga0207691_101183572 | 191 |
| 406 | 3300025942 | Ga0207689_10027920 | Ga0207689_100279201 | 191 |
| 407 | 3300025949 | Ga0207667_10136474 | Ga0207667_101364744 | 191 |
| 408 | 3300025961 | Ga0207712_10476985 | Ga0207712_104769852 | 191 |
| 409 | 3300025972 | Ga0207668_10008025 | Ga0207668_100080258 | 191 |
| 410 | 3300025981 | Ga0207640_10049987 | Ga0207640_100499872 | 191 |
| 411 | 3300026023 | Ga0207677_10015040 | Ga0207677_100150404 | 191 |
| 412 | 3300026035 | Ga0207703_10033811 | Ga0207703_100338112 | 191 |
| 413 | 3300026041 | Ga0207639_10054911 | Ga0207639_100549112 | 191 |
| 414 | 3300026067 | Ga0207678_10010680 | Ga0207678_100106806 | 191 |
| 415 | 3300026067 | Ga0207678_10183762 | Ga0207678_101837622 | 191 |
| 416 | 3300026075 | Ga0207708_10026516 | Ga0207708_100265165 | 191 |
| 417 | 3300026089 | Ga0207648_10001187 | Ga0207648_1000118727 | 191 |
| 418 | 3300026118 | Ga0207675_100000909 | Ga0207675_1000009097 | 191 |
| 419 | 3300026121 | Ga0207683_10001040 | Ga0207683_100010405 | 191 |
| 420 | 3300028380 | Ga0268265_10106721 | Ga0268265_101067211 | 191 |
| 421 | 3300032002 | Ga0307416_100513712 | Ga0307416_1005137122 | 191 |
| 422 | 3300035691 | Ga0373931_0058785 | Ga0373931_0058785_502_1101 | 191 |
| 423 | 3300036712 | Ga0316584_0125135 | Ga0316584_0125135_907_1503 | 191 |
| 424 | 3300037418 | Ga0395900_1050450 | Ga0395900_1050450_81_656 | 191 |
| 425 | 3300041411 | Ga0439466_0051138 | Ga0439466_0051138_423_998 | 191 |
| 426 | 3300041413 | Ga0439465_0112287 | Ga0439465_0112287_140_715 | 191 |
| 427 | 3300044683 | Ga0466965_0068316 | Ga0466965_0068316_1055_1657 | 191 |
| 428 | 3300044765 | Ga0466970_0089529 | Ga0466970_0089529_232_834 | 191 |
| 429 | 3300044901 | Ga0466960_0006623 | Ga0466960_0006623_197_793 | 191 |
| 430 | 3300046460 | Ga0495638_0027079 | Ga0495638_0027079_1712_2314 | 191 |
| 431 | 3300046506 | Ga0495583_0024314 | Ga0495583_0024314_466_1068 | 191 |
| 432 | 3300046507 | Ga0495606_0012713 | Ga0495606_0012713_2849_3451 | 191 |
| 433 | 3300046524 | Ga0495648_0030180 | Ga0495648_0030180_2832_3434 | 191 |
| 434 | 3300046616 | Ga0495668_0019625 | Ga0495668_0019625_1964_2566 | 191 |
| 435 | 3300046692 | Ga0495671_0131728 | Ga0495671_0131728_434_1036 | 191 |
| 436 | 3300047320 | Ga0495672_0009317 | Ga0495672_0009317_5956_6558 | 191 |
| 437 | 3300047445 | Ga0495677_0131580 | Ga0495677_0131580_250_852 | 191 |
| 438 | 3300047469 | Ga0495673_0001390 | Ga0495673_0001390_15546_16148 | 191 |
| 439 | 3300047472 | Ga0495686_0001263 | Ga0495686_0001263_11017_11622 | 191 |
| 440 | 3300047472 | Ga0495686_0059301 | Ga0495686_0059301_1187_1798 | 191 |
| 441 | 3300048903 | Ga0496100_0058311 | Ga0496100_0058311_1862_2461 | 191 |
| 442 | 3300048904 | Ga0496101_0162900 | Ga0496101_0162900_507_1106 | 191 |
| 443 | 3300048905 | Ga0496102_0040241 | Ga0496102_0040241_1917_2516 | 191 |
| 444 | 3300048905 | Ga0496102_0185985 | Ga0496102_0185985_939_1541 | 191 |
| 445 | 3300048906 | Ga0496103_0001912 | Ga0496103_0001912_4849_5448 | 191 |
| 446 | 3300048909 | Ga0496106_0014919 | Ga0496106_0014919_2159_2758 | 191 |
| 447 | 3300048910 | Ga0496107_0002086 | Ga0496107_0002086_10666_11265 | 191 |
| 448 | 3300048917 | Ga0496114_0003519 | Ga0496114_0003519_4909_5508 | 191 |
| 449 | 3300048918 | Ga0496115_0015424 | Ga0496115_0015424_936_1535 | 191 |
| 450 | 3300048918 | Ga0496115_0457717 | Ga0496115_0457717_112_714 | 191 |
| 451 | 3300048922 | Ga0496119_0037856 | Ga0496119_0037856_828_1430 | 191 |
| 452 | 3300048924 | Ga0496121_0237309 | Ga0496121_0237309_66_668 | 191 |
| 453 | 3300048924 | Ga0496121_0433899 | Ga0496121_0433899_92_700 | 191 |
| 454 | 3300048929 | Ga0496126_0001404 | Ga0496126_0001404_26123_26725 | 191 |
| 455 | 3300048929 | Ga0496126_0029386 | Ga0496126_0029386_2514_3116 | 191 |
| 456 | 3300049823 | Ga0501044_0016151 | Ga0501044_0016151_3752_4360 | 191 |
| 457 | 3300050492 | nmdc:mga0yw44_417360_c1 | nmdc:mga0yw44_417360_c1_91_690 | 191 |
| 458 | 3300050492 | nmdc:mga0yw44_6091_c1 | nmdc:mga0yw44_6091_c1_2225_2827 | 191 |
| 459 | 3300053080 | Ga0500635_0091907 | Ga0500635_0091907_316_918 | 191 |
| 460 | 3300053087 | Ga0500643_001848 | Ga0500643_001848_212_814 | 191 |
| 461 | 3300053122 | Ga0500608_201445 | Ga0500608_201445_183_785 | 191 |
| 462 | 3300053133 | Ga0500655_021592 | Ga0500655_021592_263_865 | 191 |
| 463 | 3300053158 | Ga0500627_0006781 | Ga0500627_0006781_1296_1898 | 191 |
| 464 | 3300053730 | Ga0500645_000004 | Ga0500645_000004_258823_259425 | 191 |
| 465 | 3300053730 | Ga0500645_072382 | Ga0500645_072382_12_614 | 191 |
| 466 | iso_pu_bacteria | 2643221687 | 2644488387 | 191 |
| 467 | iso_pu_bacteria | 2738541274 | 2738703277 | 191 |
| 468 | iso_pu_bacteria | 2738543028 | 2739329262 | 191 |
| 469 | iso_pu_bacteria | 2902799365 | 2902800333 | 191 |
| 470 | iso_pu_bacteria | 2902837492 | 2902842869 | 191 |
| 471 | 3300005981 | Ga0081538_10058574 | Ga0081538_100585742 | 192 |
| 472 | 3300006051 | Ga0075364_10197896 | Ga0075364_101978962 | 192 |
| 473 | 3300006177 | Ga0075362_10151690 | Ga0075362_101516902 | 192 |
| 474 | 3300041410 | Ga0439461_0008575 | Ga0439461_0008575_552_1154 | 192 |
| 475 | 3300041411 | Ga0439466_0002430 | Ga0439466_0002430_6494_7096 | 192 |
| 476 | 3300041413 | Ga0439465_0019489 | Ga0439465_0019489_1053_1655 | 192 |
| 477 | 3300042002 | Ga0439442_010722 | Ga0439442_010722_1194_1796 | 192 |
| 478 | 3300042435 | Ga0439434_0010857 | Ga0439434_0010857_16_618 | 192 |
| 479 | 3300045976 | Ga0466967_0361002 | Ga0466967_0361002_337_936 | 192 |
| 480 | 3300050490 | nmdc:mga03n38_251055_c1 | nmdc:mga03n38_251055_c1_33_632 | 192 |
| 481 | 3300050491 | nmdc:mga00v17_57809_c1 | nmdc:mga00v17_57809_c1_276_869 | 192 |
| 482 | 3300053080 | Ga0500635_0023623 | Ga0500635_0023623_93_698 | 192 |
| 483 | 3300053131 | Ga0500652_000414 | Ga0500652_000414_9763_10368 | 192 |
| 484 | 3300025931 | Ga0207644_10251171 | Ga0207644_102511712 | 193 |
| 485 | 3300009545 | Ga0105237_10090956 | Ga0105237_100909564 | 195 |
| 486 | 3300010375 | Ga0105239_10342199 | Ga0105239_103421992 | 195 |
| 487 | 3300042005 | Ga0439448_0002154 | Ga0439448_0002154_4027_4641 | 195 |
| 488 | 3300048903 | Ga0496100_0000352 | Ga0496100_0000352_17626_18240 | 195 |
| 489 | 3300048904 | Ga0496101_0000043 | Ga0496101_0000043_156884_157498 | 195 |
| 490 | 3300048905 | Ga0496102_0015077 | Ga0496102_0015077_2946_3560 | 195 |
| 491 | 3300048906 | Ga0496103_0012078 | Ga0496103_0012078_4183_4797 | 195 |
| 492 | 3300048909 | Ga0496106_0000468 | Ga0496106_0000468_2566_3180 | 195 |
| 493 | 3300048911 | Ga0496108_0100835 | Ga0496108_0100835_1132_1746 | 195 |
| 494 | 3300048912 | Ga0496109_0000145 | Ga0496109_0000145_4131_4745 | 195 |
| 495 | 3300048913 | Ga0496110_0001427 | Ga0496110_0001427_15206_15820 | 195 |
| 496 | 3300048914 | Ga0496111_0025844 | Ga0496111_0025844_2592_3206 | 195 |
| 497 | 3300048915 | Ga0496112_0198611 | Ga0496112_0198611_190_804 | 195 |
| 498 | 3300048917 | Ga0496114_0000219 | Ga0496114_0000219_4140_4754 | 195 |
| 499 | 3300048918 | Ga0496115_0007642 | Ga0496115_0007642_712_1326 | 195 |
| 500 | 3300048919 | Ga0496116_0040893 | Ga0496116_0040893_1415_2029 | 195 |
| 501 | 3300048920 | Ga0496117_0043172 | Ga0496117_0043172_793_1407 | 195 |
| 502 | 3300048921 | Ga0496118_0046155 | Ga0496118_0046155_2159_2773 | 195 |
| 503 | 3300048922 | Ga0496119_0018923 | Ga0496119_0018923_334_948 | 195 |
| 504 | 3300048923 | Ga0496120_0008670 | Ga0496120_0008670_3447_4061 | 195 |
| 505 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_4158_4772 | 195 |
| 506 | 3300048925 | Ga0496122_0001790 | Ga0496122_0001790_4158_4772 | 195 |
| 507 | 3300048926 | Ga0496123_0035257 | Ga0496123_0035257_570_1184 | 195 |
| 508 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_1489817_1490431 | 195 |
| 509 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_4158_4772 | 195 |
| 510 | 3300048929 | Ga0496126_0000009 | Ga0496126_0000009_745579_746193 | 195 |
| 511 | iso_pu_bacteria | 2842888712 | 2842892287 | 195 |
| 512 | 3300005347 | Ga0070668_100065158 | Ga0070668_1000651582 | 196 |
| 513 | 3300005355 | Ga0070671_100182455 | Ga0070671_1001824552 | 196 |
| 514 | 3300005356 | Ga0070674_100081535 | Ga0070674_1000815353 | 196 |
| 515 | 3300005367 | Ga0070667_100456334 | Ga0070667_1004563342 | 196 |
| 516 | 3300005456 | Ga0070678_100052094 | Ga0070678_1000520943 | 196 |
| 517 | 3300005548 | Ga0070665_100325898 | Ga0070665_1003258982 | 196 |
| 518 | 3300005841 | Ga0068863_100817012 | Ga0068863_1008170122 | 196 |
| 519 | 3300009177 | Ga0105248_10077729 | Ga0105248_100777295 | 196 |
| 520 | 3300013308 | Ga0157375_11051673 | Ga0157375_110516731 | 196 |
| 521 | 3300014969 | Ga0157376_10969667 | Ga0157376_109696671 | 196 |
| 522 | 3300025908 | Ga0207643_10372254 | Ga0207643_103722542 | 196 |
| 523 | 3300025941 | Ga0207711_10063806 | Ga0207711_100638064 | 196 |
| 524 | 3300025972 | Ga0207668_10004131 | Ga0207668_100041315 | 196 |
| 525 | 3300025986 | Ga0207658_10211678 | Ga0207658_102116782 | 196 |
| 526 | 3300026121 | Ga0207683_10047339 | Ga0207683_100473394 | 196 |
| 527 | 3300028379 | Ga0268266_10160859 | Ga0268266_101608593 | 196 |
| 528 | 3300046460 | Ga0495638_0002231 | Ga0495638_0002231_13886_14491 | 196 |
| 529 | 3300046660 | Ga0495625_0104502 | Ga0495625_0104502_220_825 | 196 |
| 530 | 3300046692 | Ga0495671_0194947 | Ga0495671_0194947_33_638 | 196 |
| 531 | 3300046694 | Ga0495649_0121981 | Ga0495649_0121981_97_702 | 196 |
| 532 | 3300048903 | Ga0496100_0000705 | Ga0496100_0000705_4226_4831 | 196 |
| 533 | 3300048904 | Ga0496101_0012446 | Ga0496101_0012446_2219_2824 | 196 |
| 534 | 3300048905 | Ga0496102_0164171 | Ga0496102_0164171_14_619 | 196 |
| 535 | 3300048907 | Ga0496104_0011789 | Ga0496104_0011789_3853_4458 | 196 |
| 536 | 3300048908 | Ga0496105_0003671 | Ga0496105_0003671_4474_5079 | 196 |
| 537 | 3300048909 | Ga0496106_0007395 | Ga0496106_0007395_2852_3457 | 196 |
| 538 | 3300048910 | Ga0496107_0024564 | Ga0496107_0024564_1485_2090 | 196 |
| 539 | 3300048917 | Ga0496114_0000114 | Ga0496114_0000114_39903_40508 | 196 |
| 540 | 3300048918 | Ga0496115_0004933 | Ga0496115_0004933_798_1403 | 196 |
| 541 | 3300053079 | Ga0500610_0008918 | Ga0500610_0008918_3430_4035 | 196 |
| 542 | 3300053104 | Ga0500556_0034498 | Ga0500556_0034498_411_1016 | 196 |
| 543 | 3300053108 | Ga0500562_023074 | Ga0500562_023074_627_1232 | 196 |
| 544 | 3300005937 | Ga0081455_10026071 | Ga0081455_100260712 | 197 |
| 545 | 3300009148 | Ga0105243_10383645 | Ga0105243_103836452 | 197 |
| 546 | 3300025935 | Ga0207709_10295972 | Ga0207709_102959722 | 197 |
| 547 | 3300048925 | Ga0496122_0027183 | Ga0496122_0027183_2489_3106 | 197 |
| 548 | 3300048926 | Ga0496123_0004860 | Ga0496123_0004860_13092_13709 | 197 |
| 549 | 3300048929 | Ga0496126_0005459 | Ga0496126_0005459_363_980 | 197 |
| 550 | 3300006048 | Ga0075363_100006325 | Ga0075363_1000063256 | 198 |
| 551 | 3300006048 | Ga0075363_100107678 | Ga0075363_1001076782 | 198 |
| 552 | 3300006186 | Ga0075369_10031546 | Ga0075369_100315463 | 198 |
| 553 | 3300027866 | Ga0209813_10086459 | Ga0209813_100864592 | 198 |
| 554 | 3300031852 | Ga0307410_10024933 | Ga0307410_100249336 | 198 |
| 555 | 3300031903 | Ga0307407_10080817 | Ga0307407_100808172 | 198 |
| 556 | 3300031995 | Ga0307409_100134910 | Ga0307409_1001349102 | 198 |
| 557 | 3300032126 | Ga0307415_100004788 | Ga0307415_1000047888 | 198 |
| 558 | 3300044656 | Ga0466969_0053878 | Ga0466969_0053878_1288_1884 | 198 |
| 559 | 3300044658 | Ga0466972_0005553 | Ga0466972_0005553_2817_3413 | 198 |
| 560 | 3300044684 | Ga0466966_0006045 | Ga0466966_0006045_1248_1844 | 198 |
| 561 | 3300044693 | Ga0466961_0219032 | Ga0466961_0219032_106_702 | 198 |
| 562 | 3300044706 | Ga0466964_0008433 | Ga0466964_0008433_1493_2089 | 198 |
| 563 | 3300044719 | Ga0466971_0002012 | Ga0466971_0002012_3373_3969 | 198 |
| 564 | 3300044735 | Ga0466968_0074265 | Ga0466968_0074265_510_1106 | 198 |
| 565 | 3300044765 | Ga0466970_0028803 | Ga0466970_0028803_1600_2196 | 198 |
| 566 | 3300044842 | Ga0466957_0009048 | Ga0466957_0009048_4152_4748 | 198 |
| 567 | 3300045049 | Ga0466959_0054449 | Ga0466959_0054449_2220_2816 | 198 |
| 568 | 3300045836 | Ga0466958_0007100 | Ga0466958_0007100_3811_4407 | 198 |
| 569 | 3300050490 | nmdc:mga03n38_65722_c1 | nmdc:mga03n38_65722_c1_891_1487 | 198 |
| 570 | 3300050491 | nmdc:mga00v17_5523_c1 | nmdc:mga00v17_5523_c1_1615_2211 | 198 |
| 571 | 3300050494 | nmdc:mga06z11_162782_c1 | nmdc:mga06z11_162782_c1_453_1049 | 198 |
| 572 | 3300050495 | nmdc:mga04h51_102732_c1 | nmdc:mga04h51_102732_c1_297_893 | 198 |
| 573 | 3300050516 | nmdc:mga0sz30_21553_c1 | nmdc:mga0sz30_21553_c1_1119_1715 | 198 |
| 574 | 3300061719 | Ga0466962_0009015 | Ga0466962_0009015_2081_2677 | 198 |
| 575 | 3300001991 | JGI24743J22301_10010695 | JGI24743J22301_100106952 | 200 |
| 576 | 3300002073 | JGI24745J21846_1012037 | JGI24745J21846_10120371 | 200 |
| 577 | 3300002077 | JGI24744J21845_10015454 | JGI24744J21845_100154542 | 200 |
| 578 | 3300002244 | JGI24742J22300_10022971 | JGI24742J22300_100229712 | 200 |
| 579 | 3300005330 | Ga0070690_100876520 | Ga0070690_1008765201 | 200 |
| 580 | 3300005331 | Ga0070670_100128310 | Ga0070670_1001283102 | 200 |
| 581 | 3300005334 | Ga0068869_100012274 | Ga0068869_1000122747 | 200 |
| 582 | 3300005335 | Ga0070666_10406289 | Ga0070666_104062892 | 200 |
| 583 | 3300005338 | Ga0068868_100128174 | Ga0068868_1001281743 | 200 |
| 584 | 3300005340 | Ga0070689_100342711 | Ga0070689_1003427112 | 200 |
| 585 | 3300005341 | Ga0070691_10112199 | Ga0070691_101121992 | 200 |
| 586 | 3300005347 | Ga0070668_100413552 | Ga0070668_1004135522 | 200 |
| 587 | 3300005354 | Ga0070675_100462980 | Ga0070675_1004629802 | 200 |
| 588 | 3300005355 | Ga0070671_100002188 | Ga0070671_10000218817 | 200 |
| 589 | 3300005356 | Ga0070674_100332516 | Ga0070674_1003325162 | 200 |
| 590 | 3300005364 | Ga0070673_100554268 | Ga0070673_1005542682 | 200 |
| 591 | 3300005365 | Ga0070688_100062044 | Ga0070688_1000620444 | 200 |
| 592 | 3300005367 | Ga0070667_100055783 | Ga0070667_1000557834 | 200 |
| 593 | 3300005434 | Ga0070709_10021878 | Ga0070709_100218782 | 200 |
| 594 | 3300005437 | Ga0070710_10021371 | Ga0070710_100213714 | 200 |
| 595 | 3300005438 | Ga0070701_10538980 | Ga0070701_105389802 | 200 |
| 596 | 3300005439 | Ga0070711_100003315 | Ga0070711_1000033157 | 200 |
| 597 | 3300005441 | Ga0070700_100203640 | Ga0070700_1002036402 | 200 |
| 598 | 3300005539 | Ga0068853_100060552 | Ga0068853_1000605524 | 200 |
| 599 | 3300005543 | Ga0070672_100819329 | Ga0070672_1008193291 | 200 |
| 600 | 3300005544 | Ga0070686_100676517 | Ga0070686_1006765171 | 200 |
| 601 | 3300005546 | Ga0070696_100026906 | Ga0070696_1000269064 | 200 |
| 602 | 3300005547 | Ga0070693_100007431 | Ga0070693_1000074312 | 200 |
| 603 | 3300005548 | Ga0070665_100002445 | Ga0070665_10000244518 | 200 |
| 604 | 3300005548 | Ga0070665_100202135 | Ga0070665_1002021352 | 200 |
| 605 | 3300005549 | Ga0070704_100486585 | Ga0070704_1004865852 | 200 |
| 606 | 3300005563 | Ga0068855_100566794 | Ga0068855_1005667942 | 200 |
| 607 | 3300005578 | Ga0068854_100117088 | Ga0068854_1001170883 | 200 |
| 608 | 3300005616 | Ga0068852_100196294 | Ga0068852_1001962942 | 200 |
| 609 | 3300005617 | Ga0068859_100305109 | Ga0068859_1003051092 | 200 |
| 610 | 3300005618 | Ga0068864_100453493 | Ga0068864_1004534932 | 200 |
| 611 | 3300005618 | Ga0068864_100699963 | Ga0068864_1006999632 | 200 |
| 612 | 3300005719 | Ga0068861_100536425 | Ga0068861_1005364251 | 200 |
| 613 | 3300005841 | Ga0068863_100051223 | Ga0068863_1000512234 | 200 |
| 614 | 3300005841 | Ga0068863_100193559 | Ga0068863_1001935592 | 200 |
| 615 | 3300005842 | Ga0068858_100207871 | Ga0068858_1002078712 | 200 |
| 616 | 3300005842 | Ga0068858_100240800 | Ga0068858_1002408003 | 200 |
| 617 | 3300005844 | Ga0068862_100053295 | Ga0068862_1000532954 | 200 |
| 618 | 3300005983 | Ga0081540_1137750 | Ga0081540_11377502 | 200 |
| 619 | 3300006051 | Ga0075364_10002891 | Ga0075364_100028911 | 200 |
| 620 | 3300006051 | Ga0075364_10027745 | Ga0075364_100277451 | 200 |
| 621 | 3300006163 | Ga0070715_10045223 | Ga0070715_100452232 | 200 |
| 622 | 3300006173 | Ga0070716_100010796 | Ga0070716_1000107964 | 200 |
| 623 | 3300006173 | Ga0070716_100193177 | Ga0070716_1001931772 | 200 |
| 624 | 3300006175 | Ga0070712_100010905 | Ga0070712_1000109056 | 200 |
| 625 | 3300006186 | Ga0075369_10010274 | Ga0075369_100102741 | 200 |
| 626 | 3300006353 | Ga0075370_10093822 | Ga0075370_100938223 | 200 |
| 627 | 3300006353 | Ga0075370_10142635 | Ga0075370_101426352 | 200 |
| 628 | 3300006881 | Ga0068865_100068362 | Ga0068865_1000683623 | 200 |
| 629 | 3300006931 | Ga0097620_100305101 | Ga0097620_1003051012 | 200 |
| 630 | 3300009092 | Ga0105250_10105046 | Ga0105250_101050461 | 200 |
| 631 | 3300009094 | Ga0111539_10371035 | Ga0111539_103710352 | 200 |
| 632 | 3300009098 | Ga0105245_10851538 | Ga0105245_108515381 | 200 |
| 633 | 3300009101 | Ga0105247_10057261 | Ga0105247_100572613 | 200 |
| 634 | 3300009545 | Ga0105237_10272572 | Ga0105237_102725722 | 200 |
| 635 | 3300009551 | Ga0105238_10987025 | Ga0105238_109870251 | 200 |
| 636 | 3300009553 | Ga0105249_10245996 | Ga0105249_102459962 | 200 |
| 637 | 3300010375 | Ga0105239_10550104 | Ga0105239_105501042 | 200 |
| 638 | 3300010375 | Ga0105239_11406331 | Ga0105239_114063311 | 200 |
| 639 | 3300011119 | Ga0105246_10098379 | Ga0105246_100983792 | 200 |
| 640 | 3300013297 | Ga0157378_10112066 | Ga0157378_101120663 | 200 |
| 641 | 3300013307 | Ga0157372_10153087 | Ga0157372_101530872 | 200 |
| 642 | 3300013308 | Ga0157375_10155284 | Ga0157375_101552843 | 200 |
| 643 | 3300014325 | Ga0163163_10013674 | Ga0163163_100136746 | 200 |
| 644 | 3300014325 | Ga0163163_11572693 | Ga0163163_115726931 | 200 |
| 645 | 3300014968 | Ga0157379_10100825 | Ga0157379_101008252 | 200 |
| 646 | 3300014969 | Ga0157376_10013024 | Ga0157376_100130248 | 200 |
| 647 | 3300025711 | Ga0207696_1015802 | Ga0207696_10158022 | 200 |
| 648 | 3300025900 | Ga0207710_10030781 | Ga0207710_100307813 | 200 |
| 649 | 3300025901 | Ga0207688_10001297 | Ga0207688_1000129711 | 200 |
| 650 | 3300025904 | Ga0207647_10040051 | Ga0207647_100400513 | 200 |
| 651 | 3300025905 | Ga0207685_10008023 | Ga0207685_100080232 | 200 |
| 652 | 3300025906 | Ga0207699_10095327 | Ga0207699_100953272 | 200 |
| 653 | 3300025915 | Ga0207693_10013807 | Ga0207693_100138072 | 200 |
| 654 | 3300025916 | Ga0207663_10018600 | Ga0207663_100186004 | 200 |
| 655 | 3300025918 | Ga0207662_10394384 | Ga0207662_103943841 | 200 |
| 656 | 3300025925 | Ga0207650_10168843 | Ga0207650_101688432 | 200 |
| 657 | 3300025926 | Ga0207659_10450998 | Ga0207659_104509981 | 200 |
| 658 | 3300025933 | Ga0207706_10015621 | Ga0207706_100156218 | 200 |
| 659 | 3300025936 | Ga0207670_10039764 | Ga0207670_100397644 | 200 |
| 660 | 3300025939 | Ga0207665_10013308 | Ga0207665_100133084 | 200 |
| 661 | 3300025939 | Ga0207665_10180592 | Ga0207665_101805922 | 200 |
| 662 | 3300025942 | Ga0207689_10011504 | Ga0207689_100115046 | 200 |
| 663 | 3300025961 | Ga0207712_10628270 | Ga0207712_106282702 | 200 |
| 664 | 3300025972 | Ga0207668_10231040 | Ga0207668_102310402 | 200 |
| 665 | 3300025981 | Ga0207640_10145399 | Ga0207640_101453992 | 200 |
| 666 | 3300025986 | Ga0207658_10166960 | Ga0207658_101669602 | 200 |
| 667 | 3300026023 | Ga0207677_10122905 | Ga0207677_101229052 | 200 |
| 668 | 3300026041 | Ga0207639_10443856 | Ga0207639_104438562 | 200 |
| 669 | 3300026067 | Ga0207678_10019263 | Ga0207678_100192633 | 200 |
| 670 | 3300026075 | Ga0207708_10453942 | Ga0207708_104539422 | 200 |
| 671 | 3300026088 | Ga0207641_10012244 | Ga0207641_100122444 | 200 |
| 672 | 3300026089 | Ga0207648_10074996 | Ga0207648_100749964 | 200 |
| 673 | 3300026095 | Ga0207676_10216685 | Ga0207676_102166852 | 200 |
| 674 | 3300026118 | Ga0207675_100087105 | Ga0207675_1000871054 | 200 |
| 675 | 3300026121 | Ga0207683_10022248 | Ga0207683_100222484 | 200 |
| 676 | 3300028379 | Ga0268266_10014370 | Ga0268266_100143706 | 200 |
| 677 | 3300028380 | Ga0268265_10240798 | Ga0268265_102407982 | 200 |
| 678 | 3300035114 | Ga0373939_0010032 | Ga0373939_0010032_1309_1911 | 200 |
| 679 | 3300048904 | Ga0496101_0062885 | Ga0496101_0062885_2053_2679 | 200 |
| 680 | 3300048905 | Ga0496102_0003400 | Ga0496102_0003400_9031_9648 | 200 |
| 681 | 3300048905 | Ga0496102_0097736 | Ga0496102_0097736_1244_1870 | 200 |
| 682 | 3300048905 | Ga0496102_0514431 | Ga0496102_0514431_146_772 | 200 |
| 683 | 3300048906 | Ga0496103_0044538 | Ga0496103_0044538_286_903 | 200 |
| 684 | 3300048906 | Ga0496103_0171360 | Ga0496103_0171360_483_1100 | 200 |
| 685 | 3300048907 | Ga0496104_0009859 | Ga0496104_0009859_5751_6368 | 200 |
| 686 | 3300048908 | Ga0496105_0494012 | Ga0496105_0494012_45_662 | 200 |
| 687 | 3300048909 | Ga0496106_0054562 | Ga0496106_0054562_422_1048 | 200 |
| 688 | 3300048910 | Ga0496107_0404182 | Ga0496107_0404182_196_822 | 200 |
| 689 | 3300048911 | Ga0496108_0022472 | Ga0496108_0022472_1086_1712 | 200 |
| 690 | 3300048911 | Ga0496108_0137539 | Ga0496108_0137539_419_1036 | 200 |
| 691 | 3300048912 | Ga0496109_0059123 | Ga0496109_0059123_902_1519 | 200 |
| 692 | 3300048913 | Ga0496110_0050326 | Ga0496110_0050326_982_1608 | 200 |
| 693 | 3300048913 | Ga0496110_0738573 | Ga0496110_0738573_224_850 | 200 |
| 694 | 3300048916 | Ga0496113_0014152 | Ga0496113_0014152_2974_3591 | 200 |
| 695 | 3300050490 | nmdc:mga03n38_62840_c1 | nmdc:mga03n38_62840_c1_968_1585 | 200 |
| 696 | 3300050491 | nmdc:mga00v17_137957_c1 | nmdc:mga00v17_137957_c1_328_930 | 200 |
| 697 | 3300050491 | nmdc:mga00v17_6850_c1 | nmdc:mga00v17_6850_c1_15_617 | 200 |
| 698 | 3300050491 | nmdc:mga00v17_90032_c1 | nmdc:mga00v17_90032_c1_1288_1914 | 200 |
| 699 | 3300050496 | nmdc:mga07m45_111049_c1 | nmdc:mga07m45_111049_c1_301_918 | 200 |
| 700 | 3300050516 | nmdc:mga0sz30_42655_c1 | nmdc:mga0sz30_42655_c1_153_770 | 200 |
| 701 | 3300050516 | nmdc:mga0sz30_5891_c1 | nmdc:mga0sz30_5891_c1_1652_2254 | 200 |
| 702 | iso_pu_bacteria | 2902810491 | 2902810957 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h1t-assembly1.cif.gz_B | crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution | 0.8023 | 28 | 198 |
| 2h1t-assembly1.cif.gz_B | crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution | 0.7386 | 28 | 198 |
| 1sda-assembly2.cif.gz_G | crystal structure of peroxynitrite-modified bovine cu,zn superoxide dismutase | 0.7341 | 13 | 45 |
| 3sod-assembly1.cif.gz_O | changes in crystallographic structure and thermostability of a cu,zn superoxide dismutase mutant resulting from the removal of buried cysteine | 0.7206 | 13 | 49 |
| 7epo-assembly1.cif.gz_A-2 | ketosteroid isomerase ksi with 5-nitrobenzoxazole (5nbi) | 0.6679 | 28 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q22727_70_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8138 | 158 | 181 | 2.40.50.100 |
| 6btlA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8113 | 88 | 109 | 3.50.50.60 |
| af_G5EDG8_2_147_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7712 | 88 | 109 | 3.50.50.60 |
| af_O17578_65_199_3.40.1000.30 | Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; | 0.7504 | 71 | 108 | 3.40.1000.30 |
| 3sluA01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7348 | 59 | 96 | 3.10.450.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A117IL41-F1-model_v4 | Glycolipid-binding family protein | 0.9923 | 18 | 198 |
|
| AF-M2X0H9-F1-model_v4 | deleted | 0.9823 | 35 | 198 |
|
| AF-M2X0H9-F1-model_v4 | deleted | 0.9764 | 35 | 198 |
|
| AF-A0A117IL41-F1-model_v4 | Glycolipid-binding family protein | 0.9762 | 18 | 198 |
|
| AF-N1MAI4-F1-model_v4 | deleted | 0.9734 | 64 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar