F476207

General Info

Members Datasets Scaffolds Average Seq Length
702 260 1404 236

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10086850|Ga0070715_100868502
Length 275
Sequence VRVSVIIPTHNEAKAIGRVLADLPSNLVTEVIVVDSNSNDGTPEIAAKMGARLLQEPRRGYGRACLTGLAAANAPDVVVFLDGDYSDRPSELPILIQPILDGRADITLGSRRRERRSAGALPWHQVLGNRLAASLIRLLYRLDITDLGPFRAGRADVLGALGLEEKTYGWAVEMILKGALAGYRVIEVPVSYYPRIGKSKISGTLKGTIGAGWFILSLIVRYYFRRRIGATPKPAAHQNYATLERDGGAIVRERPCTGNHGESTEARHGQDSPYA

Samples

Sample ID Description Type Environment
1 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.56
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 25.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070715_10086850 3300006163 Bacteria 1431
2 LJNas_1000349 3300000546 Bacteria 8109
3 LJNas_1009783 3300000546 Unclassified 1024
4 Ga0065712_10010322 3300005290 Bacteria 2115
5 Ga0070658_10214408 3300005327 Bacteria 1627
6 Ga0070676_10004271 3300005328 Bacteria 7506
7 Ga0070683_100009472 3300005329 Bacteria 8331
8 Ga0070683_100194454 3300005329 Bacteria 1926
9 Ga0070683_100631946 3300005329 Bacteria 1025
10 Ga0070690_100109004 3300005330 Bacteria 1845
11 Ga0070670_100012988 3300005331 Bacteria 7131
12 Ga0070670_100202703 3300005331 Bacteria 1724
13 Ga0068869_100042663 3300005334 Bacteria 3253
14 Ga0068869_100131910 3300005334 Bacteria 1921
15 Ga0068869_100158088 3300005334 Bacteria 1763
16 Ga0070666_10007921 3300005335 Bacteria 6564
17 Ga0070666_10227042 3300005335 Bacteria 1318
18 Ga0070680_100040194 3300005336 Unclassified 3786
19 Ga0070680_100157142 3300005336 Bacteria 1910
20 Ga0070680_100199043 3300005336 Unclassified 1689
21 Ga0070680_100408162 3300005336 Bacteria 1158
22 Ga0068868_100094805 3300005338 Bacteria 2408
23 Ga0070660_100009894 3300005339 Bacteria 6726
24 Ga0070660_100141774 3300005339 Unclassified 1928
25 Ga0070661_100078921 3300005344 Bacteria 2428
26 Ga0070661_100612181 3300005344 Unclassified 881
27 Ga0070668_100265344 3300005347 Bacteria 1429
28 Ga0070669_100027856 3300005353 Bacteria 4067
29 Ga0070675_100252454 3300005354 Bacteria 1544
30 Ga0070671_100018649 3300005355 Bacteria 5638
31 Ga0070671_100026671 3300005355 Unclassified 4751
32 Ga0070671_100240237 3300005355 Bacteria 1537
33 Ga0070671_100499019 3300005355 Unclassified 1047
34 Ga0070673_100275847 3300005364 Bacteria 1473
35 Ga0070659_100022184 3300005366 Bacteria 4843
36 Ga0070659_100148454 3300005366 Bacteria 1911
37 Ga0070667_100008621 3300005367 Bacteria 8450
38 Ga0070709_10015593 3300005434 Unclassified 4327
39 Ga0070709_10047348 3300005434 Bacteria 2678
40 Ga0070709_10070357 3300005434 Bacteria 2255
41 Ga0070709_10099697 3300005434 Bacteria 1933
42 Ga0070709_10101062 3300005434 Bacteria 1921
43 Ga0070709_10224941 3300005434 Bacteria 1340
44 Ga0070709_10572290 3300005434 Bacteria 867
45 Ga0070714_100000231 3300005435 Bacteria 44130
46 Ga0070714_100002825 3300005435 Bacteria 12811
47 Ga0070714_100016881 3300005435 Bacteria 5905
48 Ga0070714_100040186 3300005435 Unclassified 3941
49 Ga0070714_100040692 3300005435 Unclassified 3918
50 Ga0070714_100077770 3300005435 Bacteria 2882
51 Ga0070714_100080724 3300005435 Bacteria 2830
52 Ga0070714_100123982 3300005435 Bacteria 2301
53 Ga0070714_100131459 3300005435 Bacteria 2237
54 Ga0070714_100179564 3300005435 Bacteria 1925
55 Ga0070714_100642992 3300005435 Bacteria 1021
56 Ga0070713_100037457 3300005436 Unclassified 3921
57 Ga0070713_100044039 3300005436 Bacteria 3652
58 Ga0070713_100050310 3300005436 Unclassified 3442
59 Ga0070713_100067106 3300005436 Bacteria 3019
60 Ga0070713_100079724 3300005436 Bacteria 2790
61 Ga0070713_100126421 3300005436 Bacteria 2249
62 Ga0070713_100183904 3300005436 Bacteria 1879
63 Ga0070713_100338960 3300005436 Bacteria 1393
64 Ga0070713_100834149 3300005436 Unclassified 885
65 Ga0070710_10000598 3300005437 Bacteria 17193
66 Ga0070710_10030372 3300005437 Bacteria 2907
67 Ga0070710_10086096 3300005437 Bacteria 1845
68 Ga0070711_100000159 3300005439 Bacteria 36590
69 Ga0070711_100004814 3300005439 Bacteria 8007
70 Ga0070711_100036059 3300005439 Bacteria 3312
71 Ga0070711_100219153 3300005439 Bacteria 1478
72 Ga0070705_100090729 3300005440 Bacteria 1903
73 Ga0070708_100015426 3300005445 Bacteria 6311
74 Ga0070708_100022662 3300005445 Bacteria 5329
75 Ga0070708_100134488 3300005445 Bacteria 2290
76 Ga0070708_100147272 3300005445 Bacteria 2188
77 Ga0070708_100182492 3300005445 Bacteria 1962
78 Ga0070708_100210712 3300005445 Bacteria 1821
79 Ga0070708_100514080 3300005445 Unclassified 1129
80 Ga0070663_100001583 3300005455 Bacteria 12524
81 Ga0070663_100058233 3300005455 Unclassified 2774
82 Ga0070663_100202162 3300005455 Bacteria 1551
83 Ga0070678_100014781 3300005456 Unclassified 4937
84 Ga0070662_100007366 3300005457 Bacteria 7129
85 Ga0070681_10013120 3300005458 Bacteria 8231
86 Ga0070681_10023043 3300005458 Bacteria 6261
87 Ga0070681_10050013 3300005458 Unclassified 4172
88 Ga0070681_10196413 3300005458 Bacteria 1936
89 Ga0070681_10708545 3300005458 Unclassified 922
90 Ga0070706_100002718 3300005467 Bacteria 17695
91 Ga0070707_100043153 3300005468 Bacteria 4317
92 Ga0070707_100217838 3300005468 Bacteria 1860
93 Ga0070707_100511377 3300005468 Bacteria 1163
94 Ga0070707_100580287 3300005468 Bacteria 1083
95 Ga0070698_100169559 3300005471 Bacteria 2124
96 Ga0070699_100014701 3300005518 Bacteria 6731
97 Ga0070699_100092300 3300005518 Bacteria 2648
98 Ga0070699_100255190 3300005518 Bacteria 1567
99 Ga0070699_100383218 3300005518 Unclassified 1270
100 Ga0070679_100057638 3300005530 Unclassified 3872
101 Ga0070679_100107684 3300005530 Bacteria 2773
102 Ga0070679_100131331 3300005530 Bacteria 2485
103 Ga0070679_100497605 3300005530 Unclassified 1163
104 Ga0070684_100100654 3300005535 Bacteria 2581
105 Ga0070684_100114557 3300005535 Bacteria 2420
106 Ga0070697_100000326 3300005536 Bacteria 37671
107 Ga0070697_100011012 3300005536 Bacteria 7065
108 Ga0070697_100011538 3300005536 Bacteria 6903
109 Ga0070697_100026945 3300005536 Bacteria 4596
110 Ga0070697_100145934 3300005536 Unclassified 1991
111 Ga0070697_100163468 3300005536 Bacteria 1881
112 Ga0070697_100169918 3300005536 Bacteria 1845
113 Ga0070697_100263634 3300005536 Bacteria 1476
114 Ga0068853_100000041 3300005539 Bacteria 104733
115 Ga0068853_100074178 3300005539 Unclassified 2968
116 Ga0068853_100128518 3300005539 Bacteria 2266
117 Ga0068853_100161418 3300005539 Bacteria 2023
118 Ga0070695_100065390 3300005545 Bacteria 2368
119 Ga0070695_100122838 3300005545 Unclassified 1779
120 Ga0070696_100242520 3300005546 Bacteria 1360
121 Ga0070693_100017058 3300005547 Bacteria 3768
122 Ga0070665_100002740 3300005548 Bacteria 19089
123 Ga0070665_100128605 3300005548 Bacteria 2535
124 Ga0070665_100202526 3300005548 Unclassified 1985
125 Ga0068855_100001421 3300005563 Bacteria 29751
126 Ga0068855_100007086 3300005563 Bacteria 13598
127 Ga0068855_100103090 3300005563 Bacteria 3283
128 Ga0068855_100182725 3300005563 Bacteria 2370
129 Ga0068855_100551094 3300005563 Bacteria 1248
130 Ga0068855_100596962 3300005563 Unclassified 1191
131 Ga0070664_100028967 3300005564 Unclassified 4613
132 Ga0068857_100040374 3300005577 Unclassified 4138
133 Ga0068857_100199467 3300005577 Bacteria 1824
134 Ga0068854_100000122 3300005578 Bacteria 53557
135 Ga0068854_100004655 3300005578 Bacteria 8657
136 Ga0068854_100012486 3300005578 Bacteria 5565
137 Ga0068856_100001532 3300005614 Bacteria 24221
138 Ga0068856_100001724 3300005614 Bacteria 22874
139 Ga0068856_100084818 3300005614 Bacteria 3147
140 Ga0068856_100275654 3300005614 Bacteria 1698
141 Ga0068852_100006220 3300005616 Bacteria 8608
142 Ga0068859_100069216 3300005617 Bacteria 3564
143 Ga0068859_100661688 3300005617 Unclassified 1136
144 Ga0068864_100002560 3300005618 Bacteria 15015
145 Ga0068864_100166538 3300005618 Bacteria 2007
146 Ga0068866_10007100 3300005718 Unclassified 4682
147 Ga0068866_10188617 3300005718 Unclassified 1223
148 Ga0068851_10022899 3300005834 Bacteria 3049
149 Ga0068851_10162447 3300005834 Bacteria 1228
150 Ga0068870_10099249 3300005840 Unclassified 1642
151 Ga0068863_100246309 3300005841 Unclassified 1726
152 Ga0068863_100312803 3300005841 Bacteria 1525
153 Ga0068858_100012338 3300005842 Bacteria 8057
154 Ga0068858_100051663 3300005842 Unclassified 3803
155 Ga0068860_100014915 3300005843 Bacteria 7599
156 Ga0068860_100017349 3300005843 Bacteria 7014
157 Ga0068862_101143201 3300005844 Unclassified 775
158 Ga0081455_10187249 3300005937 Unclassified 1562
159 Ga0070717_10001232 3300006028 Bacteria 17417
160 Ga0070717_10002444 3300006028 Bacteria 13112
161 Ga0070717_10020392 3300006028 Bacteria 5213
162 Ga0070717_10022002 3300006028 Bacteria 5031
163 Ga0070717_10080035 3300006028 Unclassified 2741
164 Ga0070717_10091757 3300006028 Bacteria 2565
165 Ga0070717_10100743 3300006028 Bacteria 2453
166 Ga0070717_10165414 3300006028 Unclassified 1921
167 Ga0070717_10188568 3300006028 Bacteria 1801
168 Ga0070717_10239227 3300006028 Unclassified 1600
169 Ga0070717_10325563 3300006028 Unclassified 1370
170 Ga0070717_10583582 3300006028 Bacteria 1013
171 Ga0070715_10006010 3300006163 Bacteria 4095
172 Ga0070715_10009792 3300006163 Bacteria 3392
173 Ga0070715_10033649 3300006163 Bacteria 2096
174 Ga0070716_100000354 3300006173 Bacteria 18784
175 Ga0070716_100013004 3300006173 Unclassified 4231
176 Ga0070716_100020719 3300006173 Bacteria 3455
177 Ga0070716_100037906 3300006173 Bacteria 2666
178 Ga0070716_100060291 3300006173 Unclassified 2191
179 Ga0070716_100069700 3300006173 Bacteria 2062
180 Ga0070716_100087231 3300006173 Bacteria 1880
181 Ga0070716_100135372 3300006173 Bacteria 1564
182 Ga0070716_100273149 3300006173 Bacteria 1163
183 Ga0070716_100327496 3300006173 Bacteria 1076
184 Ga0070716_100464490 3300006173 Bacteria 926
185 Ga0070712_100006375 3300006175 Bacteria 7319
186 Ga0070712_100023999 3300006175 Bacteria 4035
187 Ga0070712_100033247 3300006175 Bacteria 3488
188 Ga0070712_100034649 3300006175 Bacteria 3423
189 Ga0070712_100063059 3300006175 Unclassified 2623
190 Ga0070712_100127114 3300006175 Unclassified 1927
191 Ga0070712_100135417 3300006175 Bacteria 1873
192 Ga0070712_100291568 3300006175 Unclassified 1317
193 Ga0097621_100000034 3300006237 Bacteria 69159
194 Ga0097621_100019759 3300006237 Bacteria 5178
195 Ga0097621_100026888 3300006237 Unclassified 4520
196 Ga0097621_100067291 3300006237 Bacteria 2952
197 Ga0097621_100420697 3300006237 Unclassified 1199
198 Ga0068871_100000819 3300006358 Bacteria 20831
199 Ga0068871_100008170 3300006358 Bacteria 7519
200 Ga0068871_100145113 3300006358 Bacteria 2020
201 Ga0068871_100170052 3300006358 Unclassified 1868
202 Ga0068871_100213398 3300006358 Bacteria 1670
203 Ga0075430_100190189 3300006846 Unclassified 1706
204 Ga0075431_100140971 3300006847 Unclassified 2485
205 Ga0075433_10004547 3300006852 Bacteria 10818
206 Ga0075433_10008310 3300006852 Bacteria 8275
207 Ga0075433_10498326 3300006852 Bacteria 1072
208 Ga0075434_100000235 3300006871 Bacteria 38289
209 Ga0075434_100004271 3300006871 Bacteria 12817
210 Ga0075434_100020351 3300006871 Bacteria 6435
211 Ga0075434_100033552 3300006871 Bacteria 5066
212 Ga0075434_100232600 3300006871 Bacteria 1863
213 Ga0075429_100029806 3300006880 Bacteria 4740
214 Ga0068865_100299098 3300006881 Bacteria 1287
215 Ga0068865_100531565 3300006881 Unclassified 985
216 Ga0075436_100002580 3300006914 Bacteria 12453
217 Ga0075436_100005980 3300006914 Bacteria 8355
218 Ga0075436_100008969 3300006914 Bacteria 6844
219 Ga0075436_100090790 3300006914 Bacteria 2124
220 Ga0075436_100100340 3300006914 Bacteria 2016
221 Ga0075436_100163182 3300006914 Bacteria 1571
222 Ga0097620_100069219 3300006931 Bacteria 3564
223 Ga0097620_100661662 3300006931 Unclassified 1136
224 Ga0075435_100003821 3300007076 Bacteria 10277
225 Ga0075435_100007962 3300007076 Bacteria 7584
226 Ga0075435_100091169 3300007076 Unclassified 2515
227 Ga0075435_100185332 3300007076 Unclassified 1760
228 Ga0075435_100299519 3300007076 Unclassified 1375
229 Ga0099794_10000033 3300007265 Bacteria 57721
230 Ga0105240_10004264 3300009093 Bacteria 21862
231 Ga0105240_10038089 3300009093 Bacteria 6172
232 Ga0105240_10040354 3300009093 Bacteria 5971
233 Ga0105240_10042413 3300009093 Bacteria 5798
234 Ga0105240_10047360 3300009093 Bacteria 5441
235 Ga0105240_10227221 3300009093 Bacteria 2171
236 Ga0105240_10377040 3300009093 Bacteria 1603
237 Ga0105245_10000411 3300009098 Bacteria 39875
238 Ga0105245_10247513 3300009098 Unclassified 1731
239 Ga0105245_10273445 3300009098 Bacteria 1648
240 Ga0114129_10006148 3300009147 Bacteria 17029
241 Ga0114129_10074350 3300009147 Unclassified 4733
242 Ga0114129_10098137 3300009147 Bacteria 4055
243 Ga0114129_10599373 3300009147 Bacteria 1427
244 Ga0105241_10008117 3300009174 Bacteria 7728
245 Ga0105241_10039967 3300009174 Unclassified 3539
246 Ga0105241_10328312 3300009174 Bacteria 1321
247 Ga0105241_10335533 3300009174 Bacteria 1308
248 Ga0105242_10076575 3300009176 Bacteria 2789
249 Ga0105242_10143932 3300009176 Unclassified 2072
250 Ga0105248_10011027 3300009177 Bacteria 9969
251 Ga0105248_10044402 3300009177 Bacteria 4984
252 Ga0105248_10069980 3300009177 Unclassified 3940
253 Ga0105248_10161420 3300009177 Bacteria 2528
254 Ga0105248_10399384 3300009177 Bacteria 1548
255 Ga0105248_10571794 3300009177 Bacteria 1275
256 Ga0105248_10957926 3300009177 Bacteria 966
257 Ga0105237_10014906 3300009545 Bacteria 8105
258 Ga0105237_10038741 3300009545 Bacteria 4813
259 Ga0105237_10244648 3300009545 Unclassified 1795
260 Ga0105237_10340471 3300009545 Bacteria 1504
261 Ga0105237_10484699 3300009545 Bacteria 1243
262 Ga0105238_10034553 3300009551 Bacteria 5143
263 Ga0105238_10036544 3300009551 Bacteria 4994
264 Ga0105249_10017407 3300009553 Bacteria 6380
265 Ga0105249_10525858 3300009553 Bacteria 1231
266 Ga0099796_10045110 3300010159 Bacteria 1509
267 Ga0105239_10021480 3300010375 Bacteria 7116
268 Ga0105239_10095242 3300010375 Unclassified 3289
269 Ga0105239_10204751 3300010375 Bacteria 2211
270 Ga0105239_10270453 3300010375 Bacteria 1911
271 Ga0105246_10020182 3300011119 Unclassified 4272
272 Ga0157373_10007167 3300013100 Bacteria 8319
273 Ga0157371_10138302 3300013102 Bacteria 1735
274 Ga0157370_10002484 3300013104 Bacteria 22231
275 Ga0157370_10581091 3300013104 Unclassified 1026
276 Ga0157370_10582087 3300013104 Bacteria 1025
277 Ga0157369_10010669 3300013105 Bacteria 10456
278 Ga0157369_10119097 3300013105 Unclassified 2802
279 Ga0157369_10155259 3300013105 Bacteria 2418
280 Ga0157369_10399861 3300013105 Bacteria 1425
281 Ga0157374_10000249 3300013296 Bacteria 49808
282 Ga0157374_10000787 3300013296 Bacteria 27777
283 Ga0157374_10009849 3300013296 Bacteria 8202
284 Ga0157374_10128064 3300013296 Unclassified 2455
285 Ga0157374_10136988 3300013296 Bacteria 2374
286 Ga0157374_10731504 3300013296 Unclassified 1003
287 Ga0157378_10000008 3300013297 Bacteria 162605
288 Ga0157378_10001217 3300013297 Bacteria 23322
289 Ga0157378_10003381 3300013297 Bacteria 14183
290 Ga0157378_10011452 3300013297 Bacteria 7761
291 Ga0157378_10038080 3300013297 Unclassified 4261
292 Ga0163162_10008783 3300013306 Bacteria 9822
293 Ga0157372_10000436 3300013307 Bacteria 45959
294 Ga0157372_10000992 3300013307 Bacteria 31047
295 Ga0157372_10030521 3300013307 Bacteria 5897
296 Ga0157372_10141022 3300013307 Bacteria 2776
297 Ga0157375_10024068 3300013308 Bacteria 5630
298 Ga0157375_10117717 3300013308 Bacteria 2763
299 Ga0157375_10813244 3300013308 Unclassified 1083
300 Ga0163163_10018345 3300014325 Bacteria 6548
301 Ga0163163_10064958 3300014325 Bacteria 3621
302 Ga0163163_10186746 3300014325 Bacteria 2120
303 Ga0163163_10239781 3300014325 Bacteria 1863
304 Ga0182008_10021637 3300014497 Bacteria 3302
305 Ga0157379_10003566 3300014968 Bacteria 13181
306 Ga0157376_10001493 3300014969 Bacteria 15434
307 Ga0157376_10002140 3300014969 Bacteria 13309
308 Ga0157376_10088787 3300014969 Unclassified 2671
309 Ga0182006_1046599 3300015261 Bacteria 1684
310 Ga0182007_10028080 3300015262 Bacteria 1935
311 Ga0182005_1011524 3300015265 Bacteria 2518
312 Ga0213873_10074341 3300021358 Unclassified 941
313 Ga0213872_10001338 3300021361 Bacteria 16267
314 Ga0213872_10001709 3300021361 Bacteria 13824
315 Ga0213872_10002491 3300021361 Bacteria 10775
316 Ga0213872_10031819 3300021361 Bacteria 2418
317 Ga0213872_10045545 3300021361 Bacteria 1996
318 Ga0213872_10094590 3300021361 Bacteria 1335
319 Ga0213872_10104727 3300021361 Bacteria 1259
320 Ga0213876_10056935 3300021384 Bacteria 2064
321 Ga0213875_10009771 3300021388 Bacteria 4843
322 Ga0213875_10080460 3300021388 Bacteria 1520
323 Ga0213875_10223533 3300021388 Unclassified 887
324 Ga0213871_10008210 3300021441 Bacteria 2292
325 Ga0228598_1001283 3300024227 Bacteria 5531
326 Ga0207656_10072300 3300025321 Bacteria 1535
327 Ga0207656_10091279 3300025321 Bacteria 1383
328 Ga0207692_10003006 3300025898 Bacteria 6536
329 Ga0207692_10040499 3300025898 Bacteria 2299
330 Ga0207692_10086083 3300025898 Bacteria 1692
331 Ga0207692_10106975 3300025898 Bacteria 1545
332 Ga0207642_10167351 3300025899 Unclassified 1186
333 Ga0207680_10112310 3300025903 Unclassified 1769
334 Ga0207647_10006284 3300025904 Bacteria 8650
335 Ga0207685_10006465 3300025905 Bacteria 3193
336 Ga0207685_10013507 3300025905 Bacteria 2528
337 Ga0207685_10020451 3300025905 Unclassified 2200
338 Ga0207699_10011334 3300025906 Bacteria 4498
339 Ga0207699_10015299 3300025906 Unclassified 3981
340 Ga0207699_10089353 3300025906 Bacteria 1931
341 Ga0207699_10117445 3300025906 Bacteria 1715
342 Ga0207699_10213385 3300025906 Bacteria 1314
343 Ga0207699_10471827 3300025906 Unclassified 903
344 Ga0207645_10096239 3300025907 Bacteria 1907
345 Ga0207705_10190255 3300025909 Bacteria 1552
346 Ga0207684_10000973 3300025910 Bacteria 32084
347 Ga0207684_10002906 3300025910 Bacteria 16981
348 Ga0207684_10125543 3300025910 Bacteria 2202
349 Ga0207654_10008704 3300025911 Bacteria 5144
350 Ga0207707_10015200 3300025912 Bacteria 6702
351 Ga0207707_10029186 3300025912 Bacteria 4821
352 Ga0207707_10086116 3300025912 Bacteria 2746
353 Ga0207707_10150117 3300025912 Bacteria 2038
354 Ga0207695_10005455 3300025913 Bacteria 16847
355 Ga0207695_10009167 3300025913 Bacteria 12278
356 Ga0207695_10025939 3300025913 Bacteria 6549
357 Ga0207695_10107005 3300025913 Bacteria 2782
358 Ga0207671_10096036 3300025914 Bacteria 2239
359 Ga0207693_10002464 3300025915 Bacteria 16079
360 Ga0207693_10005557 3300025915 Bacteria 10490
361 Ga0207693_10007800 3300025915 Bacteria 8785
362 Ga0207693_10013939 3300025915 Bacteria 6473
363 Ga0207693_10015230 3300025915 Bacteria 6172
364 Ga0207693_10032918 3300025915 Bacteria 4091
365 Ga0207693_10038900 3300025915 Bacteria 3744
366 Ga0207693_10130900 3300025915 Bacteria 1972
367 Ga0207693_10434100 3300025915 Unclassified 1027
368 Ga0207663_10000965 3300025916 Bacteria 13150
369 Ga0207663_10012760 3300025916 Unclassified 4551
370 Ga0207663_10066743 3300025916 Unclassified 2304
371 Ga0207663_10491865 3300025916 Unclassified 952
372 Ga0207663_10669175 3300025916 Unclassified 820
373 Ga0207660_10267115 3300025917 Bacteria 1354
374 Ga0207657_10001667 3300025919 Bacteria 23967
375 Ga0207657_10010205 3300025919 Bacteria 9383
376 Ga0207649_10065523 3300025920 Bacteria 2300
377 Ga0207649_10088524 3300025920 Bacteria 2022
378 Ga0207652_10083234 3300025921 Unclassified 2801
379 Ga0207652_10123880 3300025921 Bacteria 2301
380 Ga0207652_10263798 3300025921 Unclassified 1554
381 Ga0207652_10311790 3300025921 Unclassified 1420
382 Ga0207646_10006332 3300025922 Bacteria 12262
383 Ga0207646_10007050 3300025922 Bacteria 11497
384 Ga0207646_10045458 3300025922 Bacteria 3942
385 Ga0207646_10105087 3300025922 Bacteria 2532
386 Ga0207646_10171569 3300025922 Bacteria 1959
387 Ga0207646_10332408 3300025922 Unclassified 1373
388 Ga0207681_10303896 3300025923 Unclassified 1263
389 Ga0207694_10063306 3300025924 Bacteria 2881
390 Ga0207694_10092037 3300025924 Bacteria 2393
391 Ga0207650_10672896 3300025925 Bacteria 873
392 Ga0207659_10433059 3300025926 Unclassified 1105
393 Ga0207687_10000141 3300025927 Bacteria 48006
394 Ga0207700_10006490 3300025928 Bacteria 7068
395 Ga0207700_10008629 3300025928 Bacteria 6326
396 Ga0207700_10018967 3300025928 Bacteria 4637
397 Ga0207700_10028873 3300025928 Unclassified 3908
398 Ga0207700_10028932 3300025928 Bacteria 3905
399 Ga0207700_10112223 3300025928 Bacteria 2196
400 Ga0207700_10185866 3300025928 Bacteria 1743
401 Ga0207700_10247750 3300025928 Unclassified 1521
402 Ga0207700_10326187 3300025928 Unclassified 1332
403 Ga0207700_10468180 3300025928 Bacteria 1112
404 Ga0207700_10586354 3300025928 Unclassified 992
405 Ga0207664_10000033 3300025929 Bacteria 176549
406 Ga0207664_10050872 3300025929 Bacteria 3269
407 Ga0207664_10136687 3300025929 Bacteria 2069
408 Ga0207664_10142917 3300025929 Unclassified 2026
409 Ga0207664_10159823 3300025929 Bacteria 1921
410 Ga0207664_10388694 3300025929 Unclassified 1239
411 Ga0207664_10466259 3300025929 Bacteria 1129
412 Ga0207664_10646445 3300025929 Bacteria 950
413 Ga0207664_10740070 3300025929 Bacteria 884
414 Ga0207644_10017386 3300025931 Unclassified 4855
415 Ga0207644_10127442 3300025931 Bacteria 1944
416 Ga0207644_10175159 3300025931 Bacteria 1678
417 Ga0207690_10006731 3300025932 Bacteria 6811
418 Ga0207690_10118299 3300025932 Unclassified 1920
419 Ga0207706_10009258 3300025933 Bacteria 9050
420 Ga0207706_10016470 3300025933 Bacteria 6671
421 Ga0207686_10624807 3300025934 Unclassified 850
422 Ga0207709_10354244 3300025935 Unclassified 1109
423 Ga0207704_10069593 3300025938 Bacteria 2224
424 Ga0207704_10109315 3300025938 Unclassified 1864
425 Ga0207665_10000596 3300025939 Bacteria 24294
426 Ga0207665_10008819 3300025939 Bacteria 6629
427 Ga0207665_10014915 3300025939 Bacteria 5105
428 Ga0207665_10021588 3300025939 Unclassified 4235
429 Ga0207665_10052040 3300025939 Bacteria 2758
430 Ga0207665_10084007 3300025939 Unclassified 2197
431 Ga0207665_10095860 3300025939 Unclassified 2063
432 Ga0207665_10184528 3300025939 Bacteria 1512
433 Ga0207665_10315896 3300025939 Bacteria 1171
434 Ga0207711_10062942 3300025941 Bacteria 3202
435 Ga0207711_10779816 3300025941 Bacteria 890
436 Ga0207689_10095246 3300025942 Bacteria 2445
437 Ga0207661_10001952 3300025944 Bacteria 14178
438 Ga0207661_10005239 3300025944 Bacteria 9117
439 Ga0207661_10147408 3300025944 Bacteria 2032
440 Ga0207661_10430664 3300025944 Unclassified 1199
441 Ga0207679_10011893 3300025945 Bacteria 5657
442 Ga0207679_10191162 3300025945 Bacteria 1702
443 Ga0207667_10001192 3300025949 Bacteria 32605
444 Ga0207667_10001239 3300025949 Bacteria 32026
445 Ga0207667_10187553 3300025949 Bacteria 2123
446 Ga0207667_10210046 3300025949 Bacteria 1995
447 Ga0207667_10219774 3300025949 Bacteria 1947
448 Ga0207667_10262487 3300025949 Bacteria 1766
449 Ga0207640_10000057 3300025981 Bacteria 93580
450 Ga0207640_10000158 3300025981 Bacteria 49097
451 Ga0207640_10004462 3300025981 Bacteria 7584
452 Ga0207640_10068667 3300025981 Bacteria 2376
453 Ga0207658_10009142 3300025986 Bacteria 6722
454 Ga0207677_10068958 3300026023 Bacteria 2485
455 Ga0207703_10110369 3300026035 Unclassified 2346
456 Ga0207639_10000016 3300026041 Bacteria 262939
457 Ga0207639_10225636 3300026041 Unclassified 1621
458 Ga0207678_10000903 3300026067 Bacteria 27239
459 Ga0207678_10081936 3300026067 Unclassified 2761
460 Ga0207678_10221465 3300026067 Unclassified 1620
461 Ga0207702_10001513 3300026078 Bacteria 22979
462 Ga0207702_10002159 3300026078 Bacteria 18888
463 Ga0207702_10016811 3300026078 Bacteria 6055
464 Ga0207702_10172398 3300026078 Bacteria 1985
465 Ga0207702_10224439 3300026078 Unclassified 1752
466 Ga0207702_10306028 3300026078 Unclassified 1510
467 Ga0207702_10384566 3300026078 Unclassified 1350
468 Ga0207641_10088629 3300026088 Bacteria 2702
469 Ga0207641_10176111 3300026088 Bacteria 1956
470 Ga0207641_10382407 3300026088 Bacteria 1348
471 Ga0207641_11084520 3300026088 Unclassified 799
472 Ga0207648_10005015 3300026089 Bacteria 13446
473 Ga0207648_10010627 3300026089 Bacteria 8702
474 Ga0207674_10044672 3300026116 Bacteria 4563
475 Ga0207674_10047118 3300026116 Unclassified 4422
476 Ga0207683_10015510 3300026121 Bacteria 6487
477 Ga0207698_10053084 3300026142 Unclassified 3109
478 Ga0207698_10517645 3300026142 Bacteria 1164
479 Ga0209588_1000006 3300027671 Bacteria 184445
480 Ga0209588_1009128 3300027671 Unclassified 2957
481 Ga0209588_1010182 3300027671 Bacteria 2823
482 Ga0268266_10007114 3300028379 Bacteria 10150
483 Ga0268266_10120259 3300028379 Unclassified 2337
484 Ga0268265_10918769 3300028380 Unclassified 860
485 Ga0268264_10010932 3300028381 Bacteria 7498
486 Ga0265762_1004191 3300030760 Bacteria 2584
487 Ga0265762_1016240 3300030760 Bacteria 1350
488 Ga0265763_1009638 3300030763 Bacteria 881
489 Ga0265770_1013007 3300030878 Unclassified 1239
490 Ga0265760_10004082 3300031090 Unclassified 4207
491 Ga0265760_10005650 3300031090 Bacteria 3579
492 Ga0265760_10010730 3300031090 Bacteria 2617
493 Ga0265760_10015676 3300031090 Bacteria 2174
494 Ga0265760_10042346 3300031090 Bacteria 1359
495 Ga0265760_10094101 3300031090 Unclassified 941
496 Ga0265760_10132109 3300031090 Bacteria 808
497 Ga0373926_0000619 3300035083 Bacteria 9661
498 Ga0373926_0001291 3300035083 Bacteria 7536
499 Ga0373926_0017249 3300035083 Unclassified 2477
500 Ga0373934_0000830 3300035086 Bacteria 11167
501 Ga0373934_0036650 3300035086 Bacteria 1932
502 Ga0373944_0043642 3300035089 Unclassified 1394
503 Ga0373923_0077297 3300035111 Bacteria 1439
504 Ga0373936_0009809 3300035113 Bacteria 3614
505 Ga0373953_0004359 3300035117 Unclassified 4506
506 Ga0373954_0000402 3300035118 Bacteria 16198
507 Ga0373954_0011555 3300035118 Bacteria 3915
508 Ga0373954_0163616 3300035118 Bacteria 1089
509 Ga0373956_0035799 3300035119 Unclassified 2190
510 Ga0373956_0047938 3300035119 Bacteria 1912
511 Ga0373957_0055850 3300035120 Unclassified 1519
512 Ga0373943_0000093 3300035170 Bacteria 32989
513 Ga0373943_0065347 3300035170 Bacteria 1829
514 Ga0373943_0078696 3300035170 Bacteria 1686
515 Ga0373946_0001175 3300035171 Bacteria 9070
516 Ga0373946_0040162 3300035171 Bacteria 1913
517 Ga0373946_0218051 3300035171 Bacteria 920
518 Ga0373955_0013271 3300035172 Bacteria 3979
519 Ga0373955_0142455 3300035172 Unclassified 1406
520 Ga0373942_0034388 3300035207 Unclassified 1356
521 Ga0373924_0023109 3300035410 Unclassified 2435
522 Ga0373931_0011405 3300035691 Unclassified 4294
523 Ga0373935_0000406 3300035692 Bacteria 22423
524 Ga0373935_0045385 3300035692 Bacteria 2773
525 Ga0373927_0000351 3300035695 Bacteria 36072
526 Ga0373927_0005076 3300035695 Bacteria 9107
527 Ga0373927_0009237 3300035695 Bacteria 6613
528 Ga0373927_0038721 3300035695 Bacteria 3095
529 Ga0373927_0057875 3300035695 Bacteria 2506
530 Ga0373927_0067963 3300035695 Bacteria 2306
531 Ga0373933_0000375 3300035724 Bacteria 28675
532 Ga0373933_0010901 3300035724 Bacteria 4991
533 Ga0373947_0003946 3300035725 Bacteria 8720
534 Ga0373947_0015910 3300035725 Bacteria 4321
535 Ga0373947_0022859 3300035725 Unclassified 3629
536 Ga0373947_0135446 3300035725 Bacteria 1575
537 Ga0373937_0000082 3300036401 Bacteria 87971
538 Ga0373937_0003011 3300036401 Bacteria 14130
539 Ga0373937_0009898 3300036401 Bacteria 8312
540 Ga0373937_0044675 3300036401 Bacteria 4047
541 Ga0373937_0078351 3300036401 Bacteria 3054
542 Ga0373937_0258866 3300036401 Bacteria 1641
543 Ga0373925_0001716 3300037068 Bacteria 18475
544 Ga0373925_0007208 3300037068 Bacteria 8128
545 Ga0373925_0007869 3300037068 Bacteria 7763
546 Ga0373925_0023003 3300037068 Bacteria 4548
547 Ga0373925_0517547 3300037068 Unclassified 980
548 Ga0395900_0173907 3300037418 Unclassified 2191
549 Ga0395898_0247788 3300037466 Unclassified 1699
550 Ga0436364_0042355 3300037853 Unclassified 4466
551 Ga0436364_0524449 3300037853 Unclassified 3644
552 Ga0436364_0868968 3300037853 Bacteria 1365
553 Ga0436364_1479972 3300037853 Bacteria 8306
554 Ga0395901_0069456 3300038443 Bacteria 3669
555 Ga0395901_0667415 3300038443 Unclassified 1041
556 Ga0242420_030418 3300038996 Bacteria 1000
557 Ga0436365_0031849 3300039437 Bacteria 47942
558 Ga0436365_1035977 3300039437 Bacteria 3956
559 Ga0436365_1116478 3300039437 Bacteria 7415
560 Ga0436360_0680576 3300039438 Bacteria 8776
561 Ga0436360_1228382 3300039438 Bacteria 4781
562 Ga0436361_0091471 3300039447 Bacteria 5518
563 Ga0436361_0169123 3300039447 Bacteria 4146
564 Ga0436361_0400616 3300039447 Bacteria 83329
565 Ga0436361_0502041 3300039447 Unclassified 990
566 Ga0436361_0672781 3300039447 Unclassified 3722
567 Ga0436361_0705926 3300039447 Bacteria 3484
568 Ga0436361_0775789 3300039447 Unclassified 2270
569 Ga0436361_0797421 3300039447 Bacteria 2176
570 Ga0436361_0875242 3300039447 Unclassified 1180
571 Ga0436363_0436454 3300039450 Bacteria 3703
572 Ga0436363_0493680 3300039450 Unclassified 3630
573 Ga0436363_0875210 3300039450 Bacteria 2001
574 Ga0436363_1630748 3300039450 Unclassified 1229
575 Ga0436362_0092701 3300039453 Bacteria 1580
576 Ga0436362_0405422 3300039453 Bacteria 2604
577 Ga0436362_0539068 3300039453 Bacteria 6207
578 Ga0451577_0081585 3300042876 Bacteria 2885
579 Ga0451577_0330959 3300042876 Bacteria 1381
580 Ga0453683_0218324 3300044673 Unclassified 1212
581 Ga0466964_0211108 3300044706 Unclassified 937
582 Ga0453684_0062176 3300044712 Bacteria 4785
583 Ga0453684_0285831 3300044712 Bacteria 1879
584 Ga0453684_0864965 3300044712 Bacteria 971
585 Ga0451576_0112174 3300045051 Bacteria 2838
586 Ga0451576_0413200 3300045051 Unclassified 1415
587 Ga0451576_0591900 3300045051 Unclassified 1166
588 Ga0451576_0631099 3300045051 Unclassified 1126
589 Ga0466967_0009451 3300045976 Bacteria 7233
590 Ga0466967_0127475 3300045976 Bacteria 2359
591 Ga0466967_0715932 3300045976 Unclassified 992
592 Ga0495592_0046432 3300046454 Bacteria 3238
593 Ga0495629_0054939 3300046459 Bacteria 2785
594 Ga0495651_0239363 3300046462 Unclassified 1246
595 Ga0495653_0044063 3300046463 Bacteria 3465
596 Ga0495580_0004001 3300046472 Bacteria 12437
597 Ga0495580_0006097 3300046472 Bacteria 9858
598 Ga0495580_0051162 3300046472 Bacteria 2921
599 Ga0495580_0085653 3300046472 Unclassified 2195
600 Ga0495582_0010407 3300046473 Bacteria 5116
601 Ga0495582_0024529 3300046473 Bacteria 3300
602 Ga0495639_0037357 3300046475 Bacteria 2176
603 Ga0495664_0064965 3300046477 Unclassified 2175
604 Ga0495664_0068823 3300046477 Unclassified 2113
605 Ga0495594_0041072 3300046499 Bacteria 2533
606 Ga0495608_0015490 3300046511 Bacteria 5288
607 Ga0495628_0161288 3300046516 Bacteria 1704
608 Ga0495630_0005548 3300046517 Bacteria 8904
609 Ga0495630_0046166 3300046517 Bacteria 3256
610 Ga0495630_0269710 3300046517 Bacteria 1300
611 Ga0495666_0038176 3300046526 Bacteria 2336
612 Ga0495666_0102548 3300046526 Bacteria 1348
613 Ga0495652_0293184 3300046529 Unclassified 1186
614 Ga0495665_0005685 3300046531 Bacteria 6729
615 Ga0495665_0010204 3300046531 Bacteria 5089
616 Ga0495665_0043956 3300046531 Unclassified 2375
617 Ga0495640_0010896 3300046533 Bacteria 7008
618 Ga0495586_0055264 3300046535 Bacteria 2151
619 Ga0495587_0003381 3300046536 Bacteria 10641
620 Ga0495587_0219283 3300046536 Bacteria 1073
621 Ga0495645_0081315 3300046543 Unclassified 2324
622 Ga0495622_0169289 3300046557 Unclassified 983
623 Ga0495667_0040669 3300046559 Unclassified 3086
624 Ga0495635_0042731 3300046663 Unclassified 3129
625 Ga0495635_0080644 3300046663 Bacteria 2227
626 Ga0495623_0106551 3300046679 Unclassified 1703
627 Ga0495623_0256534 3300046679 Bacteria 981
628 Ga0495647_0004251 3300046681 Bacteria 4638
629 Ga0495658_0008227 3300046683 Bacteria 5167
630 Ga0495613_0068203 3300046689 Bacteria 2594
631 Ga0495624_0044011 3300046690 Unclassified 2847
632 Ga0495670_0174275 3300046691 Bacteria 1134
633 Ga0495604_0000235 3300047317 Bacteria 49754
634 Ga0495674_0031040 3300047319 Bacteria 4856
635 Ga0495674_0060600 3300047319 Bacteria 3301
636 Ga0495674_0092937 3300047319 Bacteria 2575
637 Ga0495674_0099208 3300047319 Bacteria 2480
638 Ga0495676_0024901 3300047321 Bacteria 5172
639 Ga0495676_0138852 3300047321 Bacteria 1744
640 Ga0495676_0146067 3300047321 Bacteria 1689
641 Ga0495675_0168846 3300047444 Bacteria 1344
642 Ga0495684_0023950 3300047471 Unclassified 4695
643 Ga0495684_0082815 3300047471 Bacteria 2434
644 Ga0495602_0055071 3300048088 Unclassified 3505
645 Ga0495614_0026234 3300048089 Bacteria 2511
646 Ga0496100_0018636 3300048903 Unclassified 4122
647 Ga0496100_0395855 3300048903 Unclassified 1051
648 Ga0496100_0599525 3300048903 Unclassified 855
649 Ga0496101_0024720 3300048904 Bacteria 4161
650 Ga0496101_0081636 3300048904 Unclassified 2392
651 Ga0496101_0120502 3300048904 Bacteria 1983
652 Ga0496102_0003254 3300048905 Bacteria 13781
653 Ga0496102_0073061 3300048905 Unclassified 3153
654 Ga0496103_0027212 3300048906 Bacteria 3463
655 Ga0496103_0046043 3300048906 Bacteria 2692
656 Ga0496104_0021762 3300048907 Bacteria 5889
657 Ga0496105_0040427 3300048908 Bacteria 3845
658 Ga0496105_0722410 3300048908 Bacteria 763
659 Ga0496106_0354205 3300048909 Unclassified 1179
660 Ga0496108_0169891 3300048911 Bacteria 1886
661 Ga0496109_0038109 3300048912 Bacteria 4345
662 Ga0496109_0153116 3300048912 Bacteria 2159
663 Ga0496111_0051037 3300048914 Bacteria 2986
664 Ga0496112_0001829 3300048915 Bacteria 16733
665 Ga0496112_0021016 3300048915 Bacteria 6200
666 Ga0496112_0096825 3300048915 Bacteria 2921
667 Ga0496112_0109408 3300048915 Unclassified 2733
668 Ga0496112_0317599 3300048915 Bacteria 1502
669 Ga0496115_0042209 3300048918 Bacteria 3633
670 Ga0496115_0482676 3300048918 Unclassified 998
671 nmdc:mga05p37_42655_c1 3300050507 Bacteria 5576
672 nmdc:mga06r32_214002_c1 3300050510 Unclassified 1915
673 nmdc:mga08y16_384683_c1 3300050511 Bacteria 1438
674 nmdc:mga0n895_119480_c1 3300050512 Bacteria 2656
675 nmdc:mga0n895_129088_c1 3300050512 Bacteria 2552
676 nmdc:mga0n895_17170_c1 3300050512 Bacteria 6668
677 nmdc:mga0n895_4333_c1 3300050512 Bacteria 11630
678 nmdc:mga0n895_449647_c1 3300050512 Bacteria 1301
679 nmdc:mga0n895_6406_c1 3300050512 Bacteria 9987
680 nmdc:mga0n895_679426_c1 3300050512 Unclassified 1027
681 nmdc:mga0n895_696767_c1 3300050512 Unclassified 1012
682 nmdc:mga0rr50_140_c1 3300050513 Bacteria 39942
683 nmdc:mga0rr50_165242_c1 3300050513 Bacteria 1799
684 nmdc:mga0rr50_172327_c1 3300050513 Unclassified 1764
685 nmdc:mga0rr50_19118_c1 3300050513 Bacteria 4617
686 nmdc:mga0rr50_26280_c1 3300050513 Bacteria 4059
687 nmdc:mga0rr50_37308_c1 3300050513 Bacteria 3507
688 nmdc:mga0rr50_65554_c1 3300050513 Unclassified 2751
689 nmdc:mga0rr50_707053_c1 3300050513 Unclassified 860
690 nmdc:mga0rr50_74004_c1 3300050513 Unclassified 2606
691 nmdc:mga08x19_115419_c1 3300050514 Bacteria 1795
692 nmdc:mga08x19_11550_c1 3300050514 Bacteria 5315
693 nmdc:mga08x19_14044_c1 3300050514 Unclassified 4852
694 nmdc:mga08x19_171535_c1 3300050514 Bacteria 1478
695 nmdc:mga08x19_177582_c1 3300050514 Unclassified 1453
696 nmdc:mga08x19_22938_c1 3300050514 Bacteria 3870
697 nmdc:mga08x19_243722_c1 3300050514 Bacteria 1240
698 nmdc:mga08x19_43093_c1 3300050514 Bacteria 2879
699 nmdc:mga08x19_591227_c1 3300050514 Bacteria 786
700 nmdc:mga08x19_87945_c1 3300050514 Unclassified 2047
701 nmdc:mga0a205_40577_c1 3300050515 Bacteria 4481
702 nmdc:mga0a205_449_c1 3300050515 Bacteria 31835
703 Ga0070715_10086850
704 LJNas_1000349
705 LJNas_1009783
706 Ga0065712_10010322
707 Ga0070658_10214408
708 Ga0070676_10004271
709 Ga0070683_100009472
710 Ga0070683_100194454
711 Ga0070683_100631946
712 Ga0070690_100109004
713 Ga0070670_100012988
714 Ga0070670_100202703
715 Ga0068869_100042663
716 Ga0068869_100131910
717 Ga0068869_100158088
718 Ga0070666_10007921
719 Ga0070666_10227042
720 Ga0070680_100040194
721 Ga0070680_100157142
722 Ga0070680_100199043
723 Ga0070680_100408162
724 Ga0068868_100094805
725 Ga0070660_100009894
726 Ga0070660_100141774
727 Ga0070661_100078921
728 Ga0070661_100612181
729 Ga0070668_100265344
730 Ga0070669_100027856
731 Ga0070675_100252454
732 Ga0070671_100018649
733 Ga0070671_100026671
734 Ga0070671_100240237
735 Ga0070671_100499019
736 Ga0070673_100275847
737 Ga0070659_100022184
738 Ga0070659_100148454
739 Ga0070667_100008621
740 Ga0070709_10015593
741 Ga0070709_10047348
742 Ga0070709_10070357
743 Ga0070709_10099697
744 Ga0070709_10101062
745 Ga0070709_10224941
746 Ga0070709_10572290
747 Ga0070714_100000231
748 Ga0070714_100002825
749 Ga0070714_100016881
750 Ga0070714_100040186
751 Ga0070714_100040692
752 Ga0070714_100077770
753 Ga0070714_100080724
754 Ga0070714_100123982
755 Ga0070714_100131459
756 Ga0070714_100179564
757 Ga0070714_100642992
758 Ga0070713_100037457
759 Ga0070713_100044039
760 Ga0070713_100050310
761 Ga0070713_100067106
762 Ga0070713_100079724
763 Ga0070713_100126421
764 Ga0070713_100183904
765 Ga0070713_100338960
766 Ga0070713_100834149
767 Ga0070710_10000598
768 Ga0070710_10030372
769 Ga0070710_10086096
770 Ga0070711_100000159
771 Ga0070711_100004814
772 Ga0070711_100036059
773 Ga0070711_100219153
774 Ga0070705_100090729
775 Ga0070708_100015426
776 Ga0070708_100022662
777 Ga0070708_100134488
778 Ga0070708_100147272
779 Ga0070708_100182492
780 Ga0070708_100210712
781 Ga0070708_100514080
782 Ga0070663_100001583
783 Ga0070663_100058233
784 Ga0070663_100202162
785 Ga0070678_100014781
786 Ga0070662_100007366
787 Ga0070681_10013120
788 Ga0070681_10023043
789 Ga0070681_10050013
790 Ga0070681_10196413
791 Ga0070681_10708545
792 Ga0070706_100002718
793 Ga0070707_100043153
794 Ga0070707_100217838
795 Ga0070707_100511377
796 Ga0070707_100580287
797 Ga0070698_100169559
798 Ga0070699_100014701
799 Ga0070699_100092300
800 Ga0070699_100255190
801 Ga0070699_100383218
802 Ga0070679_100057638
803 Ga0070679_100107684
804 Ga0070679_100131331
805 Ga0070679_100497605
806 Ga0070684_100100654
807 Ga0070684_100114557
808 Ga0070697_100000326
809 Ga0070697_100011012
810 Ga0070697_100011538
811 Ga0070697_100026945
812 Ga0070697_100145934
813 Ga0070697_100163468
814 Ga0070697_100169918
815 Ga0070697_100263634
816 Ga0068853_100000041
817 Ga0068853_100074178
818 Ga0068853_100128518
819 Ga0068853_100161418
820 Ga0070695_100065390
821 Ga0070695_100122838
822 Ga0070696_100242520
823 Ga0070693_100017058
824 Ga0070665_100002740
825 Ga0070665_100128605
826 Ga0070665_100202526
827 Ga0068855_100001421
828 Ga0068855_100007086
829 Ga0068855_100103090
830 Ga0068855_100182725
831 Ga0068855_100551094
832 Ga0068855_100596962
833 Ga0070664_100028967
834 Ga0068857_100040374
835 Ga0068857_100199467
836 Ga0068854_100000122
837 Ga0068854_100004655
838 Ga0068854_100012486
839 Ga0068856_100001532
840 Ga0068856_100001724
841 Ga0068856_100084818
842 Ga0068856_100275654
843 Ga0068852_100006220
844 Ga0068859_100069216
845 Ga0068859_100661688
846 Ga0068864_100002560
847 Ga0068864_100166538
848 Ga0068866_10007100
849 Ga0068866_10188617
850 Ga0068851_10022899
851 Ga0068851_10162447
852 Ga0068870_10099249
853 Ga0068863_100246309
854 Ga0068863_100312803
855 Ga0068858_100012338
856 Ga0068858_100051663
857 Ga0068860_100014915
858 Ga0068860_100017349
859 Ga0068862_101143201
860 Ga0081455_10187249
861 Ga0070717_10001232
862 Ga0070717_10002444
863 Ga0070717_10020392
864 Ga0070717_10022002
865 Ga0070717_10080035
866 Ga0070717_10091757
867 Ga0070717_10100743
868 Ga0070717_10165414
869 Ga0070717_10188568
870 Ga0070717_10239227
871 Ga0070717_10325563
872 Ga0070717_10583582
873 Ga0070715_10006010
874 Ga0070715_10009792
875 Ga0070715_10033649
876 Ga0070716_100000354
877 Ga0070716_100013004
878 Ga0070716_100020719
879 Ga0070716_100037906
880 Ga0070716_100060291
881 Ga0070716_100069700
882 Ga0070716_100087231
883 Ga0070716_100135372
884 Ga0070716_100273149
885 Ga0070716_100327496
886 Ga0070716_100464490
887 Ga0070712_100006375
888 Ga0070712_100023999
889 Ga0070712_100033247
890 Ga0070712_100034649
891 Ga0070712_100063059
892 Ga0070712_100127114
893 Ga0070712_100135417
894 Ga0070712_100291568
895 Ga0097621_100000034
896 Ga0097621_100019759
897 Ga0097621_100026888
898 Ga0097621_100067291
899 Ga0097621_100420697
900 Ga0068871_100000819
901 Ga0068871_100008170
902 Ga0068871_100145113
903 Ga0068871_100170052
904 Ga0068871_100213398
905 Ga0075430_100190189
906 Ga0075431_100140971
907 Ga0075433_10004547
908 Ga0075433_10008310
909 Ga0075433_10498326
910 Ga0075434_100000235
911 Ga0075434_100004271
912 Ga0075434_100020351
913 Ga0075434_100033552
914 Ga0075434_100232600
915 Ga0075429_100029806
916 Ga0068865_100299098
917 Ga0068865_100531565
918 Ga0075436_100002580
919 Ga0075436_100005980
920 Ga0075436_100008969
921 Ga0075436_100090790
922 Ga0075436_100100340
923 Ga0075436_100163182
924 Ga0097620_100069219
925 Ga0097620_100661662
926 Ga0075435_100003821
927 Ga0075435_100007962
928 Ga0075435_100091169
929 Ga0075435_100185332
930 Ga0075435_100299519
931 Ga0099794_10000033
932 Ga0105240_10004264
933 Ga0105240_10038089
934 Ga0105240_10040354
935 Ga0105240_10042413
936 Ga0105240_10047360
937 Ga0105240_10227221
938 Ga0105240_10377040
939 Ga0105245_10000411
940 Ga0105245_10247513
941 Ga0105245_10273445
942 Ga0114129_10006148
943 Ga0114129_10074350
944 Ga0114129_10098137
945 Ga0114129_10599373
946 Ga0105241_10008117
947 Ga0105241_10039967
948 Ga0105241_10328312
949 Ga0105241_10335533
950 Ga0105242_10076575
951 Ga0105242_10143932
952 Ga0105248_10011027
953 Ga0105248_10044402
954 Ga0105248_10069980
955 Ga0105248_10161420
956 Ga0105248_10399384
957 Ga0105248_10571794
958 Ga0105248_10957926
959 Ga0105237_10014906
960 Ga0105237_10038741
961 Ga0105237_10244648
962 Ga0105237_10340471
963 Ga0105237_10484699
964 Ga0105238_10034553
965 Ga0105238_10036544
966 Ga0105249_10017407
967 Ga0105249_10525858
968 Ga0099796_10045110
969 Ga0105239_10021480
970 Ga0105239_10095242
971 Ga0105239_10204751
972 Ga0105239_10270453
973 Ga0105246_10020182
974 Ga0157373_10007167
975 Ga0157371_10138302
976 Ga0157370_10002484
977 Ga0157370_10581091
978 Ga0157370_10582087
979 Ga0157369_10010669
980 Ga0157369_10119097
981 Ga0157369_10155259
982 Ga0157369_10399861
983 Ga0157374_10000249
984 Ga0157374_10000787
985 Ga0157374_10009849
986 Ga0157374_10128064
987 Ga0157374_10136988
988 Ga0157374_10731504
989 Ga0157378_10000008
990 Ga0157378_10001217
991 Ga0157378_10003381
992 Ga0157378_10011452
993 Ga0157378_10038080
994 Ga0163162_10008783
995 Ga0157372_10000436
996 Ga0157372_10000992
997 Ga0157372_10030521
998 Ga0157372_10141022
999 Ga0157375_10024068
1000 Ga0157375_10117717
1001 Ga0157375_10813244
1002 Ga0163163_10018345
1003 Ga0163163_10064958
1004 Ga0163163_10186746
1005 Ga0163163_10239781
1006 Ga0182008_10021637
1007 Ga0157379_10003566
1008 Ga0157376_10001493
1009 Ga0157376_10002140
1010 Ga0157376_10088787
1011 Ga0182006_1046599
1012 Ga0182007_10028080
1013 Ga0182005_1011524
1014 Ga0213873_10074341
1015 Ga0213872_10001338
1016 Ga0213872_10001709
1017 Ga0213872_10002491
1018 Ga0213872_10031819
1019 Ga0213872_10045545
1020 Ga0213872_10094590
1021 Ga0213872_10104727
1022 Ga0213876_10056935
1023 Ga0213875_10009771
1024 Ga0213875_10080460
1025 Ga0213875_10223533
1026 Ga0213871_10008210
1027 Ga0228598_1001283
1028 Ga0207656_10072300
1029 Ga0207656_10091279
1030 Ga0207692_10003006
1031 Ga0207692_10040499
1032 Ga0207692_10086083
1033 Ga0207692_10106975
1034 Ga0207642_10167351
1035 Ga0207680_10112310
1036 Ga0207647_10006284
1037 Ga0207685_10006465
1038 Ga0207685_10013507
1039 Ga0207685_10020451
1040 Ga0207699_10011334
1041 Ga0207699_10015299
1042 Ga0207699_10089353
1043 Ga0207699_10117445
1044 Ga0207699_10213385
1045 Ga0207699_10471827
1046 Ga0207645_10096239
1047 Ga0207705_10190255
1048 Ga0207684_10000973
1049 Ga0207684_10002906
1050 Ga0207684_10125543
1051 Ga0207654_10008704
1052 Ga0207707_10015200
1053 Ga0207707_10029186
1054 Ga0207707_10086116
1055 Ga0207707_10150117
1056 Ga0207695_10005455
1057 Ga0207695_10009167
1058 Ga0207695_10025939
1059 Ga0207695_10107005
1060 Ga0207671_10096036
1061 Ga0207693_10002464
1062 Ga0207693_10005557
1063 Ga0207693_10007800
1064 Ga0207693_10013939
1065 Ga0207693_10015230
1066 Ga0207693_10032918
1067 Ga0207693_10038900
1068 Ga0207693_10130900
1069 Ga0207693_10434100
1070 Ga0207663_10000965
1071 Ga0207663_10012760
1072 Ga0207663_10066743
1073 Ga0207663_10491865
1074 Ga0207663_10669175
1075 Ga0207660_10267115
1076 Ga0207657_10001667
1077 Ga0207657_10010205
1078 Ga0207649_10065523
1079 Ga0207649_10088524
1080 Ga0207652_10083234
1081 Ga0207652_10123880
1082 Ga0207652_10263798
1083 Ga0207652_10311790
1084 Ga0207646_10006332
1085 Ga0207646_10007050
1086 Ga0207646_10045458
1087 Ga0207646_10105087
1088 Ga0207646_10171569
1089 Ga0207646_10332408
1090 Ga0207681_10303896
1091 Ga0207694_10063306
1092 Ga0207694_10092037
1093 Ga0207650_10672896
1094 Ga0207659_10433059
1095 Ga0207687_10000141
1096 Ga0207700_10006490
1097 Ga0207700_10008629
1098 Ga0207700_10018967
1099 Ga0207700_10028873
1100 Ga0207700_10028932
1101 Ga0207700_10112223
1102 Ga0207700_10185866
1103 Ga0207700_10247750
1104 Ga0207700_10326187
1105 Ga0207700_10468180
1106 Ga0207700_10586354
1107 Ga0207664_10000033
1108 Ga0207664_10050872
1109 Ga0207664_10136687
1110 Ga0207664_10142917
1111 Ga0207664_10159823
1112 Ga0207664_10388694
1113 Ga0207664_10466259
1114 Ga0207664_10646445
1115 Ga0207664_10740070
1116 Ga0207644_10017386
1117 Ga0207644_10127442
1118 Ga0207644_10175159
1119 Ga0207690_10006731
1120 Ga0207690_10118299
1121 Ga0207706_10009258
1122 Ga0207706_10016470
1123 Ga0207686_10624807
1124 Ga0207709_10354244
1125 Ga0207704_10069593
1126 Ga0207704_10109315
1127 Ga0207665_10000596
1128 Ga0207665_10008819
1129 Ga0207665_10014915
1130 Ga0207665_10021588
1131 Ga0207665_10052040
1132 Ga0207665_10084007
1133 Ga0207665_10095860
1134 Ga0207665_10184528
1135 Ga0207665_10315896
1136 Ga0207711_10062942
1137 Ga0207711_10779816
1138 Ga0207689_10095246
1139 Ga0207661_10001952
1140 Ga0207661_10005239
1141 Ga0207661_10147408
1142 Ga0207661_10430664
1143 Ga0207679_10011893
1144 Ga0207679_10191162
1145 Ga0207667_10001192
1146 Ga0207667_10001239
1147 Ga0207667_10187553
1148 Ga0207667_10210046
1149 Ga0207667_10219774
1150 Ga0207667_10262487
1151 Ga0207640_10000057
1152 Ga0207640_10000158
1153 Ga0207640_10004462
1154 Ga0207640_10068667
1155 Ga0207658_10009142
1156 Ga0207677_10068958
1157 Ga0207703_10110369
1158 Ga0207639_10000016
1159 Ga0207639_10225636
1160 Ga0207678_10000903
1161 Ga0207678_10081936
1162 Ga0207678_10221465
1163 Ga0207702_10001513
1164 Ga0207702_10002159
1165 Ga0207702_10016811
1166 Ga0207702_10172398
1167 Ga0207702_10224439
1168 Ga0207702_10306028
1169 Ga0207702_10384566
1170 Ga0207641_10088629
1171 Ga0207641_10176111
1172 Ga0207641_10382407
1173 Ga0207641_11084520
1174 Ga0207648_10005015
1175 Ga0207648_10010627
1176 Ga0207674_10044672
1177 Ga0207674_10047118
1178 Ga0207683_10015510
1179 Ga0207698_10053084
1180 Ga0207698_10517645
1181 Ga0209588_1000006
1182 Ga0209588_1009128
1183 Ga0209588_1010182
1184 Ga0268266_10007114
1185 Ga0268266_10120259
1186 Ga0268265_10918769
1187 Ga0268264_10010932
1188 Ga0265762_1004191
1189 Ga0265762_1016240
1190 Ga0265763_1009638
1191 Ga0265770_1013007
1192 Ga0265760_10004082
1193 Ga0265760_10005650
1194 Ga0265760_10010730
1195 Ga0265760_10015676
1196 Ga0265760_10042346
1197 Ga0265760_10094101
1198 Ga0265760_10132109
1199 Ga0373926_0000619
1200 Ga0373926_0001291
1201 Ga0373926_0017249
1202 Ga0373934_0000830
1203 Ga0373934_0036650
1204 Ga0373944_0043642
1205 Ga0373923_0077297
1206 Ga0373936_0009809
1207 Ga0373953_0004359
1208 Ga0373954_0000402
1209 Ga0373954_0011555
1210 Ga0373954_0163616
1211 Ga0373956_0035799
1212 Ga0373956_0047938
1213 Ga0373957_0055850
1214 Ga0373943_0000093
1215 Ga0373943_0065347
1216 Ga0373943_0078696
1217 Ga0373946_0001175
1218 Ga0373946_0040162
1219 Ga0373946_0218051
1220 Ga0373955_0013271
1221 Ga0373955_0142455
1222 Ga0373942_0034388
1223 Ga0373924_0023109
1224 Ga0373931_0011405
1225 Ga0373935_0000406
1226 Ga0373935_0045385
1227 Ga0373927_0000351
1228 Ga0373927_0005076
1229 Ga0373927_0009237
1230 Ga0373927_0038721
1231 Ga0373927_0057875
1232 Ga0373927_0067963
1233 Ga0373933_0000375
1234 Ga0373933_0010901
1235 Ga0373947_0003946
1236 Ga0373947_0015910
1237 Ga0373947_0022859
1238 Ga0373947_0135446
1239 Ga0373937_0000082
1240 Ga0373937_0003011
1241 Ga0373937_0009898
1242 Ga0373937_0044675
1243 Ga0373937_0078351
1244 Ga0373937_0258866
1245 Ga0373925_0001716
1246 Ga0373925_0007208
1247 Ga0373925_0007869
1248 Ga0373925_0023003
1249 Ga0373925_0517547
1250 Ga0395900_0173907
1251 Ga0395898_0247788
1252 Ga0436364_0042355
1253 Ga0436364_0524449
1254 Ga0436364_0868968
1255 Ga0436364_1479972
1256 Ga0395901_0069456
1257 Ga0395901_0667415
1258 Ga0242420_030418
1259 Ga0436365_0031849
1260 Ga0436365_1035977
1261 Ga0436365_1116478
1262 Ga0436360_0680576
1263 Ga0436360_1228382
1264 Ga0436361_0091471
1265 Ga0436361_0169123
1266 Ga0436361_0400616
1267 Ga0436361_0502041
1268 Ga0436361_0672781
1269 Ga0436361_0705926
1270 Ga0436361_0775789
1271 Ga0436361_0797421
1272 Ga0436361_0875242
1273 Ga0436363_0436454
1274 Ga0436363_0493680
1275 Ga0436363_0875210
1276 Ga0436363_1630748
1277 Ga0436362_0092701
1278 Ga0436362_0405422
1279 Ga0436362_0539068
1280 Ga0451577_0081585
1281 Ga0451577_0330959
1282 Ga0453683_0218324
1283 Ga0466964_0211108
1284 Ga0453684_0062176
1285 Ga0453684_0285831
1286 Ga0453684_0864965
1287 Ga0451576_0112174
1288 Ga0451576_0413200
1289 Ga0451576_0591900
1290 Ga0451576_0631099
1291 Ga0466967_0009451
1292 Ga0466967_0127475
1293 Ga0466967_0715932
1294 Ga0495592_0046432
1295 Ga0495629_0054939
1296 Ga0495651_0239363
1297 Ga0495653_0044063
1298 Ga0495580_0004001
1299 Ga0495580_0006097
1300 Ga0495580_0051162
1301 Ga0495580_0085653
1302 Ga0495582_0010407
1303 Ga0495582_0024529
1304 Ga0495639_0037357
1305 Ga0495664_0064965
1306 Ga0495664_0068823
1307 Ga0495594_0041072
1308 Ga0495608_0015490
1309 Ga0495628_0161288
1310 Ga0495630_0005548
1311 Ga0495630_0046166
1312 Ga0495630_0269710
1313 Ga0495666_0038176
1314 Ga0495666_0102548
1315 Ga0495652_0293184
1316 Ga0495665_0005685
1317 Ga0495665_0010204
1318 Ga0495665_0043956
1319 Ga0495640_0010896
1320 Ga0495586_0055264
1321 Ga0495587_0003381
1322 Ga0495587_0219283
1323 Ga0495645_0081315
1324 Ga0495622_0169289
1325 Ga0495667_0040669
1326 Ga0495635_0042731
1327 Ga0495635_0080644
1328 Ga0495623_0106551
1329 Ga0495623_0256534
1330 Ga0495647_0004251
1331 Ga0495658_0008227
1332 Ga0495613_0068203
1333 Ga0495624_0044011
1334 Ga0495670_0174275
1335 Ga0495604_0000235
1336 Ga0495674_0031040
1337 Ga0495674_0060600
1338 Ga0495674_0092937
1339 Ga0495674_0099208
1340 Ga0495676_0024901
1341 Ga0495676_0138852
1342 Ga0495676_0146067
1343 Ga0495675_0168846
1344 Ga0495684_0023950
1345 Ga0495684_0082815
1346 Ga0495602_0055071
1347 Ga0495614_0026234
1348 Ga0496100_0018636
1349 Ga0496100_0395855
1350 Ga0496100_0599525
1351 Ga0496101_0024720
1352 Ga0496101_0081636
1353 Ga0496101_0120502
1354 Ga0496102_0003254
1355 Ga0496102_0073061
1356 Ga0496103_0027212
1357 Ga0496103_0046043
1358 Ga0496104_0021762
1359 Ga0496105_0040427
1360 Ga0496105_0722410
1361 Ga0496106_0354205
1362 Ga0496108_0169891
1363 Ga0496109_0038109
1364 Ga0496109_0153116
1365 Ga0496111_0051037
1366 Ga0496112_0001829
1367 Ga0496112_0021016
1368 Ga0496112_0096825
1369 Ga0496112_0109408
1370 Ga0496112_0317599
1371 Ga0496115_0042209
1372 Ga0496115_0482676
1373 nmdc:mga05p37_42655_c1
1374 nmdc:mga06r32_214002_c1
1375 nmdc:mga08y16_384683_c1
1376 nmdc:mga0n895_119480_c1
1377 nmdc:mga0n895_129088_c1
1378 nmdc:mga0n895_17170_c1
1379 nmdc:mga0n895_4333_c1
1380 nmdc:mga0n895_449647_c1
1381 nmdc:mga0n895_6406_c1
1382 nmdc:mga0n895_679426_c1
1383 nmdc:mga0n895_696767_c1
1384 nmdc:mga0rr50_140_c1
1385 nmdc:mga0rr50_165242_c1
1386 nmdc:mga0rr50_172327_c1
1387 nmdc:mga0rr50_19118_c1
1388 nmdc:mga0rr50_26280_c1
1389 nmdc:mga0rr50_37308_c1
1390 nmdc:mga0rr50_65554_c1
1391 nmdc:mga0rr50_707053_c1
1392 nmdc:mga0rr50_74004_c1
1393 nmdc:mga08x19_115419_c1
1394 nmdc:mga08x19_11550_c1
1395 nmdc:mga08x19_14044_c1
1396 nmdc:mga08x19_171535_c1
1397 nmdc:mga08x19_177582_c1
1398 nmdc:mga08x19_22938_c1
1399 nmdc:mga08x19_243722_c1
1400 nmdc:mga08x19_43093_c1
1401 nmdc:mga08x19_591227_c1
1402 nmdc:mga08x19_87945_c1
1403 nmdc:mga0a205_40577_c1
1404 nmdc:mga0a205_449_c1

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

4

162

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7961 2 229
4y6n-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 0.7839 2 223
5jqx-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga 0.7827 2 222
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.7798 2 109
3ckq-assembly1.cif.gz_A-2 crystal structure of a mycobacterial protein 0.7784 2 222
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9463 3 215 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9206 3 215 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8541 3 215 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8286 1 222 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8266 5 220 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6J4VWC6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9694 4 223 GO:0016757
AF-A0A2D8SSQ6-F1-model_v4 deleted 0.9689 2 224
AF-A0A2E8H4R4-F1-model_v4 UDP-glucose--dolichyl-phosphate glucosyltransferase 0.9681 2 223 GO:0016757
AF-A0A7W0S4X3-F1-model_v4 Glycosyltransferase family 2 protein 0.9672 2 224 GO:0016757
AF-A0A537YDT4-F1-model_v4 Glycosyltransferase family 2 protein 0.9667 3 219 GO:0016757

Map