F476232

General Info

Members Datasets Scaffolds Average Seq Length
702 593 1404 420

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0026738|Ga0495638_0026738_840_2231
Length 463
Sequence MASRIGQKEAWNPYKLYRLTPEFFCAMTPEQLKAEGDVMPRTLIHAAAIMLAGGISLMAATAHAATDPAAVVKHYAELGHAKYEDALTTAKALDVAIDAFLAAPSEETQKAAKAAWIKARVPYQQTEAYRFGNSIVDDWEGKVNAWPLDEGLIDYVDKAYGTESDENEQYVLNVIANPKFSIGGKEIDATGITPELLESTLQEANETESNVATGYHAIEFLLWGQDLNGTGPGAGTRSYTDYDLKNCTNGNCDRRAAYLKAASSLLVTDLEYMVKQWAPDGEAAKAVTSDPTKGISAMLTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTFNSHLNDAIGIQGVYTGKYTRADGTEMTGPSLSALVAEKDAAVDKELTGKLDTTIAAMQAMAKRGETVEAYDQMIGDGNAEGNKVVQAAIDGLVDQTKSIERAISALNLGKIELEGSDSLDNPAAVGK

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
31 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
32 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
33 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
36 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
37 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
38 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
39 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
40 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
80 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
89 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
139 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
140 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
141 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
142 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
143 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
144 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
145 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
146 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
147 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
148 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
149 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
150 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
151 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
152 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
153 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
154 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
155 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
156 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
157 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
158 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
159 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
160 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
161 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
162 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
163 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
164 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
165 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
166 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
167 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
168 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
169 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
170 2516143018 Ensifer sp. BR816 Isolate Nodule
171 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
172 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
173 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
174 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
175 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
176 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
177 2519899620 Rhizobium sp. Pop5 Isolate Nodule
178 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
179 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
180 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
181 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
182 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
183 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
184 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
185 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
186 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
187 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
188 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
189 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
190 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
191 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
192 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
193 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
194 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
195 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
196 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
197 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
198 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
199 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
200 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
201 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
202 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
203 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
204 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
205 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
206 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
207 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
208 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
209 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
210 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
211 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
212 2643221557 Ensifer sp. Root558 Isolate Unclassified
213 2643221569 Achromobacter sp. Root565 Isolate Unclassified
214 2643221580 Devosia sp. Root635 Isolate Unclassified
215 2643221591 Devosia sp. Root685 Isolate Unclassified
216 2643221594 Achromobacter sp. Root170 Isolate Unclassified
217 2643221599 Rhizobium sp. Root708 Isolate Unclassified
218 2643221607 Rhizobium sp. Root73 Isolate Unclassified
219 2643221610 Ensifer sp. Root74 Isolate Unclassified
220 2643221621 Achromobacter sp. Root83 Isolate Unclassified
221 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
222 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
223 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
224 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
225 2643221668 Ensifer sp. Root423 Isolate Unclassified
226 2643221674 Devosia sp. Root436 Isolate Unclassified
227 2643221675 Ensifer sp. Root1298 Isolate Unclassified
228 2643221680 Ensifer sp. Root1312 Isolate Unclassified
229 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
230 2643221688 Rhizobium sp. Root482 Isolate Unclassified
231 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
232 2643221718 Rhizobium sp. Root268 Isolate Unclassified
233 2643221723 Ensifer sp. Root278 Isolate Unclassified
234 2643221726 Ensifer sp. Root954 Isolate Unclassified
235 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
236 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
237 2718217882 Rhizobium sp. N741 Isolate Nodule
238 2718217927 Rhizobium sp. N324 Isolate Nodule
239 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
240 2718218009 Rhizobium sp. N561 Isolate Nodule
241 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
242 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
243 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
244 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
245 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
246 2718218363 Rhizobium sp. N113 Isolate Nodule
247 2718218365 Rhizobium sp. N731 Isolate Nodule
248 2718218366 Rhizobium sp. N621 Isolate Nodule
249 2718218423 Rhizobium sp. N941 Isolate Nodule
250 2721755514 Rhizobium sp. N6212 Isolate Nodule
251 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
252 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
253 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
254 2721755809 Rhizobium sp. N541 Isolate Nodule
255 2721755810 Rhizobium sp. N871 Isolate Nodule
256 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
257 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
258 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
259 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
260 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
261 2728369365 Rhizobium sp. N1341 Isolate Nodule
262 2728369397 Rhizobium sp. N1314 Isolate Nodule
263 2738541293 Rhizobium sp. GV031 Isolate Unclassified
264 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
265 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
266 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
267 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
268 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
269 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
270 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
271 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
272 2791355256 Rhizobium sp. M10 Isolate Nodule
273 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
274 2791355260 Rhizobium sp. L9 Isolate Nodule
275 2791355261 Rhizobium sp. J15 Isolate Nodule
276 2791355262 Rhizobium sp. M1 Isolate Nodule
277 2791355263 Rhizobium chutanense C5 Isolate Nodule
278 2791355264 Rhizobium sp. S9 Isolate Nodule
279 2791355265 Rhizobium sp. H4 Isolate Nodule
280 2791355266 Rhizobium sp. L43 Isolate Nodule
281 2791355267 Rhizobium sp. L18 Isolate Nodule
282 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
283 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
284 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
285 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
286 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
287 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
288 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
289 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
290 2802429633 Rhizobium anhuiense J3 Isolate Nodule
291 2802429634 Rhizobium anhuiense S10 Isolate Nodule
292 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
293 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
294 2802429637 Rhizobium anhuiense C15 Isolate Nodule
295 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
296 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
297 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
298 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
299 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
300 2838048938 Rhizobium pisi 27/80 Isolate Nodule
301 2838061910 Rhizobium phaseoli L15 Isolate Nodule
302 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
303 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
304 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
305 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
306 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
307 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
308 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
309 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
310 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
311 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
312 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
313 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
314 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
315 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
316 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
317 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
318 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
319 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
320 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
321 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
322 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
323 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
324 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
325 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
326 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
327 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
328 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
329 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
330 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
331 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
332 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
333 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
334 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
335 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
336 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
337 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
338 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
339 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
340 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
341 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
342 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
343 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
344 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
345 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
346 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
347 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
348 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
349 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
350 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
351 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
352 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
353 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
354 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
355 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
356 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
357 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
358 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
359 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
360 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
361 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
362 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
363 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
364 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
365 2858950400 Achromobacter sp. K91 Isolate Unclassified
366 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
367 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
368 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
369 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
370 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
371 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
372 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
373 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
374 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
375 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
376 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
377 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
378 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
379 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
380 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
381 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
382 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
383 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
384 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
385 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
386 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
387 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
388 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
389 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
390 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
391 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
392 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
393 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
394 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
395 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
396 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
397 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
398 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
399 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
400 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
401 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
402 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
403 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
404 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
405 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
406 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
407 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
408 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
409 2932401849 Devosia sp. 2618 Isolate Rhizosphere
410 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
411 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
412 2933599457 Rhizobium phaseoli M3 Isolate Nodule
413 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
414 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
415 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
416 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
417 2936381700 Rhizobium chutanense C16 Isolate Unclassified
418 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
419 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
420 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
421 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
422 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
423 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
424 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
425 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
426 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
427 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
428 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
429 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
430 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
431 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
432 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
433 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
434 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
435 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
436 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
437 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
438 2941479691
439 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
440 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
441 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
442 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
443 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
444 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
445 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
446 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
447 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
448 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
449 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
450 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
451 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
452 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
453 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
454 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
455 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
456 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
457 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
458 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
459 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
460 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
461 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
462 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
463 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
464 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
465 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
466 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
467 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
468 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
469 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
470 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
471 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
472 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
473 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
474 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
475 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
476 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
477 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
478 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
479 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
480 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
481 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
482 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
483 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
484 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
485 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
486 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
487 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
488 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
489 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
490 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
491 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
492 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
493 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
494 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
495 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
496 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
497 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
498 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
499 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
500 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
501 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
502 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
503 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
504 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
505 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
506 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
507 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
508 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
509 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
510 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
511 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
512 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
513 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
514 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
515 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
516 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
517 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
518 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
519 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
520 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
521 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
522 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
523 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
524 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
525 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
526 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
527 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
528 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
529 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
530 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
531 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
532 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
533 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
534 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
535 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
536 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
537 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
538 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
539 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
540 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
541 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
542 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
543 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
544 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
545 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
546 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
547 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
548 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
549 2996887358 Rhizobium sp. R711 Isolate Nodule
550 2996893221 Rhizobium sp. R635 Isolate Nodule
551 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
552 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
553 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
554 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
555 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
556 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
557 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
558 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
559 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
560 8005258706 Rhizobium sp. R693 Isolate Nodule
561 8005275841 Rhizobium sp. N4311 Isolate Nodule
562 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
563 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
564 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
565 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
566 8005321885 Rhizobium sp. R72 Isolate Nodule
567 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
568 8005382845 Rhizobium sp. R634 Isolate Nodule
569 8005395548 Rhizobium sp. R339 Isolate Nodule
570 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
571 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
572 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
573 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
574 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
575 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
576 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
577 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
578 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
579 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
580 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
581 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
582 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
583 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
584 8018176218 Rhizobium sp. N122 Isolate Nodule
585 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
586 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
587 8024501048 Rhizobium sp. H4 Isolate Nodule
588 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
589 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
590 8056382006 Rhizobium croatiense 13T Isolate Nodule
591 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
592 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
593 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.9
Metatranscriptomes 0.14
Isolates 64.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.95
Nodule 54.84
Rhizoplane 1.28
Rhizosphere 13.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0026738 3300046460 Bacteria 3739
2 JGI25152J39213_1001611 3300002773 Bacteria 9437
3 JGI25152J39213_1002582 3300002773 Bacteria 6766
4 JGI25152J39213_1003990 3300002773 Bacteria 4817
5 JGI25150J39212_1000064 3300002774 Bacteria 64002
6 JGI25159J45721_1000015 3300002987 Bacteria 142431
7 JGI25151J46595_10000242 3300003187 Bacteria 64028
8 JGI25151J46595_10000278 3300003187 Bacteria 58449
9 JGI25153J46596_10001280 3300003215 Bacteria 15099
10 JGI25153J46596_10003865 3300003215 Bacteria 8237
11 JGI25153J46596_10017954 3300003215 Bacteria 2766
12 JGI25160J50197_1000003 3300003354 Bacteria 482719
13 JGI25160J50197_1001559 3300003354 Bacteria 11318
14 JGI25161J50226_1000219 3300003374 Bacteria 35426
15 JGI25161J50226_1000229 3300003374 Bacteria 34236
16 Ga0055526_1000858 3300003771 Bacteria 22642
17 Ga0055526_1005467 3300003771 Bacteria 7294
18 Ga0055526_1009373 3300003771 Bacteria 4719
19 Ga0055524_1003177 3300003775 Bacteria 8079
20 Ga0055524_1004718 3300003775 Bacteria 6244
21 Ga0055524_1005580 3300003775 Bacteria 5589
22 Ga0055524_1005604 3300003775 Bacteria 5575
23 Ga0055524_1009805 3300003775 Bacteria 3863
24 Ga0055528_1000454 3300003790 Bacteria 32651
25 Ga0055528_1000622 3300003790 Bacteria 26376
26 Ga0055528_1002653 3300003790 Bacteria 9442
27 Ga0055528_1006382 3300003790 Bacteria 5353
28 Ga0055528_1024480 3300003790 Bacteria 1807
29 Ga0055540_1000797 3300003792 Bacteria 21342
30 Ga0055531_10016836 3300003794 Bacteria 3126
31 Ga0055543_1000034 3300004625 Bacteria 128668
32 Ga0055543_1000105 3300004625 Bacteria 73426
33 Ga0055543_1001402 3300004625 Bacteria 9583
34 Ga0065165_1000025 3300005262 Bacteria 246909
35 Ga0065165_1006563 3300005262 Bacteria 6059
36 Ga0070683_100057641 3300005329 Bacteria 3609
37 Ga0070666_10045013 3300005335 Bacteria 2958
38 Ga0070674_100126581 3300005356 Bacteria 1899
39 Ga0068857_100010337 3300005577 Bacteria 8108
40 Ga0081455_10003244 3300005937 Bacteria 18830
41 Ga0075365_10000983 3300006038 Bacteria 12147
42 Ga0075368_10020337 3300006042 Bacteria 2513
43 Ga0075363_100005718 3300006048 Bacteria 5572
44 Ga0075367_10005124 3300006178 Bacteria 6469
45 Ga0075369_10057344 3300006186 Bacteria 1694
46 Ga0075370_10010819 3300006353 Bacteria 4782
47 Ga0075370_10035491 3300006353 Bacteria 2798
48 Ga0075431_100149348 3300006847 Bacteria 2407
49 Ga0079104_1002193 3300006946 Bacteria 11005
50 Ga0105248_10006903 3300009177 Bacteria 12443
51 Ga0123340_1036039 3300009763 Bacteria 2608
52 Ga0123341_1000024 3300009765 Bacteria 73026
53 Ga0123341_1057399 3300009765 Bacteria 2005
54 Ga0123342_1011229 3300009766 Bacteria 9889
55 Ga0123342_1018459 3300009766 Bacteria 5546
56 Ga0171463_1001 3300013249 Bacteria 1406070
57 Ga0163163_10178111 3300014325 Bacteria 2173
58 Ga0183363_1038 3300015690 Bacteria 43720
59 Ga0214544_1006450 3300021320 Bacteria 21631
60 Ga0214542_1000029 3300021321 Bacteria 174097
61 Ga0214543_1000040 3300021327 Bacteria 174142
62 Ga0228711_1003057 3300022739 Bacteria 25943
63 Ga0228710_1000004 3300022740 Bacteria 250560
64 Ga0209436_100113 3300025208 Bacteria 39873
65 Ga0207425_1000139 3300025245 Bacteria 64086
66 Ga0207425_1000470 3300025245 Bacteria 25566
67 Ga0207425_1016087 3300025245 Bacteria 1666
68 Ga0209148_1000268 3300025254 Bacteria 81728
69 Ga0209129_1000066 3300025258 Bacteria 226820
70 Ga0209129_1000223 3300025258 Bacteria 64086
71 Ga0209129_1001237 3300025258 Bacteria 14652
72 Ga0209129_1001838 3300025258 Bacteria 11245
73 Ga0209129_1002820 3300025258 Bacteria 8065
74 Ga0209129_1003106 3300025258 Bacteria 7469
75 Ga0209129_1003118 3300025258 Bacteria 7456
76 Ga0209455_1000617 3300025272 Bacteria 22458
77 Ga0209673_1000024 3300025273 Bacteria 409632
78 Ga0209673_1000135 3300025273 Bacteria 160333
79 Ga0209673_1000378 3300025273 Bacteria 80351
80 Ga0209673_1000906 3300025273 Bacteria 37927
81 Ga0209673_1000988 3300025273 Bacteria 34774
82 Ga0209673_1005713 3300025273 Bacteria 6201
83 Ga0209130_1000002 3300025284 Bacteria 722648
84 Ga0209130_1000005 3300025284 Bacteria 599620
85 Ga0209676_1006401 3300025292 Bacteria 5822
86 Ga0209676_1014920 3300025292 Bacteria 2889
87 Ga0209025_1000105 3300025294 Bacteria 224157
88 Ga0209025_1000235 3300025294 Bacteria 129981
89 Ga0209025_1000557 3300025294 Bacteria 69226
90 Ga0209025_1000612 3300025294 Bacteria 64088
91 Ga0209025_1000866 3300025294 Bacteria 47843
92 Ga0209025_1013668 3300025294 Bacteria 5076
93 Ga0209025_1016133 3300025294 Bacteria 4441
94 Ga0209025_1024523 3300025294 Bacteria 3107
95 Ga0209025_1036655 3300025294 Bacteria 2191
96 Ga0209025_1043031 3300025294 Bacteria 1910
97 Ga0209564_1000113 3300025295 Bacteria 211564
98 Ga0209564_1000138 3300025295 Bacteria 181512
99 Ga0209564_1000683 3300025295 Bacteria 50090
100 Ga0209564_1001075 3300025295 Bacteria 32804
101 Ga0209758_1000495 3300025297 Bacteria 64088
102 Ga0209758_1000786 3300025297 Bacteria 45428
103 Ga0209758_1001165 3300025297 Bacteria 33420
104 Ga0209758_1001945 3300025297 Bacteria 22393
105 Ga0209758_1003289 3300025297 Bacteria 14977
106 Ga0209758_1004173 3300025297 Bacteria 12285
107 Ga0209758_1035638 3300025297 Bacteria 1957
108 Ga0209050_1003387 3300025298 Bacteria 11833
109 Ga0209050_1007425 3300025298 Bacteria 6149
110 Ga0209050_1024793 3300025298 Bacteria 2061
111 Ga0209256_1000027 3300025299 Bacteria 423283
112 Ga0209256_1000664 3300025299 Bacteria 46510
113 Ga0209256_1001273 3300025299 Bacteria 27393
114 Ga0209256_1001386 3300025299 Bacteria 25312
115 Ga0209256_1002435 3300025299 Bacteria 15208
116 Ga0209256_1009794 3300025299 Bacteria 4130
117 Ga0209256_1016066 3300025299 Bacteria 2575
118 Ga0207426_1000013 3300025302 Bacteria 721897
119 Ga0207426_1000015 3300025302 Bacteria 599316
120 Ga0207426_1000142 3300025302 Bacteria 194023
121 Ga0207426_1017300 3300025302 Bacteria 2565
122 Ga0209051_1000228 3300025303 Bacteria 94166
123 Ga0209051_1001381 3300025303 Bacteria 20949
124 Ga0209051_1010997 3300025303 Bacteria 4512
125 Ga0209051_1019124 3300025303 Bacteria 3001
126 Ga0209257_1002062 3300025304 Bacteria 21252
127 Ga0209257_1002102 3300025304 Bacteria 20853
128 Ga0209257_1013628 3300025304 Bacteria 3589
129 Ga0207680_10146461 3300025903 Bacteria 1570
130 Ga0207705_10169839 3300025909 Bacteria 1642
131 Ga0207657_10125836 3300025919 Bacteria 2105
132 Ga0207694_10067431 3300025924 Bacteria 2793
133 Ga0207644_10107983 3300025931 Bacteria 2100
134 Ga0207690_10278719 3300025932 Bacteria 1301
135 Ga0207691_10159707 3300025940 Bacteria 1978
136 Ga0207711_10029785 3300025941 Bacteria 4605
137 Ga0207661_10218722 3300025944 Bacteria 1683
138 Ga0207674_10007967 3300026116 Bacteria 12293
139 Ga0207698_10217507 3300026142 Bacteria 1724
140 Ga0209281_1000134 3300027111 Bacteria 185406
141 Ga0209281_1000445 3300027111 Bacteria 59209
142 Ga0209282_1000029 3300027666 Bacteria 157883
143 Ga0209813_10013212 3300027866 Bacteria 2200
144 Ga0307515_10000029 3300028794 Bacteria 365410
145 Ga0307515_10002648 3300028794 Bacteria 38377
146 Ga0307515_10005710 3300028794 Bacteria 25131
147 Ga0307515_10022967 3300028794 Bacteria 10967
148 Ga0307513_10003029 3300031456 Bacteria 22905
149 Ga0307405_10012088 3300031731 Bacteria 4554
150 Ga0307406_10004494 3300031901 Bacteria 7594
151 Ga0307412_10000392 3300031911 Bacteria 27005
152 Ga0307412_10003119 3300031911 Bacteria 9206
153 Ga0315914_1000004 3300031967 Bacteria 288534
154 Ga0307409_100151509 3300031995 Bacteria 2014
155 Ga0316593_10001489 3300032168 Bacteria 5177
156 Ga0315913_1000370 3300033430 Bacteria 38384
157 Ga0315915_1000003 3300033464 Bacteria 407996
158 Ga0373935_0119619 3300035692 Bacteria 1758
159 Ga0373927_0000144 3300035695 Bacteria 55726
160 Ga0373937_0006337 3300036401 Bacteria 10203
161 Ga0373925_0000481 3300037068 Bacteria 39959
162 Ga0373925_0142376 3300037068 Bacteria 1878
163 Ga0395905_0002704 3300037471 Bacteria 19430
164 Ga0395905_0004201 3300037471 Bacteria 15073
165 Ga0395905_0203134 3300037471 Bacteria 1857
166 Ga0316581_0007722 3300037588 Bacteria 2899
167 Ga0451843_0714921 3300041509 Bacteria 1618
168 Ga0451855_0902888 3300041511 Bacteria 1839
169 Ga0439432_034009 3300042006 Bacteria 1638
170 Ga0439449_0002720 3300042007 Bacteria 6882
171 Ga0450906_013508 3300042145 Bacteria 1504
172 Ga0495638_0000833 3300046460 Bacteria 32378
173 Ga0495605_0040122 3300046474 Bacteria 2341
174 Ga0495607_0000073 3300046501 Bacteria 100053
175 Ga0495632_0003395 3300046519 Bacteria 11341
176 Ga0495643_0008881 3300046522 Bacteria 6317
177 Ga0495654_0000070 3300046530 Bacteria 117357
178 Ga0495625_0008274 3300046660 Bacteria 8891
179 Ga0495625_0066373 3300046660 Bacteria 2541
180 Ga0495687_055298 3300047443 Bacteria 1660
181 Ga0495626_0049962 3300048091 Bacteria 1934
182 Ga0496106_0001485 3300048909 Bacteria 17625
183 Ga0496110_0116450 3300048913 Bacteria 2406
184 Ga0496111_0000442 3300048914 Bacteria 21049
185 Ga0496111_0030233 3300048914 Bacteria 3852
186 Ga0496116_0050618 3300048919 Bacteria 2766
187 Ga0496117_0004320 3300048920 Bacteria 15810
188 Ga0496117_0030079 3300048920 Bacteria 4174
189 Ga0496118_0042727 3300048921 Bacteria 3572
190 Ga0496119_0013263 3300048922 Bacteria 6587
191 Ga0496121_0001404 3300048924 Bacteria 40784
192 Ga0496121_0024205 3300048924 Bacteria 5816
193 Ga0496121_0041613 3300048924 Bacteria 4013
194 Ga0496121_0134569 3300048924 Bacteria 1843
195 Ga0496122_0000029 3300048925 Bacteria 336396
196 Ga0496122_0000309 3300048925 Bacteria 107844
197 Ga0496122_0054865 3300048925 Bacteria 2988
198 Ga0496122_0055524 3300048925 Bacteria 2962
199 Ga0496123_0000531 3300048926 Bacteria 65624
200 Ga0496123_0002465 3300048926 Bacteria 22901
201 Ga0496123_0009237 3300048926 Bacteria 8911
202 Ga0496123_0047285 3300048926 Bacteria 2909
203 Ga0496123_0050246 3300048926 Bacteria 2787
204 Ga0496124_0000024 3300048927 Bacteria 414291
205 Ga0496124_0003452 3300048927 Bacteria 19323
206 Ga0496124_0003968 3300048927 Bacteria 17643
207 Ga0496124_0020894 3300048927 Bacteria 6040
208 Ga0496124_0072907 3300048927 Bacteria 2842
209 Ga0496124_0134620 3300048927 Bacteria 1958
210 Ga0496125_0000244 3300048928 Bacteria 111663
211 Ga0496125_0000276 3300048928 Bacteria 103024
212 Ga0496125_0005992 3300048928 Bacteria 13304
213 Ga0496125_0008430 3300048928 Bacteria 10791
214 Ga0496126_0002943 3300048929 Bacteria 22129
215 Ga0496126_0037148 3300048929 Bacteria 4548
216 Ga0496126_0051670 3300048929 Bacteria 3740
217 Ga0496126_0118593 3300048929 Bacteria 2297
218 Ga0496126_0135372 3300048929 Bacteria 2126
219 Ga0501031_0110537 3300049568 Bacteria 1794
220 Ga0501032_0060679 3300049569 Bacteria 2536
221 Ga0501032_0160835 3300049569 Bacteria 1475
222 Ga0501034_0001136 3300049571 Bacteria 37035
223 Ga0501034_0052060 3300049571 Bacteria 4126
224 Ga0501034_0056633 3300049571 Bacteria 3943
225 Ga0501036_0223235 3300049572 Bacteria 1582
226 Ga0501037_0030549 3300049573 Bacteria 3981
227 Ga0501038_0081611 3300049574 Bacteria 2724
228 Ga0501039_0183028 3300049575 Bacteria 1648
229 Ga0501040_0030218 3300049576 Bacteria 3660
230 Ga0501043_0092676 3300049579 Bacteria 2375
231 Ga0501048_0120718 3300049582 Bacteria 1852
232 Ga0501071_0078355 3300049587 Bacteria 2415
233 Ga0501074_0062119 3300049590 Bacteria 2691
234 Ga0501075_0064214 3300049591 Bacteria 2769
235 Ga0501076_0143706 3300049592 Bacteria 1939
236 Ga0501081_0178345 3300049743 Bacteria 1536
237 Ga0501083_0031941 3300049744 Bacteria 3611
238 Ga0501044_0094358 3300049823 Bacteria 3017
239 Ga0500618_000096 3300053125 Bacteria 72003
240 Ga0500658_0001404 3300053134 Bacteria 9709
241 Ga0500573_0001956 3300053140 Bacteria 10068
242 Ga0500622_0000323 3300053156 Bacteria 47794
243 Ga0500634_0000002 3300053161 Bacteria 252372
244 Ga0501084_0093167 3300054114 Bacteria 2529
245 Ga0501082_0095206 3300060353 Bacteria 2573
246 Ga0530510_0069767 3300061734 Bacteria 2550
247 2509388884 2509276021 Bacteria 7634384
248 2509444470 2509276033 Bacteria 7180565
249 2510135786 2510065019 Bacteria 6903379
250 2510308153 2510065057 Bacteria 6649661
251 2510897265 2510461076 Bacteria 8618824
252 2511185723 2510917028 Bacteria 6185411
253 2511194079 2510917030 Bacteria 7460662
254 2511498932 2511231052 Bacteria 6974333
255 2512535060 2512047086 Bacteria 6850303
256 2512973115 2512875026 Bacteria 6861065
257 2513570951 2513237084 Bacteria 7231967
258 2513574849 2513237085 Bacteria 7695351
259 2513587200 2513237086 Bacteria 7265287
260 2513595411 2513237088 Bacteria 6927906
261 2513604304 2513237089 Bacteria 6553624
262 2513616210 2513237091 Bacteria 6900273
263 2513634095 2513237093 Bacteria 7545552
264 2513870235 2513237138 Bacteria 7368160
265 2513882637 2513237140 Bacteria 7076289
266 2513904620 2513237143 Bacteria 6664116
267 2513911086 2513237144 Bacteria 7530820
268 2513924397 2513237146 Bacteria 7166346
269 2513983175 2513237156 Bacteria 6402557
270 2513996391 2513237159 Bacteria 6810126
271 2514008182 2513237160 Bacteria 6650282
272 2514022228 2513237162 Bacteria 7468464
273 2515114994 2515075009 Bacteria 7288508
274 2515607350 2515154107 Bacteria 6795637
275 2515633882 2515154113 Bacteria 7807172
276 2515641296 2515154114 Bacteria 7848616
277 2515659698 2515154116 Bacteria 7552979
278 2515741075 2515154134 Bacteria 7220242
279 2516204721 2516143018 Bacteria 6951533
280 2516895208 2516653046 Bacteria 6989037
281 2517038580 2516653077 Bacteria 7555578
282 2517078834 2516653085 Bacteria 7346596
283 2517097586 2517093000 Bacteria 7412387
284 2517409056 2517287029 Bacteria 6905599
285 2517571885 2517487022 Bacteria 7227575
286 2520375838 2519899620 Bacteria 6499161
287 2523104461 2522572158 Bacteria 6514390
288 2524450908 2524023207 Bacteria 6813453
289 2530648242 2529292951 Bacteria 6916614
290 2535514679 2534681796 Bacteria 7146037
291 2551675230 2551306084 Bacteria 8942552
292 2551686977 2551306085 Bacteria 7347181
293 2551696606 2551306086 Bacteria 6843938
294 2551709258 2551306089 Bacteria 7162724
295 2551716500 2551306090 Bacteria 7953713
296 2551726712 2551306091 Bacteria 7086830
297 2551734428 2551306092 Bacteria 6992595
298 2551743136 2551306093 Bacteria 7064773
299 2558866496 2558860100 Bacteria 8458965
300 2585164532 2582581283 Bacteria 6030556
301 2585223369 2582581298 Bacteria 7315509
302 2585232382 2582581299 Bacteria 6518058
303 2585256301 2582581304 Bacteria 5831370
304 2585264841 2582581306 Bacteria 6450535
305 2585386103 2582581865 Bacteria 6644329
306 2585394666 2582581866 Bacteria 6859583
307 2585398979 2582581867 Bacteria 7184437
308 2585523834 2585427526 Bacteria 7258840
309 2585543377 2585427528 Bacteria 6842387
310 2585546035 2585427529 Bacteria 7395659
311 2585818900 2585427590 Bacteria 6824633
312 2585840795 2585427593 Bacteria 7141551
313 2585843817 2585427594 Bacteria 6180594
314 2599332678 2599185156 Bacteria 5403036
315 2599419644 2599185170 Bacteria 7295545
316 2599718882 2599185236 Bacteria 6875203
317 2599906612 2599185292 Bacteria 6290804
318 2600197556 2599185352 Bacteria 7228948
319 2600376667 2600254933 Bacteria 4750527
320 2616293847 2615840624 Bacteria 6557588
321 2643805893 2643221557 Bacteria 7184309
322 2643860819 2643221569 Bacteria 6064337
323 2643910399 2643221580 Bacteria 3816678
324 2643963909 2643221591 Bacteria 4397626
325 2643981341 2643221594 Bacteria 5811388
326 2644004522 2643221599 Bacteria 6292121
327 2644051510 2643221607 Bacteria 6314006
328 2644066069 2643221610 Bacteria 7480339
329 2644124111 2643221621 Bacteria 6212786
330 2644196967 2643221634 Bacteria 6705461
331 2644200007 2643221636 Bacteria 6583769
332 2644207168 2643221637 Bacteria 5345260
333 2644237567 2643221643 Bacteria 5749658
334 2644380374 2643221668 Bacteria 7306521
335 2644411711 2643221674 Bacteria 3919126
336 2644417400 2643221675 Bacteria 7473456
337 2644450796 2643221680 Bacteria 7473610
338 2644480379 2643221686 Bacteria 6310811
339 2644495506 2643221688 Bacteria 5260751
340 2644498884 2643221689 Bacteria 6042950
341 2644650816 2643221718 Bacteria 5345506
342 2644671569 2643221723 Bacteria 7095460
343 2644692780 2643221726 Bacteria 7455827
344 2692317667 2690316117 Bacteria 6800650
345 2715498521 2713897090 Bacteria 3353799
346 2719183451 2718217882 Bacteria 6556348
347 2719388195 2718217927 Bacteria 6972593
348 2719667817 2718217997 Bacteria 6740740
349 2719734168 2718218009 Bacteria 6478651
350 2720494237 2718218199 Bacteria 6740745
351 2720615699 2718218232 Bacteria 6720332
352 2720622484 2718218233 Bacteria 6662049
353 2720633838 2718218235 Bacteria 6630699
354 2720777538 2718218269 Bacteria 6906114
355 2721149563 2718218363 Bacteria 6524337
356 2721160966 2718218365 Bacteria 6274507
357 2721166400 2718218366 Bacteria 6425255
358 2721401830 2718218423 Bacteria 6438183
359 2722842570 2721755514 Bacteria 6424414
360 2723029137 2721755556 Bacteria 6745503
361 2723562751 2721755684 Bacteria 6859907
362 2723569445 2721755685 Bacteria 6704835
363 2724040644 2721755809 Bacteria 6438790
364 2724046924 2721755810 Bacteria 6479005
365 2724092145 2721755819 Bacteria 6906405
366 2724106710 2721755822 Bacteria 6726041
367 2724112519 2721755823 Bacteria 6752556
368 2725947582 2724679232 Bacteria 7646494
369 2730110073 2728369352 Bacteria 6745171
370 2730166686 2728369365 Bacteria 6555560
371 2730300598 2728369397 Bacteria 6274511
372 2738800893 2738541293 Bacteria 7065685
373 2739038215 2738541333 Bacteria 7106503
374 2739612111 2739367655 Bacteria 4051151
375 2753459867 2751185821 Bacteria 6189929
376 2766063273 2765235942 Bacteria 7445910
377 2776916168 2775507049 Bacteria 6284736
378 2792621050 2791355091 Bacteria 6135441
379 2792625265 2791355092 Bacteria 6248105
380 2792637696 2791355094 Bacteria 7011481
381 2793296722 2791355256 Bacteria 6798008
382 2793314106 2791355259 Bacteria 7254731
383 2793322390 2791355260 Bacteria 6598818
384 2793327679 2791355261 Bacteria 6661293
385 2793336709 2791355262 Bacteria 6774204
386 2793341151 2791355263 Bacteria 6872478
387 2793349564 2791355264 Bacteria 6429314
388 2793352586 2791355265 Bacteria 6539969
389 2793358409 2791355266 Bacteria 7116587
390 2793365443 2791355267 Bacteria 7222458
391 2802718682 2802428858 Bacteria 6636079
392 2802724362 2802428859 Bacteria 6667919
393 2802729976 2802428860 Bacteria 6525526
394 2802737319 2802428861 Bacteria 6534206
395 2802742235 2802428862 Bacteria 6633353
396 2802748917 2802428863 Bacteria 6410669
397 2805928254 2802429605 Bacteria 6875453
398 2805936582 2802429606 Bacteria 6346811
399 2806046581 2802429633 Bacteria 7341974
400 2806051331 2802429634 Bacteria 7083200
401 2806059320 2802429635 Bacteria 7650140
402 2806066707 2802429636 Bacteria 7597525
403 2806073764 2802429637 Bacteria 7067217
404 2809035258 2808606395 Bacteria 6020352
405 2838020702 2838016132 Bacteria 6577831
406 2838026329 2838022645 Bacteria 6494267
407 2838039823 2838035591 Bacteria 7166484
408 2838044750 2838042994 Bacteria 6046894
409 2838053205 2838048938 Bacteria 6044578
410 2838064600 2838061910 Bacteria 6794874
411 2838070624 2838068647 Bacteria 6208656
412 2838664105 2838661181 Bacteria 7385261
413 2838674058 2838668709 Bacteria 6671819
414 2838680130 2838680041 Bacteria 6545511
415 2838689734 2838686498 Bacteria 7807632
416 2838695839 2838694306 Bacteria 6853137
417 2838706502 2838701080 Bacteria 6669771
418 2838709214 2838707686 Bacteria 6619912
419 2838731570 2838729681 Bacteria 7400765
420 2838744511 2838742623 Bacteria 7396178
421 2841853051 2841851746 Bacteria 7532261
422 2841869001 2841864319 Bacteria 6742987
423 2842079550 2842077413 Bacteria 6508645
424 2842112632 2842110456 Bacteria 7656360
425 2842120168 2842118031 Bacteria 7033875
426 2842151160 2842146304 Bacteria 5957337
427 2842160378 2842156927 Bacteria 6894975
428 2842165644 2842163707 Bacteria 6916235
429 2842183956 2842180545 Bacteria 6888678
430 2842196263 2842192696 Bacteria 6147454
431 2842202090 2842198810 Bacteria 6608673
432 2842209026 2842205361 Bacteria 6340321
433 2842219300 2842217011 Bacteria 7497767
434 2842231537 2842229732 Bacteria 7475766
435 2842238625 2842237096 Bacteria 6620661
436 2842245993 2842243621 Bacteria 7421798
437 2842256216 2842250916 Bacteria 6579627
438 2842260371 2842257432 Bacteria 7401195
439 2842273782 2842271015 Bacteria 7807131
440 2842282284 2842278818 Bacteria 6340002
441 2842286394 2842285085 Bacteria 6011953
442 2842293211 2842291075 Bacteria 7076806
443 2842308993 2842304105 Bacteria 7023636
444 2842312325 2842311132 Bacteria 6616990
445 2842321921 2842317721 Bacteria 6793725
446 2842344532 2842341865 Bacteria 7003929
447 2842367573 2842363717 Bacteria 6844742
448 2842370592 2842370503 Bacteria 7038661
449 2842379608 2842377471 Bacteria 7140707
450 2842386679 2842384541 Bacteria 7057858
451 2842397734 2842395702 Bacteria 6780583
452 2842404053 2842402390 Bacteria 6681310
453 2842410244 2842409023 Bacteria 6687331
454 2842416892 2842415677 Bacteria 6596907
455 2842424238 2842422224 Bacteria 6239196
456 2842453934 2842447887 Bacteria 6754142
457 2842494210 2842489311 Bacteria 6620893
458 2842499820 2842495871 Bacteria 6820686
459 2842521311 2842521101 Bacteria 6569494
460 2842922953 2842922631 Bacteria 5824079
461 2844456482 2844454524 Bacteria 7952546
462 2847421353 2847417321 Bacteria 6913799
463 2848996138 2848992105 Bacteria 6810864
464 2854900713 2854896431 Bacteria 5869725
465 2854919590 2854916844 Bacteria 5725939
466 2855827846 2855825444 Bacteria 6785811
467 2855843214 2855839649 Bacteria 7135830
468 2855877846 2855872281 Bacteria 6964271
469 2857522077 2857516855 Bacteria 7787325
470 2857542279 2857537821 Bacteria 5248181
471 2857545052 2857542790 Bacteria 5326616
472 2857579400 2857576091 Bacteria 5465855
473 2858802942 2858800743 Bacteria 6603254
474 2858953567 2858950400 Bacteria 6783797
475 2887377817 2887375801 Bacteria 5334027
476 2891375347 2891373044 Bacteria 5202277
477 2913298333 2913295892 Bacteria 6333755
478 2915986606 2915980308 Bacteria 6624279
479 2915993650 2915986958 Bacteria 6739310
480 2915994186 2915993759 Bacteria 7016183
481 2916004912 2916000859 Bacteria 6865702
482 2916008315 2916007675 Bacteria 6898660
483 2916015114 2916014648 Bacteria 6946486
484 2916026191 2916021584 Bacteria 6854472
485 2916035153 2916028427 Bacteria 6748433
486 2916041522 2916035215 Bacteria 6755766
487 2916047416 2916041962 Bacteria 6820487
488 2916054847 2916048683 Bacteria 6543552
489 2916058953 2916055098 Bacteria 6758838
490 2916065878 2916061851 Bacteria 6737736
491 2916069437 2916068649 Bacteria 6943657
492 2916077268 2916076590 Bacteria 6596108
493 2919101751 2919100787 Bacteria 7710546
494 2920822922 2920822456 Bacteria 6897201
495 2921202459 2921201388 Bacteria 6926299
496 2921209216 2921208531 Bacteria 6745326
497 2921237601 2921237296 Bacteria 6876710
498 2921249766 2921244191 Bacteria 6568419
499 2921254863 2921250672 Bacteria 6677771
500 2921263876 2921257292 Bacteria 6808382
501 2921270539 2921263974 Bacteria 6864552
502 2921283111 2921282425 Bacteria 6826397
503 2921289991 2921289301 Bacteria 7316391
504 2921298059 2921296804 Bacteria 7176999
505 2924146136 2924144063 Bacteria 6883928
506 2924158209 2924150972 Bacteria 7169444
507 2924164538 2924158325 Bacteria 7188855
508 2924171371 2924165586 Bacteria 7260590
509 2924179631 2924172951 Bacteria 6749356
510 2924180035 2924179722 Bacteria 6843264
511 2924186801 2924186466 Bacteria 6876637
512 2924200296 2924193448 Bacteria 6955718
513 2924202613 2924200457 Bacteria 6757188
514 2924209442 2924207177 Bacteria 6917007
515 2924217851 2924214083 Bacteria 7080103
516 2924227059 2924221636 Bacteria 7113495
517 2924234741 2924228884 Bacteria 6633132
518 2932402333 2932401849 Bacteria 4262978
519 2933575436 2933570622 Bacteria 7023390
520 2933588479 2933586486 Bacteria 7667493
521 2933601428 2933599457 Bacteria 5858799
522 2935896359 2935894831 Bacteria 6620579
523 2935902431 2935901341 Bacteria 7341747
524 2936369401 2936367885 Bacteria 7324495
525 2936380095 2936375103 Bacteria 6652732
526 2936386210 2936381700 Bacteria 7006523
527 2936998662 2936996657 Bacteria 6298727
528 2937006318 2937002841 Bacteria 6934057
529 2937011676 2937009748 Bacteria 6746052
530 2937018382 2937016420 Bacteria 6782579
531 2937025724 2937023124 Bacteria 6815156
532 2937033623 2937029754 Bacteria 6424026
533 2937040341 2937036028 Bacteria 6846469
534 2937045782 2937042894 Bacteria 6741576
535 2937055993 2937049772 Bacteria 6757901
536 2937057221 2937056579 Bacteria 7107896
537 2937069967 2937063883 Bacteria 7199456
538 2937078315 2937071275 Bacteria 6984483
539 2937082712 2937078374 Bacteria 6610289
540 2937088629 2937084907 Bacteria 6618516
541 2937092579 2937091812 Bacteria 6979387
542 2937106323 2937098957 Bacteria 7249374
543 2937108279 2937106411 Bacteria 6947143
544 2937118688 2937113482 Bacteria 6505872
545 2937121867 2937119839 Bacteria 6597547
546 2937129675 2937126314 Bacteria 6771275
547 2941484670
548 2941501116 2941499720 Bacteria 7599444
549 2957377929 2957375807 Bacteria 6425588
550 2957384327 2957382221 Bacteria 6737050
551 2957393777 2957388812 Bacteria 6778072
552 2957396027 2957395598 Bacteria 6822399
553 2957405600 2957402308 Bacteria 6741770
554 2957413527 2957408893 Bacteria 6558585
555 2957422294 2957415311 Bacteria 6991633
556 2957426268 2957422303 Bacteria 7172205
557 2957434353 2957430029 Bacteria 7022557
558 2957437550 2957437181 Bacteria 6568994
559 2957450140 2957443900 Bacteria 6869977
560 2957452820 2957450854 Bacteria 6765715
561 2957458213 2957457609 Bacteria 6967680
562 2957466309 2957464669 Bacteria 6568877
563 2957474691 2957471148 Bacteria 6797643
564 2957484082 2957478035 Bacteria 6756658
565 2957485225 2957484790 Bacteria 6703082
566 2957493775 2957491536 Bacteria 6695180
567 2957498923 2957498199 Bacteria 7126688
568 2957506027 2957505466 Bacteria 7253085
569 2960584612 2960584000 Bacteria 6864594
570 2960593255 2960591022 Bacteria 6622873
571 2960603188 2960597568 Bacteria 6550735
572 2960609378 2960603979 Bacteria 6898737
573 2960615327 2960610863 Bacteria 6691244
574 2960623259 2960617483 Bacteria 6727748
575 2960624815 2960624210 Bacteria 6875384
576 2960637041 2960631154 Bacteria 6732508
577 2960638867 2960637947 Bacteria 7296468
578 2960650954 2960645483 Bacteria 7211087
579 2960659355 2960652885 Bacteria 7083688
580 2960666929 2960660292 Bacteria 7041660
581 2960670169 2960667422 Bacteria 6763020
582 2960679540 2960674078 Bacteria 6609048
583 2960687288 2960680706 Bacteria 6624464
584 2960693666 2960687367 Bacteria 6535474
585 2960697366 2960693952 Bacteria 6749742
586 2964611566 2964607997 Bacteria 7101408
587 2964621545 2964615318 Bacteria 6809089
588 2964622469 2964621998 Bacteria 6834995
589 2964634259 2964628898 Bacteria 7083044
590 2964641409 2964636051 Bacteria 7091832
591 2964644956 2964643177 Bacteria 6820887
592 2964655935 2964649959 Bacteria 6675118
593 2964657027 2964656573 Bacteria 7100150
594 2964670353 2964663802 Bacteria 7019362
595 2964674809 2964670856 Bacteria 6851364
596 2964684533 2964678106 Bacteria 6792020
597 2964685352 2964685014 Bacteria 6839111
598 2964692394 2964691889 Bacteria 6802758
599 2964705387 2964698721 Bacteria 6765331
600 2964708955 2964705432 Bacteria 7114648
601 2964713037 2964712639 Bacteria 6695970
602 2964720295 2964719344 Bacteria 7286602
603 2967665793 2967664464 Bacteria 6948836
604 2967671958 2967671571 Bacteria 7021409
605 2967679130 2967678726 Bacteria 7264382
606 2967689907 2967686174 Bacteria 6678622
607 2967695277 2967693043 Bacteria 6804451
608 2967703853 2967699805 Bacteria 6854538
609 2967707704 2967706974 Bacteria 7186053
610 2967720672 2967714385 Bacteria 7000047
611 2967728479 2967721400 Bacteria 7073753
612 2967732777 2967728569 Bacteria 6641507
613 2967741124 2967735183 Bacteria 6827012
614 2967742380 2967742019 Bacteria 6794534
615 2967749601 2967748971 Bacteria 6733771
616 2967761959 2967755722 Bacteria 6814706
617 2967768670 2967762386 Bacteria 6923502
618 2967771414 2967769361 Bacteria 6587838
619 2967776569 2967775926 Bacteria 6738189
620 2970020065 2970019648 Bacteria 7072033
621 2970031045 2970026789 Bacteria 6785236
622 2970040198 2970033650 Bacteria 7118744
623 2970046848 2970040964 Bacteria 6731123
624 2970051836 2970047711 Bacteria 7088379
625 2970060412 2970054988 Bacteria 6611507
626 2970062081 2970061556 Bacteria 7099761
627 2970075186 2970068827 Bacteria 7123112
628 2970082286 2970076120 Bacteria 6697332
629 2970087981 2970082768 Bacteria 6183754
630 2970091643 2970088815 Bacteria 6933825
631 2970097099 2970095765 Bacteria 6936963
632 2970108322 2970102677 Bacteria 6812532
633 2970113553 2970109326 Bacteria 6863976
634 2970121984 2970116247 Bacteria 6501857
635 2970128617 2970122695 Bacteria 6625855
636 2970135425 2970129317 Bacteria 6806560
637 2970139727 2970136068 Bacteria 7207982
638 2970149332 2970143518 Bacteria 6446480
639 2970153601 2970149975 Bacteria 6779706
640 2970157894 2970156795 Bacteria 7168044
641 2970169680 2970164137 Bacteria 6861252
642 2970174034 2970170962 Bacteria 6876229
643 2970182461 2970177841 Bacteria 6768001
644 2970186998 2970184632 Bacteria 7054431
645 2970198655 2970191845 Bacteria 7032787
646 2977517448 2977516862 Bacteria 6940108
647 2977530341 2977523885 Bacteria 6960446
648 2977530986 2977530762 Bacteria 6951399
649 2977538620 2977537788 Bacteria 6929320
650 2977548635 2977544691 Bacteria 6875412
651 2977554219 2977551784 Bacteria 7125765
652 2977565316 2977558990 Bacteria 6863948
653 2977569965 2977565890 Bacteria 6901543
654 2977579435 2977572785 Bacteria 6763888
655 2977584018 2977579622 Bacteria 6772100
656 2989351823 2989349275 Bacteria 6349068
657 2989772445 2989771324 Bacteria 5605128
658 2996888081 2996887358 Bacteria 5795980
659 2996897711 2996893221 Bacteria 5823108
660 3003931559 3003930520 Bacteria 5667563
661 3005410724 3005409236 Bacteria 7188837
662 3005450198 3005445848 Bacteria 6906074
663 3005456471 3005452660 Bacteria 5889319
664 639646191 639633055 Bacteria 7751309
665 643827844 643692032 Bacteria 6891900
666 648736669 648276728 Bacteria 6968865
667 8003995796 8003992118 Bacteria 7266902
668 8004003556 8003999396 Bacteria 7063185
669 8005261354 8005258706 Bacteria 6184835
670 8005278401 8005275841 Bacteria 6929066
671 8005285370 8005282627 Bacteria 6675747
672 8005291533 8005289223 Bacteria 6634003
673 8005305586 8005301065 Bacteria 6614431
674 8005310361 8005307578 Bacteria 7395396
675 8005322608 8005321885 Bacteria 5795980
676 8005377910 8005376324 Bacteria 6590079
677 8005385204 8005382845 Bacteria 6732062
678 8005399716 8005395548 Bacteria 6806915
679 8005433284 8005430974 Bacteria 6689030
680 8005465691 8005460587 Bacteria 7157962
681 8005498214 8005497431 Bacteria 6477605
682 8005543347 8005542996 Bacteria 7077758
683 8005560094 8005556819 Bacteria 6908598
684 8005564407 8005563573 Bacteria 7153261
685 8005573968 8005570704 Bacteria 6957481
686 8005619423 8005619151 Bacteria 7030230
687 8005627990 8005626139 Bacteria 6534237
688 8005669623 8005668836 Bacteria 6953162
689 8005692661 8005688590 Bacteria 6610080
690 8005701347 8005695170 Bacteria 6912330
691 8018132669 8018127388 Bacteria 7351159
692 8018167480 8018163183 Bacteria 7277977
693 8018181965 8018176218 Bacteria 6896178
694 8023681162 8023680758 Bacteria 7729763
695 8024479812 8024479707 Bacteria 6954785
696 8024506438 8024501048 Bacteria 6427847
697 8054561116 8054558443 Bacteria 5204801
698 8056381063 8056375014 Bacteria 7006639
699 8056382579 8056382006 Bacteria 6408074
700 8056878753 8056875544 Bacteria 4355797
701 8057134821 8057132660 Bacteria 4061191
702 8057879076 8057874678 Bacteria 7494653
703 Ga0495638_0026738
704 JGI25152J39213_1001611
705 JGI25152J39213_1002582
706 JGI25152J39213_1003990
707 JGI25150J39212_1000064
708 JGI25159J45721_1000015
709 JGI25151J46595_10000242
710 JGI25151J46595_10000278
711 JGI25153J46596_10001280
712 JGI25153J46596_10003865
713 JGI25153J46596_10017954
714 JGI25160J50197_1000003
715 JGI25160J50197_1001559
716 JGI25161J50226_1000219
717 JGI25161J50226_1000229
718 Ga0055526_1000858
719 Ga0055526_1005467
720 Ga0055526_1009373
721 Ga0055524_1003177
722 Ga0055524_1004718
723 Ga0055524_1005580
724 Ga0055524_1005604
725 Ga0055524_1009805
726 Ga0055528_1000454
727 Ga0055528_1000622
728 Ga0055528_1002653
729 Ga0055528_1006382
730 Ga0055528_1024480
731 Ga0055540_1000797
732 Ga0055531_10016836
733 Ga0055543_1000034
734 Ga0055543_1000105
735 Ga0055543_1001402
736 Ga0065165_1000025
737 Ga0065165_1006563
738 Ga0070683_100057641
739 Ga0070666_10045013
740 Ga0070674_100126581
741 Ga0068857_100010337
742 Ga0081455_10003244
743 Ga0075365_10000983
744 Ga0075368_10020337
745 Ga0075363_100005718
746 Ga0075367_10005124
747 Ga0075369_10057344
748 Ga0075370_10010819
749 Ga0075370_10035491
750 Ga0075431_100149348
751 Ga0079104_1002193
752 Ga0105248_10006903
753 Ga0123340_1036039
754 Ga0123341_1000024
755 Ga0123341_1057399
756 Ga0123342_1011229
757 Ga0123342_1018459
758 Ga0171463_1001
759 Ga0163163_10178111
760 Ga0183363_1038
761 Ga0214544_1006450
762 Ga0214542_1000029
763 Ga0214543_1000040
764 Ga0228711_1003057
765 Ga0228710_1000004
766 Ga0209436_100113
767 Ga0207425_1000139
768 Ga0207425_1000470
769 Ga0207425_1016087
770 Ga0209148_1000268
771 Ga0209129_1000066
772 Ga0209129_1000223
773 Ga0209129_1001237
774 Ga0209129_1001838
775 Ga0209129_1002820
776 Ga0209129_1003106
777 Ga0209129_1003118
778 Ga0209455_1000617
779 Ga0209673_1000024
780 Ga0209673_1000135
781 Ga0209673_1000378
782 Ga0209673_1000906
783 Ga0209673_1000988
784 Ga0209673_1005713
785 Ga0209130_1000002
786 Ga0209130_1000005
787 Ga0209676_1006401
788 Ga0209676_1014920
789 Ga0209025_1000105
790 Ga0209025_1000235
791 Ga0209025_1000557
792 Ga0209025_1000612
793 Ga0209025_1000866
794 Ga0209025_1013668
795 Ga0209025_1016133
796 Ga0209025_1024523
797 Ga0209025_1036655
798 Ga0209025_1043031
799 Ga0209564_1000113
800 Ga0209564_1000138
801 Ga0209564_1000683
802 Ga0209564_1001075
803 Ga0209758_1000495
804 Ga0209758_1000786
805 Ga0209758_1001165
806 Ga0209758_1001945
807 Ga0209758_1003289
808 Ga0209758_1004173
809 Ga0209758_1035638
810 Ga0209050_1003387
811 Ga0209050_1007425
812 Ga0209050_1024793
813 Ga0209256_1000027
814 Ga0209256_1000664
815 Ga0209256_1001273
816 Ga0209256_1001386
817 Ga0209256_1002435
818 Ga0209256_1009794
819 Ga0209256_1016066
820 Ga0207426_1000013
821 Ga0207426_1000015
822 Ga0207426_1000142
823 Ga0207426_1017300
824 Ga0209051_1000228
825 Ga0209051_1001381
826 Ga0209051_1010997
827 Ga0209051_1019124
828 Ga0209257_1002062
829 Ga0209257_1002102
830 Ga0209257_1013628
831 Ga0207680_10146461
832 Ga0207705_10169839
833 Ga0207657_10125836
834 Ga0207694_10067431
835 Ga0207644_10107983
836 Ga0207690_10278719
837 Ga0207691_10159707
838 Ga0207711_10029785
839 Ga0207661_10218722
840 Ga0207674_10007967
841 Ga0207698_10217507
842 Ga0209281_1000134
843 Ga0209281_1000445
844 Ga0209282_1000029
845 Ga0209813_10013212
846 Ga0307515_10000029
847 Ga0307515_10002648
848 Ga0307515_10005710
849 Ga0307515_10022967
850 Ga0307513_10003029
851 Ga0307405_10012088
852 Ga0307406_10004494
853 Ga0307412_10000392
854 Ga0307412_10003119
855 Ga0315914_1000004
856 Ga0307409_100151509
857 Ga0316593_10001489
858 Ga0315913_1000370
859 Ga0315915_1000003
860 Ga0373935_0119619
861 Ga0373927_0000144
862 Ga0373937_0006337
863 Ga0373925_0000481
864 Ga0373925_0142376
865 Ga0395905_0002704
866 Ga0395905_0004201
867 Ga0395905_0203134
868 Ga0316581_0007722
869 Ga0451843_0714921
870 Ga0451855_0902888
871 Ga0439432_034009
872 Ga0439449_0002720
873 Ga0450906_013508
874 Ga0495638_0000833
875 Ga0495605_0040122
876 Ga0495607_0000073
877 Ga0495632_0003395
878 Ga0495643_0008881
879 Ga0495654_0000070
880 Ga0495625_0008274
881 Ga0495625_0066373
882 Ga0495687_055298
883 Ga0495626_0049962
884 Ga0496106_0001485
885 Ga0496110_0116450
886 Ga0496111_0000442
887 Ga0496111_0030233
888 Ga0496116_0050618
889 Ga0496117_0004320
890 Ga0496117_0030079
891 Ga0496118_0042727
892 Ga0496119_0013263
893 Ga0496121_0001404
894 Ga0496121_0024205
895 Ga0496121_0041613
896 Ga0496121_0134569
897 Ga0496122_0000029
898 Ga0496122_0000309
899 Ga0496122_0054865
900 Ga0496122_0055524
901 Ga0496123_0000531
902 Ga0496123_0002465
903 Ga0496123_0009237
904 Ga0496123_0047285
905 Ga0496123_0050246
906 Ga0496124_0000024
907 Ga0496124_0003452
908 Ga0496124_0003968
909 Ga0496124_0020894
910 Ga0496124_0072907
911 Ga0496124_0134620
912 Ga0496125_0000244
913 Ga0496125_0000276
914 Ga0496125_0005992
915 Ga0496125_0008430
916 Ga0496126_0002943
917 Ga0496126_0037148
918 Ga0496126_0051670
919 Ga0496126_0118593
920 Ga0496126_0135372
921 Ga0501031_0110537
922 Ga0501032_0060679
923 Ga0501032_0160835
924 Ga0501034_0001136
925 Ga0501034_0052060
926 Ga0501034_0056633
927 Ga0501036_0223235
928 Ga0501037_0030549
929 Ga0501038_0081611
930 Ga0501039_0183028
931 Ga0501040_0030218
932 Ga0501043_0092676
933 Ga0501048_0120718
934 Ga0501071_0078355
935 Ga0501074_0062119
936 Ga0501075_0064214
937 Ga0501076_0143706
938 Ga0501081_0178345
939 Ga0501083_0031941
940 Ga0501044_0094358
941 Ga0500618_000096
942 Ga0500658_0001404
943 Ga0500573_0001956
944 Ga0500622_0000323
945 Ga0500634_0000002
946 Ga0501084_0093167
947 Ga0501082_0095206
948 Ga0530510_0069767
949 2509388884
950 2509444470
951 2510135786
952 2510308153
953 2510897265
954 2511185723
955 2511194079
956 2511498932
957 2512535060
958 2512973115
959 2513570951
960 2513574849
961 2513587200
962 2513595411
963 2513604304
964 2513616210
965 2513634095
966 2513870235
967 2513882637
968 2513904620
969 2513911086
970 2513924397
971 2513983175
972 2513996391
973 2514008182
974 2514022228
975 2515114994
976 2515607350
977 2515633882
978 2515641296
979 2515659698
980 2515741075
981 2516204721
982 2516895208
983 2517038580
984 2517078834
985 2517097586
986 2517409056
987 2517571885
988 2520375838
989 2523104461
990 2524450908
991 2530648242
992 2535514679
993 2551675230
994 2551686977
995 2551696606
996 2551709258
997 2551716500
998 2551726712
999 2551734428
1000 2551743136
1001 2558866496
1002 2585164532
1003 2585223369
1004 2585232382
1005 2585256301
1006 2585264841
1007 2585386103
1008 2585394666
1009 2585398979
1010 2585523834
1011 2585543377
1012 2585546035
1013 2585818900
1014 2585840795
1015 2585843817
1016 2599332678
1017 2599419644
1018 2599718882
1019 2599906612
1020 2600197556
1021 2600376667
1022 2616293847
1023 2643805893
1024 2643860819
1025 2643910399
1026 2643963909
1027 2643981341
1028 2644004522
1029 2644051510
1030 2644066069
1031 2644124111
1032 2644196967
1033 2644200007
1034 2644207168
1035 2644237567
1036 2644380374
1037 2644411711
1038 2644417400
1039 2644450796
1040 2644480379
1041 2644495506
1042 2644498884
1043 2644650816
1044 2644671569
1045 2644692780
1046 2692317667
1047 2715498521
1048 2719183451
1049 2719388195
1050 2719667817
1051 2719734168
1052 2720494237
1053 2720615699
1054 2720622484
1055 2720633838
1056 2720777538
1057 2721149563
1058 2721160966
1059 2721166400
1060 2721401830
1061 2722842570
1062 2723029137
1063 2723562751
1064 2723569445
1065 2724040644
1066 2724046924
1067 2724092145
1068 2724106710
1069 2724112519
1070 2725947582
1071 2730110073
1072 2730166686
1073 2730300598
1074 2738800893
1075 2739038215
1076 2739612111
1077 2753459867
1078 2766063273
1079 2776916168
1080 2792621050
1081 2792625265
1082 2792637696
1083 2793296722
1084 2793314106
1085 2793322390
1086 2793327679
1087 2793336709
1088 2793341151
1089 2793349564
1090 2793352586
1091 2793358409
1092 2793365443
1093 2802718682
1094 2802724362
1095 2802729976
1096 2802737319
1097 2802742235
1098 2802748917
1099 2805928254
1100 2805936582
1101 2806046581
1102 2806051331
1103 2806059320
1104 2806066707
1105 2806073764
1106 2809035258
1107 2838020702
1108 2838026329
1109 2838039823
1110 2838044750
1111 2838053205
1112 2838064600
1113 2838070624
1114 2838664105
1115 2838674058
1116 2838680130
1117 2838689734
1118 2838695839
1119 2838706502
1120 2838709214
1121 2838731570
1122 2838744511
1123 2841853051
1124 2841869001
1125 2842079550
1126 2842112632
1127 2842120168
1128 2842151160
1129 2842160378
1130 2842165644
1131 2842183956
1132 2842196263
1133 2842202090
1134 2842209026
1135 2842219300
1136 2842231537
1137 2842238625
1138 2842245993
1139 2842256216
1140 2842260371
1141 2842273782
1142 2842282284
1143 2842286394
1144 2842293211
1145 2842308993
1146 2842312325
1147 2842321921
1148 2842344532
1149 2842367573
1150 2842370592
1151 2842379608
1152 2842386679
1153 2842397734
1154 2842404053
1155 2842410244
1156 2842416892
1157 2842424238
1158 2842453934
1159 2842494210
1160 2842499820
1161 2842521311
1162 2842922953
1163 2844456482
1164 2847421353
1165 2848996138
1166 2854900713
1167 2854919590
1168 2855827846
1169 2855843214
1170 2855877846
1171 2857522077
1172 2857542279
1173 2857545052
1174 2857579400
1175 2858802942
1176 2858953567
1177 2887377817
1178 2891375347
1179 2913298333
1180 2915986606
1181 2915993650
1182 2915994186
1183 2916004912
1184 2916008315
1185 2916015114
1186 2916026191
1187 2916035153
1188 2916041522
1189 2916047416
1190 2916054847
1191 2916058953
1192 2916065878
1193 2916069437
1194 2916077268
1195 2919101751
1196 2920822922
1197 2921202459
1198 2921209216
1199 2921237601
1200 2921249766
1201 2921254863
1202 2921263876
1203 2921270539
1204 2921283111
1205 2921289991
1206 2921298059
1207 2924146136
1208 2924158209
1209 2924164538
1210 2924171371
1211 2924179631
1212 2924180035
1213 2924186801
1214 2924200296
1215 2924202613
1216 2924209442
1217 2924217851
1218 2924227059
1219 2924234741
1220 2932402333
1221 2933575436
1222 2933588479
1223 2933601428
1224 2935896359
1225 2935902431
1226 2936369401
1227 2936380095
1228 2936386210
1229 2936998662
1230 2937006318
1231 2937011676
1232 2937018382
1233 2937025724
1234 2937033623
1235 2937040341
1236 2937045782
1237 2937055993
1238 2937057221
1239 2937069967
1240 2937078315
1241 2937082712
1242 2937088629
1243 2937092579
1244 2937106323
1245 2937108279
1246 2937118688
1247 2937121867
1248 2937129675
1249 2941484670
1250 2941501116
1251 2957377929
1252 2957384327
1253 2957393777
1254 2957396027
1255 2957405600
1256 2957413527
1257 2957422294
1258 2957426268
1259 2957434353
1260 2957437550
1261 2957450140
1262 2957452820
1263 2957458213
1264 2957466309
1265 2957474691
1266 2957484082
1267 2957485225
1268 2957493775
1269 2957498923
1270 2957506027
1271 2960584612
1272 2960593255
1273 2960603188
1274 2960609378
1275 2960615327
1276 2960623259
1277 2960624815
1278 2960637041
1279 2960638867
1280 2960650954
1281 2960659355
1282 2960666929
1283 2960670169
1284 2960679540
1285 2960687288
1286 2960693666
1287 2960697366
1288 2964611566
1289 2964621545
1290 2964622469
1291 2964634259
1292 2964641409
1293 2964644956
1294 2964655935
1295 2964657027
1296 2964670353
1297 2964674809
1298 2964684533
1299 2964685352
1300 2964692394
1301 2964705387
1302 2964708955
1303 2964713037
1304 2964720295
1305 2967665793
1306 2967671958
1307 2967679130
1308 2967689907
1309 2967695277
1310 2967703853
1311 2967707704
1312 2967720672
1313 2967728479
1314 2967732777
1315 2967741124
1316 2967742380
1317 2967749601
1318 2967761959
1319 2967768670
1320 2967771414
1321 2967776569
1322 2970020065
1323 2970031045
1324 2970040198
1325 2970046848
1326 2970051836
1327 2970060412
1328 2970062081
1329 2970075186
1330 2970082286
1331 2970087981
1332 2970091643
1333 2970097099
1334 2970108322
1335 2970113553
1336 2970121984
1337 2970128617
1338 2970135425
1339 2970139727
1340 2970149332
1341 2970153601
1342 2970157894
1343 2970169680
1344 2970174034
1345 2970182461
1346 2970186998
1347 2970198655
1348 2977517448
1349 2977530341
1350 2977530986
1351 2977538620
1352 2977548635
1353 2977554219
1354 2977565316
1355 2977569965
1356 2977579435
1357 2977584018
1358 2989351823
1359 2989772445
1360 2996888081
1361 2996897711
1362 3003931559
1363 3005410724
1364 3005450198
1365 3005456471
1366 639646191
1367 643827844
1368 648736669
1369 8003995796
1370 8004003556
1371 8005261354
1372 8005278401
1373 8005285370
1374 8005291533
1375 8005305586
1376 8005310361
1377 8005322608
1378 8005377910
1379 8005385204
1380 8005399716
1381 8005433284
1382 8005465691
1383 8005498214
1384 8005543347
1385 8005560094
1386 8005564407
1387 8005573968
1388 8005619423
1389 8005627990
1390 8005669623
1391 8005692661
1392 8005701347
1393 8018132669
1394 8018167480
1395 8018181965
1396 8023681162
1397 8024479812
1398 8024506438
1399 8054561116
1400 8056381063
1401 8056382579
1402 8056878753
1403 8057134821
1404 8057879076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09375

Peptidase_M75

Imelysin

79

435

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrx-assembly1.cif.gz_A insulin-cleaving membrane protease-icmp 0.7703 17 386
7xrx-assembly1.cif.gz_A insulin-cleaving membrane protease-icmp 0.7216 17 386
3ze3-assembly1.cif.gz_E crystal structure of the integral membrane diacylglycerol kinase - delta7 0.662 303 376
3n8u-assembly1.cif.gz_A crystal structure of an imelysin peptidase (bacova_03801) from bacteroides ovatus at 1.44 a resolution 0.6378 213 394
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.622 225 376
ID Description Score Start End Superfamily
3ze3E00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.662 303 376 1.10.287.3610
af_K7KFM6_449_571_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6333 266 371 1.20.58.390
af_I1L4B1_302_450_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6268 225 378 1.20.120.520
4cjzB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6245 300 375 1.10.287.3610
af_A0A1D6NZI8_358_467_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6231 266 369 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A531MP64-F1-model_v4 Peptidase 0.9638 240 396 GO:0030313
AF-A0A531LHJ3-F1-model_v4 Peptidase 0.9627 191 396 GO:0030313
AF-A0A0P9I643-F1-model_v4 deleted 0.9622 232 386
AF-A0A528TLN6-F1-model_v4 Peptidase 0.9615 230 375 GO:0030313
AF-A0A836NVF3-F1-model_v4 deleted 0.9615 248 383

Map