F476239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 403 | 1404 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0120961|Ga0501033_0120961_14_1147 |
| Length | 377 |
| Sequence | VSVLVLDWTTIGCSDPIGTPPTRTVTVERRMVGDMGGNITSCMPETSPDHPRRAAITGVATYVPERVVTNADLARTLDTSDDWIVTRTGIRERRIGAPGETTSTMGAEAVRRLLAAKGLAPGDVDALIVATVTPDMLFPATACLIQDRLGMQNVWGFDLSAACSGFLYALTTGAQFVASGVHRRVIVVGADLKSSIIDPTDRTTAVLFGDGAGAVVLEPAEPGFGILDFFHRVDGSGRGELLMPAGGSLKPPSAETVAARQHFLKQNGRTVFKFAVSQMAESVQRLVERNGLKPADIAVVIPHQANQRILDATAEHLGLPHDRMASVIARYGNTTAATLPLALDDVLCTGRLKRGDLVVFVAVGAGFTMGATLVRWS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 219 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 228 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 240 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 363 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 374 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 376 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 377 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 381 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 382 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 383 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 384 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 385 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 386 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 387 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 388 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 389 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 390 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 391 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 392 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 393 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 394 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 395 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 396 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 397 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 398 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 399 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 400 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 401 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 402 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 403 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.3 |
| Metatranscriptomes | 0.43 |
| Isolates | 3.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.13 |
| Nodule | 0 |
| Rhizoplane | 3.7 |
| Rhizosphere | 86.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501033_0120961 | 3300049570 | Bacteria | 1900 |
| 2 | SwRhRL2b_contig_1653087 | 2162886007 | Bacteria | 2458 |
| 3 | JGI24736J21556_1007625 | 3300001904 | Bacteria | 1816 |
| 4 | JGI25154J39366_1000587 | 3300002738 | Bacteria | 17590 |
| 5 | JGI25158J39367_1006219 | 3300002739 | Bacteria | 1723 |
| 6 | JGI25406J46586_10013591 | 3300003203 | Bacteria | 3489 |
| 7 | JGI25153J46596_10000224 | 3300003215 | Bacteria | 48671 |
| 8 | rootH2_10004419 | 3300003320 | Bacteria | 46013 |
| 9 | rootH2_10241813 | 3300003320 | Bacteria | 3600 |
| 10 | rootL2_10160258 | 3300003322 | Bacteria | 6104 |
| 11 | rootL2_10281962 | 3300003322 | Bacteria | 1774 |
| 12 | rootL2_10289050 | 3300003322 | Bacteria | 3472 |
| 13 | rootH1_10024117 | 3300003323 | Bacteria | 11592 |
| 14 | rootH1_10040132 | 3300003323 | Bacteria | 9743 |
| 15 | Ga0055542_1002717 | 3300003762 | Bacteria | 5413 |
| 16 | Ga0055531_10000132 | 3300003794 | Bacteria | 85251 |
| 17 | Ga0058859_11782272 | 3300004798 | Bacteria | 2819 |
| 18 | Ga0065165_1028129 | 3300005262 | Bacteria | 1820 |
| 19 | Ga0065714_10003722 | 3300005288 | Bacteria | 22816 |
| 20 | Ga0065714_10006151 | 3300005288 | Bacteria | 6883 |
| 21 | Ga0065714_10069901 | 3300005288 | Bacteria | 4043 |
| 22 | Ga0065714_10107029 | 3300005288 | Bacteria | 1539 |
| 23 | Ga0065704_10000425 | 3300005289 | Bacteria | 76756 |
| 24 | Ga0065704_10074258 | 3300005289 | Bacteria | 6413 |
| 25 | Ga0065704_10096285 | 3300005289 | Bacteria | 2449 |
| 26 | Ga0070658_10020104 | 3300005327 | Bacteria | 5348 |
| 27 | Ga0070658_10076261 | 3300005327 | Bacteria | 2750 |
| 28 | Ga0070676_10002188 | 3300005328 | Bacteria | 9965 |
| 29 | Ga0070683_100039163 | 3300005329 | Bacteria | 4350 |
| 30 | Ga0070683_100354695 | 3300005329 | Unclassified | 1397 |
| 31 | Ga0070683_100449933 | 3300005329 | Bacteria | 1229 |
| 32 | Ga0070670_100000292 | 3300005331 | Bacteria | 43960 |
| 33 | Ga0070670_100197294 | 3300005331 | Bacteria | 1749 |
| 34 | Ga0068869_100340433 | 3300005334 | Bacteria | 1220 |
| 35 | Ga0070680_100020355 | 3300005336 | Bacteria | 5267 |
| 36 | Ga0070680_100221815 | 3300005336 | Bacteria | 1596 |
| 37 | Ga0070680_100371885 | 3300005336 | Bacteria | 1216 |
| 38 | Ga0070689_100096183 | 3300005340 | Bacteria | 2340 |
| 39 | Ga0070687_100147145 | 3300005343 | Bacteria | 1378 |
| 40 | Ga0070668_100095027 | 3300005347 | Unclassified | 2354 |
| 41 | Ga0070673_100011603 | 3300005364 | Bacteria | 6019 |
| 42 | Ga0070688_100175590 | 3300005365 | Bacteria | 1482 |
| 43 | Ga0070659_100095172 | 3300005366 | Bacteria | 2392 |
| 44 | Ga0070659_100111135 | 3300005366 | Bacteria | 2212 |
| 45 | Ga0070659_100147183 | 3300005366 | Bacteria | 1919 |
| 46 | Ga0070667_100000415 | 3300005367 | Bacteria | 45632 |
| 47 | Ga0070703_10005421 | 3300005406 | Bacteria | 3565 |
| 48 | Ga0070709_10005139 | 3300005434 | Bacteria | 7080 |
| 49 | Ga0070709_10026716 | 3300005434 | Bacteria | 3424 |
| 50 | Ga0070714_100046381 | 3300005435 | Bacteria | 3687 |
| 51 | Ga0070713_100096679 | 3300005436 | Bacteria | 2550 |
| 52 | Ga0070710_10000342 | 3300005437 | Bacteria | 22161 |
| 53 | Ga0070701_10220886 | 3300005438 | Bacteria | 1130 |
| 54 | Ga0070711_100005710 | 3300005439 | Bacteria | 7460 |
| 55 | Ga0070711_100025090 | 3300005439 | Bacteria | 3896 |
| 56 | Ga0070705_100013439 | 3300005440 | Bacteria | 4189 |
| 57 | Ga0070705_100156190 | 3300005440 | Bacteria | 1519 |
| 58 | Ga0070700_100084526 | 3300005441 | Bacteria | 2057 |
| 59 | Ga0070694_100001094 | 3300005444 | Bacteria | 15532 |
| 60 | Ga0070708_100004098 | 3300005445 | Bacteria | 11443 |
| 61 | Ga0070708_100039982 | 3300005445 | Bacteria | 4106 |
| 62 | Ga0070708_100127425 | 3300005445 | Bacteria | 2354 |
| 63 | Ga0070708_100189257 | 3300005445 | Bacteria | 1925 |
| 64 | Ga0070708_100263674 | 3300005445 | Bacteria | 1620 |
| 65 | Ga0070678_100001564 | 3300005456 | Bacteria | 12252 |
| 66 | Ga0070662_100000043 | 3300005457 | Bacteria | 70660 |
| 67 | Ga0070662_100272345 | 3300005457 | Bacteria | 1367 |
| 68 | Ga0070681_10004632 | 3300005458 | Bacteria | 13127 |
| 69 | Ga0070681_10347638 | 3300005458 | Bacteria | 1393 |
| 70 | Ga0068867_100000970 | 3300005459 | Bacteria | 19578 |
| 71 | Ga0070706_100005569 | 3300005467 | Bacteria | 11989 |
| 72 | Ga0070706_100068254 | 3300005467 | Bacteria | 3288 |
| 73 | Ga0070707_100007438 | 3300005468 | Bacteria | 10170 |
| 74 | Ga0070707_100010931 | 3300005468 | Bacteria | 8453 |
| 75 | Ga0070707_100351689 | 3300005468 | Bacteria | 1431 |
| 76 | Ga0070707_100452337 | 3300005468 | Bacteria | 1245 |
| 77 | Ga0070698_100015876 | 3300005471 | Bacteria | 7951 |
| 78 | Ga0070698_100056214 | 3300005471 | Bacteria | 3989 |
| 79 | Ga0070698_100063498 | 3300005471 | Bacteria | 3724 |
| 80 | Ga0070698_100172939 | 3300005471 | Bacteria | 2100 |
| 81 | Ga0070698_100210880 | 3300005471 | Bacteria | 1877 |
| 82 | Ga0070699_100009581 | 3300005518 | Bacteria | 8392 |
| 83 | Ga0070699_100051477 | 3300005518 | Bacteria | 3565 |
| 84 | Ga0070699_100299399 | 3300005518 | Bacteria | 1443 |
| 85 | Ga0070679_100000575 | 3300005530 | Bacteria | 31162 |
| 86 | Ga0070679_100001256 | 3300005530 | Bacteria | 22367 |
| 87 | Ga0070679_100120140 | 3300005530 | Bacteria | 2613 |
| 88 | Ga0070684_100072257 | 3300005535 | Bacteria | 3037 |
| 89 | Ga0070697_100001294 | 3300005536 | Bacteria | 18842 |
| 90 | Ga0070697_100003459 | 3300005536 | Bacteria | 12139 |
| 91 | Ga0070697_100004739 | 3300005536 | Bacteria | 10421 |
| 92 | Ga0070697_100013284 | 3300005536 | Bacteria | 6460 |
| 93 | Ga0070697_100236227 | 3300005536 | Unclassified | 1560 |
| 94 | Ga0068853_100086942 | 3300005539 | Bacteria | 2742 |
| 95 | Ga0070672_100233351 | 3300005543 | Bacteria | 1546 |
| 96 | Ga0070686_100014764 | 3300005544 | Bacteria | 4507 |
| 97 | Ga0070695_100006098 | 3300005545 | Bacteria | 7123 |
| 98 | Ga0070695_100064043 | 3300005545 | Bacteria | 2391 |
| 99 | Ga0070696_100000740 | 3300005546 | Bacteria | 20843 |
| 100 | Ga0070696_100050526 | 3300005546 | Bacteria | 2890 |
| 101 | Ga0070696_100098818 | 3300005546 | Bacteria | 2088 |
| 102 | Ga0070693_100001006 | 3300005547 | Bacteria | 12576 |
| 103 | Ga0070693_100018101 | 3300005547 | Bacteria | 3675 |
| 104 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 105 | Ga0070665_100043298 | 3300005548 | Bacteria | 4524 |
| 106 | Ga0070704_100006564 | 3300005549 | Bacteria | 6861 |
| 107 | Ga0070704_100178865 | 3300005549 | Bacteria | 1695 |
| 108 | Ga0068855_100067792 | 3300005563 | Bacteria | 4155 |
| 109 | Ga0068855_100092300 | 3300005563 | Bacteria | 3492 |
| 110 | Ga0068855_100352685 | 3300005563 | Bacteria | 1620 |
| 111 | Ga0070664_100173869 | 3300005564 | Bacteria | 1911 |
| 112 | Ga0068857_100032705 | 3300005577 | Bacteria | 4598 |
| 113 | Ga0068856_100093074 | 3300005614 | Unclassified | 3000 |
| 114 | Ga0068852_100004240 | 3300005616 | Bacteria | 10126 |
| 115 | Ga0068852_100121571 | 3300005616 | Bacteria | 2392 |
| 116 | Ga0068859_100064410 | 3300005617 | Bacteria | 3698 |
| 117 | Ga0068859_100101848 | 3300005617 | Bacteria | 2929 |
| 118 | Ga0068859_100155823 | 3300005617 | Bacteria | 2361 |
| 119 | Ga0068864_100000300 | 3300005618 | Bacteria | 43960 |
| 120 | Ga0068864_100045885 | 3300005618 | Bacteria | 3749 |
| 121 | Ga0068864_100166504 | 3300005618 | Bacteria | 2007 |
| 122 | Ga0068861_100014168 | 3300005719 | Bacteria | 5592 |
| 123 | Ga0068863_100000073 | 3300005841 | Bacteria | 110576 |
| 124 | Ga0068863_100087106 | 3300005841 | Bacteria | 2959 |
| 125 | Ga0068858_100354133 | 3300005842 | Bacteria | 1406 |
| 126 | Ga0068858_100571358 | 3300005842 | Bacteria | 1095 |
| 127 | Ga0068860_100002227 | 3300005843 | Bacteria | 20410 |
| 128 | Ga0068860_100034591 | 3300005843 | Bacteria | 4848 |
| 129 | Ga0068862_100000431 | 3300005844 | Bacteria | 45517 |
| 130 | Ga0081455_10089200 | 3300005937 | Bacteria | 2503 |
| 131 | Ga0081539_10000597 | 3300005985 | Bacteria | 73805 |
| 132 | Ga0081539_10028543 | 3300005985 | Unclassified | 3506 |
| 133 | Ga0070717_10143433 | 3300006028 | Bacteria | 2061 |
| 134 | Ga0075363_100048553 | 3300006048 | Bacteria | 2257 |
| 135 | Ga0070716_100001859 | 3300006173 | Bacteria | 9569 |
| 136 | Ga0070716_100004211 | 3300006173 | Bacteria | 6846 |
| 137 | Ga0070716_100040475 | 3300006173 | Unclassified | 2593 |
| 138 | Ga0070716_100052372 | 3300006173 | Bacteria | 2323 |
| 139 | Ga0070712_100029338 | 3300006175 | Bacteria | 3687 |
| 140 | Ga0097621_100000099 | 3300006237 | Bacteria | 48404 |
| 141 | Ga0068871_100000290 | 3300006358 | Bacteria | 35074 |
| 142 | Ga0075428_100148069 | 3300006844 | Bacteria | 2551 |
| 143 | Ga0075430_100198118 | 3300006846 | Bacteria | 1668 |
| 144 | Ga0075431_100018982 | 3300006847 | Bacteria | 7005 |
| 145 | Ga0075433_10127260 | 3300006852 | Bacteria | 2262 |
| 146 | Ga0075433_10156906 | 3300006852 | Bacteria | 2025 |
| 147 | Ga0075434_100113670 | 3300006871 | Bacteria | 2719 |
| 148 | Ga0075434_100151391 | 3300006871 | Bacteria | 2340 |
| 149 | Ga0075436_100095937 | 3300006914 | Bacteria | 2063 |
| 150 | Ga0097620_100064412 | 3300006931 | Bacteria | 3698 |
| 151 | Ga0097620_100101847 | 3300006931 | Bacteria | 2929 |
| 152 | Ga0097620_100155833 | 3300006931 | Bacteria | 2361 |
| 153 | Ga0099794_10001609 | 3300007265 | Bacteria | 7963 |
| 154 | Ga0099794_10002978 | 3300007265 | Bacteria | 6388 |
| 155 | Ga0099794_10016218 | 3300007265 | Bacteria | 3300 |
| 156 | Ga0099794_10110523 | 3300007265 | Bacteria | 1377 |
| 157 | Ga0105251_10000296 | 3300009011 | Bacteria | 49888 |
| 158 | Ga0105240_10004537 | 3300009093 | Bacteria | 21094 |
| 159 | Ga0105240_10083212 | 3300009093 | Bacteria | 3928 |
| 160 | Ga0105240_10115941 | 3300009093 | Bacteria | 3233 |
| 161 | Ga0105240_10143457 | 3300009093 | Unclassified | 2853 |
| 162 | Ga0105240_10150951 | 3300009093 | Bacteria | 2767 |
| 163 | Ga0105245_10002109 | 3300009098 | Bacteria | 17996 |
| 164 | Ga0105247_10012063 | 3300009101 | Bacteria | 5191 |
| 165 | Ga0114129_10515386 | 3300009147 | Bacteria | 1560 |
| 166 | Ga0105241_10005263 | 3300009174 | Bacteria | 9556 |
| 167 | Ga0105241_10015656 | 3300009174 | Bacteria | 5558 |
| 168 | Ga0105241_10110294 | 3300009174 | Bacteria | 2201 |
| 169 | Ga0105241_10125282 | 3300009174 | Bacteria | 2074 |
| 170 | Ga0105241_10710227 | 3300009174 | Bacteria | 918 |
| 171 | Ga0105242_10029962 | 3300009176 | Bacteria | 4343 |
| 172 | Ga0105248_10000029 | 3300009177 | Bacteria | 223366 |
| 173 | Ga0105248_10005459 | 3300009177 | Bacteria | 13973 |
| 174 | Ga0105248_10028360 | 3300009177 | Bacteria | 6237 |
| 175 | Ga0105248_10152135 | 3300009177 | Bacteria | 2611 |
| 176 | Ga0105237_10000805 | 3300009545 | Bacteria | 42788 |
| 177 | Ga0105237_10001937 | 3300009545 | Bacteria | 26385 |
| 178 | Ga0105237_10065636 | 3300009545 | Bacteria | 3625 |
| 179 | Ga0105238_10020964 | 3300009551 | Bacteria | 6658 |
| 180 | Ga0105238_10047639 | 3300009551 | Bacteria | 4321 |
| 181 | Ga0105249_10300880 | 3300009553 | Unclassified | 1609 |
| 182 | Ga0099796_10014533 | 3300010159 | Bacteria | 2277 |
| 183 | Ga0099796_10019493 | 3300010159 | Bacteria | 2057 |
| 184 | Ga0105239_10000095 | 3300010375 | Bacteria | 124330 |
| 185 | Ga0105239_10092634 | 3300010375 | Bacteria | 3336 |
| 186 | Ga0105239_10240584 | 3300010375 | Bacteria | 2031 |
| 187 | Ga0105239_10571685 | 3300010375 | Bacteria | 1288 |
| 188 | Ga0105246_10083985 | 3300011119 | Bacteria | 2277 |
| 189 | Ga0157373_10000034 | 3300013100 | Bacteria | 124053 |
| 190 | Ga0157373_10002835 | 3300013100 | Bacteria | 13111 |
| 191 | Ga0157373_10006316 | 3300013100 | Bacteria | 8850 |
| 192 | Ga0157373_10028380 | 3300013100 | Bacteria | 4036 |
| 193 | Ga0157373_10294336 | 3300013100 | Bacteria | 1151 |
| 194 | Ga0157371_10001448 | 3300013102 | Bacteria | 24636 |
| 195 | Ga0157371_10003042 | 3300013102 | Bacteria | 15561 |
| 196 | Ga0157371_10003741 | 3300013102 | Bacteria | 13618 |
| 197 | Ga0157371_10015852 | 3300013102 | Bacteria | 5638 |
| 198 | Ga0157371_10050713 | 3300013102 | Bacteria | 2949 |
| 199 | Ga0157371_10054552 | 3300013102 | Bacteria | 2838 |
| 200 | Ga0157370_10000083 | 3300013104 | Bacteria | 104313 |
| 201 | Ga0157370_10003843 | 3300013104 | Bacteria | 17514 |
| 202 | Ga0157370_10025903 | 3300013104 | Bacteria | 5799 |
| 203 | Ga0157370_10044375 | 3300013104 | Bacteria | 4273 |
| 204 | Ga0157370_10128696 | 3300013104 | Bacteria | 2362 |
| 205 | Ga0157369_10092689 | 3300013105 | Unclassified | 3225 |
| 206 | Ga0157369_10093339 | 3300013105 | Bacteria | 3213 |
| 207 | Ga0157369_10102491 | 3300013105 | Bacteria | 3050 |
| 208 | Ga0157369_10142776 | 3300013105 | Bacteria | 2532 |
| 209 | Ga0157369_10388570 | 3300013105 | Unclassified | 1448 |
| 210 | Ga0157374_10001159 | 3300013296 | Bacteria | 22456 |
| 211 | Ga0157374_10001894 | 3300013296 | Bacteria | 17545 |
| 212 | Ga0157374_10009460 | 3300013296 | Bacteria | 8367 |
| 213 | Ga0157378_10000560 | 3300013297 | Bacteria | 35416 |
| 214 | Ga0157378_10001056 | 3300013297 | Bacteria | 25231 |
| 215 | Ga0163162_10000051 | 3300013306 | Bacteria | 117695 |
| 216 | Ga0163162_10017425 | 3300013306 | Bacteria | 7027 |
| 217 | Ga0163162_10214228 | 3300013306 | Bacteria | 2056 |
| 218 | Ga0157372_10002554 | 3300013307 | Bacteria | 19731 |
| 219 | Ga0157372_10003988 | 3300013307 | Bacteria | 15845 |
| 220 | Ga0157372_10004195 | 3300013307 | Bacteria | 15425 |
| 221 | Ga0157372_10033289 | 3300013307 | Bacteria | 5659 |
| 222 | Ga0157372_10210633 | 3300013307 | Bacteria | 2252 |
| 223 | Ga0157375_10195387 | 3300013308 | Bacteria | 2178 |
| 224 | Ga0157375_10297419 | 3300013308 | Bacteria | 1777 |
| 225 | Ga0157380_10046279 | 3300014326 | Bacteria | 3416 |
| 226 | Ga0182008_10000022 | 3300014497 | Bacteria | 207052 |
| 227 | Ga0182008_10000104 | 3300014497 | Bacteria | 65446 |
| 228 | Ga0157377_10101298 | 3300014745 | Bacteria | 1716 |
| 229 | Ga0157379_10070427 | 3300014968 | Bacteria | 3129 |
| 230 | Ga0157379_10082915 | 3300014968 | Bacteria | 2873 |
| 231 | Ga0157379_10383703 | 3300014968 | Bacteria | 1289 |
| 232 | Ga0157376_10016366 | 3300014969 | Bacteria | 5628 |
| 233 | Ga0182006_1000279 | 3300015261 | Bacteria | 45379 |
| 234 | Ga0182006_1010075 | 3300015261 | Bacteria | 4212 |
| 235 | Ga0182007_10011886 | 3300015262 | Bacteria | 3369 |
| 236 | Ga0182005_1000209 | 3300015265 | Bacteria | 38801 |
| 237 | Ga0163161_10000828 | 3300017792 | Bacteria | 24173 |
| 238 | Ga0213876_10000909 | 3300021384 | Bacteria | 19677 |
| 239 | Ga0213875_10004925 | 3300021388 | Bacteria | 7251 |
| 240 | Ga0209436_104141 | 3300025208 | Bacteria | 3645 |
| 241 | Ga0209436_108603 | 3300025208 | Bacteria | 2017 |
| 242 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 243 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 244 | Ga0209026_1000198 | 3300025250 | Bacteria | 83656 |
| 245 | Ga0209026_1000199 | 3300025250 | Bacteria | 83231 |
| 246 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 247 | Ga0209129_1007780 | 3300025258 | Bacteria | 3107 |
| 248 | Ga0209758_1000742 | 3300025297 | Bacteria | 47450 |
| 249 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 250 | Ga0207426_1000888 | 3300025302 | Bacteria | 30602 |
| 251 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 252 | Ga0207713_1002770 | 3300025735 | Bacteria | 12405 |
| 253 | Ga0207653_10005977 | 3300025885 | Bacteria | 3797 |
| 254 | Ga0207692_10000633 | 3300025898 | Bacteria | 12350 |
| 255 | Ga0207710_10006368 | 3300025900 | Bacteria | 5044 |
| 256 | Ga0207647_10000036 | 3300025904 | Bacteria | 98204 |
| 257 | Ga0207647_10008554 | 3300025904 | Bacteria | 7328 |
| 258 | Ga0207699_10006337 | 3300025906 | Bacteria | 5721 |
| 259 | Ga0207699_10019145 | 3300025906 | Bacteria | 3643 |
| 260 | Ga0207699_10020705 | 3300025906 | Bacteria | 3531 |
| 261 | Ga0207699_10244510 | 3300025906 | Bacteria | 1234 |
| 262 | Ga0207645_10000312 | 3300025907 | Bacteria | 40968 |
| 263 | Ga0207705_10016332 | 3300025909 | Bacteria | 5323 |
| 264 | Ga0207705_10044980 | 3300025909 | Unclassified | 3173 |
| 265 | Ga0207684_10011618 | 3300025910 | Bacteria | 7693 |
| 266 | Ga0207684_10031677 | 3300025910 | Bacteria | 4498 |
| 267 | Ga0207684_10073185 | 3300025910 | Bacteria | 2910 |
| 268 | Ga0207654_10009434 | 3300025911 | Bacteria | 4957 |
| 269 | Ga0207654_10011141 | 3300025911 | Bacteria | 4577 |
| 270 | Ga0207707_10176083 | 3300025912 | Bacteria | 1869 |
| 271 | Ga0207695_10001548 | 3300025913 | Bacteria | 37825 |
| 272 | Ga0207695_10013446 | 3300025913 | Bacteria | 9762 |
| 273 | Ga0207695_10046307 | 3300025913 | Bacteria | 4611 |
| 274 | Ga0207695_10098003 | 3300025913 | Unclassified | 2931 |
| 275 | Ga0207671_10002974 | 3300025914 | Bacteria | 17406 |
| 276 | Ga0207671_10005112 | 3300025914 | Bacteria | 12229 |
| 277 | Ga0207671_10007229 | 3300025914 | Bacteria | 9667 |
| 278 | Ga0207693_10137464 | 3300025915 | Bacteria | 1921 |
| 279 | Ga0207693_10267033 | 3300025915 | Bacteria | 1341 |
| 280 | Ga0207663_10012107 | 3300025916 | Bacteria | 4653 |
| 281 | Ga0207663_10030522 | 3300025916 | Bacteria | 3180 |
| 282 | Ga0207660_10051504 | 3300025917 | Bacteria | 2927 |
| 283 | Ga0207660_10146516 | 3300025917 | Bacteria | 1810 |
| 284 | Ga0207657_10092205 | 3300025919 | Unclassified | 2525 |
| 285 | Ga0207657_10192169 | 3300025919 | Bacteria | 1646 |
| 286 | Ga0207652_10000051 | 3300025921 | Bacteria | 120327 |
| 287 | Ga0207652_10000791 | 3300025921 | Bacteria | 30182 |
| 288 | Ga0207652_10011674 | 3300025921 | Bacteria | 7088 |
| 289 | Ga0207646_10000481 | 3300025922 | Bacteria | 53432 |
| 290 | Ga0207646_10000572 | 3300025922 | Bacteria | 48197 |
| 291 | Ga0207646_10373084 | 3300025922 | Bacteria | 1289 |
| 292 | Ga0207681_10424609 | 3300025923 | Bacteria | 1078 |
| 293 | Ga0207694_10096180 | 3300025924 | Bacteria | 2342 |
| 294 | Ga0207687_10349342 | 3300025927 | Unclassified | 1204 |
| 295 | Ga0207700_10069255 | 3300025928 | Bacteria | 2707 |
| 296 | Ga0207700_10099169 | 3300025928 | Bacteria | 2319 |
| 297 | Ga0207664_10046416 | 3300025929 | Bacteria | 3409 |
| 298 | Ga0207664_10380495 | 3300025929 | Bacteria | 1253 |
| 299 | Ga0207690_10060358 | 3300025932 | Bacteria | 2573 |
| 300 | Ga0207690_10113976 | 3300025932 | Bacteria | 1952 |
| 301 | Ga0207706_10000125 | 3300025933 | Bacteria | 83075 |
| 302 | Ga0207706_10236649 | 3300025933 | Bacteria | 1596 |
| 303 | Ga0207686_10111386 | 3300025934 | Bacteria | 1847 |
| 304 | Ga0207670_10072705 | 3300025936 | Bacteria | 2382 |
| 305 | Ga0207704_10000335 | 3300025938 | Bacteria | 21770 |
| 306 | Ga0207665_10000023 | 3300025939 | Bacteria | 104745 |
| 307 | Ga0207665_10003362 | 3300025939 | Bacteria | 10709 |
| 308 | Ga0207665_10032079 | 3300025939 | Bacteria | 3478 |
| 309 | Ga0207665_10052077 | 3300025939 | Bacteria | 2757 |
| 310 | Ga0207665_10062870 | 3300025939 | Unclassified | 2520 |
| 311 | Ga0207665_10408651 | 3300025939 | Bacteria | 1035 |
| 312 | Ga0207691_10151605 | 3300025940 | Bacteria | 2038 |
| 313 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 314 | Ga0207711_10048440 | 3300025941 | Bacteria | 3636 |
| 315 | Ga0207689_10213628 | 3300025942 | Bacteria | 1594 |
| 316 | Ga0207661_10027845 | 3300025944 | Bacteria | 4322 |
| 317 | Ga0207667_10002789 | 3300025949 | Bacteria | 21642 |
| 318 | Ga0207667_10021474 | 3300025949 | Bacteria | 7153 |
| 319 | Ga0207667_10070847 | 3300025949 | Bacteria | 3628 |
| 320 | Ga0207651_10002492 | 3300025960 | Bacteria | 8783 |
| 321 | Ga0207712_10187994 | 3300025961 | Bacteria | 1628 |
| 322 | Ga0207658_10001129 | 3300025986 | Bacteria | 21497 |
| 323 | Ga0207703_10387617 | 3300026035 | Bacteria | 1294 |
| 324 | Ga0207639_10067588 | 3300026041 | Bacteria | 2781 |
| 325 | Ga0207678_10156920 | 3300026067 | Bacteria | 1943 |
| 326 | Ga0207708_10032968 | 3300026075 | Bacteria | 3933 |
| 327 | Ga0207702_10005819 | 3300026078 | Bacteria | 10723 |
| 328 | Ga0207702_10065757 | 3300026078 | Unclassified | 3106 |
| 329 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 330 | Ga0207641_10500897 | 3300026088 | Bacteria | 1179 |
| 331 | Ga0207648_10000961 | 3300026089 | Bacteria | 32589 |
| 332 | Ga0207648_10184925 | 3300026089 | Bacteria | 1845 |
| 333 | Ga0207648_10258703 | 3300026089 | Bacteria | 1553 |
| 334 | Ga0207676_10000276 | 3300026095 | Bacteria | 44706 |
| 335 | Ga0207676_10033700 | 3300026095 | Bacteria | 3872 |
| 336 | Ga0207676_10562444 | 3300026095 | Bacteria | 1091 |
| 337 | Ga0207674_10084633 | 3300026116 | Bacteria | 3169 |
| 338 | Ga0207675_100011052 | 3300026118 | Bacteria | 8456 |
| 339 | Ga0207683_10010707 | 3300026121 | Bacteria | 7818 |
| 340 | Ga0207683_10239986 | 3300026121 | Bacteria | 1653 |
| 341 | Ga0207698_10003948 | 3300026142 | Bacteria | 8985 |
| 342 | Ga0209588_1002151 | 3300027671 | Bacteria | 5318 |
| 343 | Ga0209588_1002685 | 3300027671 | Bacteria | 4854 |
| 344 | Ga0209588_1003067 | 3300027671 | Bacteria | 4605 |
| 345 | Ga0209588_1016128 | 3300027671 | Bacteria | 2303 |
| 346 | Ga0265354_1000026 | 3300028016 | Bacteria | 23406 |
| 347 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 348 | Ga0268266_10012805 | 3300028379 | Bacteria | 7245 |
| 349 | Ga0268266_10213270 | 3300028379 | Bacteria | 1771 |
| 350 | Ga0268265_10000097 | 3300028380 | Bacteria | 110755 |
| 351 | Ga0268264_10444098 | 3300028381 | Bacteria | 1255 |
| 352 | Ga0265318_10004764 | 3300028577 | Bacteria | 6503 |
| 353 | Ga0265770_1001077 | 3300030878 | Bacteria | 3774 |
| 354 | Ga0265765_1000099 | 3300030879 | Bacteria | 4890 |
| 355 | Ga0265332_10044009 | 3300031238 | Bacteria | 1926 |
| 356 | Ga0265320_10049766 | 3300031240 | Bacteria | 2039 |
| 357 | Ga0265325_10031694 | 3300031241 | Bacteria | 2826 |
| 358 | Ga0265325_10050234 | 3300031241 | Bacteria | 2149 |
| 359 | Ga0265329_10000084 | 3300031242 | Bacteria | 43535 |
| 360 | Ga0265339_10044764 | 3300031249 | Bacteria | 2439 |
| 361 | Ga0265331_10000047 | 3300031250 | Bacteria | 183230 |
| 362 | Ga0265331_10061485 | 3300031250 | Bacteria | 1773 |
| 363 | Ga0265327_10006221 | 3300031251 | Bacteria | 9623 |
| 364 | Ga0265316_10215532 | 3300031344 | Bacteria | 1418 |
| 365 | Ga0307408_100013148 | 3300031548 | Bacteria | 5493 |
| 366 | Ga0307408_100045499 | 3300031548 | Bacteria | 3135 |
| 367 | Ga0307408_100099563 | 3300031548 | Bacteria | 2212 |
| 368 | Ga0307408_100329279 | 3300031548 | Bacteria | 1289 |
| 369 | Ga0265313_10007149 | 3300031595 | Bacteria | 7688 |
| 370 | Ga0265313_10012298 | 3300031595 | Bacteria | 5238 |
| 371 | Ga0265313_10021254 | 3300031595 | Bacteria | 3554 |
| 372 | Ga0316579_10002311 | 3300031691 | Bacteria | 7198 |
| 373 | Ga0265314_10038296 | 3300031711 | Bacteria | 3466 |
| 374 | Ga0265342_10000158 | 3300031712 | Bacteria | 76866 |
| 375 | Ga0265342_10095010 | 3300031712 | Bacteria | 1705 |
| 376 | Ga0316576_10040864 | 3300031727 | Bacteria | 3335 |
| 377 | Ga0316576_10100099 | 3300031727 | Bacteria | 2166 |
| 378 | Ga0316578_10000651 | 3300031728 | Bacteria | 12292 |
| 379 | Ga0307405_10012885 | 3300031731 | Bacteria | 4444 |
| 380 | Ga0316577_10002446 | 3300031733 | Bacteria | 9198 |
| 381 | Ga0316577_10010268 | 3300031733 | Bacteria | 5050 |
| 382 | Ga0307413_10018598 | 3300031824 | Bacteria | 3651 |
| 383 | Ga0307413_10108715 | 3300031824 | Bacteria | 1851 |
| 384 | Ga0307410_10006614 | 3300031852 | Bacteria | 6269 |
| 385 | Ga0307410_10018286 | 3300031852 | Bacteria | 4232 |
| 386 | Ga0307410_10041176 | 3300031852 | Bacteria | 3045 |
| 387 | Ga0307410_10107511 | 3300031852 | Bacteria | 2012 |
| 388 | Ga0307406_10011431 | 3300031901 | Bacteria | 5039 |
| 389 | Ga0307406_10030864 | 3300031901 | Bacteria | 3258 |
| 390 | Ga0307407_10009430 | 3300031903 | Bacteria | 4548 |
| 391 | Ga0307407_10018970 | 3300031903 | Bacteria | 3492 |
| 392 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 393 | Ga0307412_10026545 | 3300031911 | Bacteria | 3601 |
| 394 | Ga0307412_10249432 | 3300031911 | Bacteria | 1378 |
| 395 | Ga0307409_100003739 | 3300031995 | Bacteria | 8359 |
| 396 | Ga0307409_100008700 | 3300031995 | Bacteria | 6182 |
| 397 | Ga0307409_100015405 | 3300031995 | Bacteria | 5018 |
| 398 | Ga0307409_100102773 | 3300031995 | Bacteria | 2375 |
| 399 | Ga0307409_100533225 | 3300031995 | Bacteria | 1149 |
| 400 | Ga0307416_100001429 | 3300032002 | Bacteria | 12970 |
| 401 | Ga0307416_100004343 | 3300032002 | Bacteria | 8526 |
| 402 | Ga0307416_100038689 | 3300032002 | Bacteria | 3682 |
| 403 | Ga0307416_100170194 | 3300032002 | Bacteria | 2026 |
| 404 | Ga0307416_100376135 | 3300032002 | Bacteria | 1448 |
| 405 | Ga0307414_10000268 | 3300032004 | Bacteria | 32688 |
| 406 | Ga0307414_10000987 | 3300032004 | Bacteria | 14520 |
| 407 | Ga0307414_10017542 | 3300032004 | Bacteria | 4382 |
| 408 | Ga0307414_10043983 | 3300032004 | Bacteria | 3046 |
| 409 | Ga0307414_10051328 | 3300032004 | Bacteria | 2863 |
| 410 | Ga0307414_10067852 | 3300032004 | Bacteria | 2557 |
| 411 | Ga0307414_10071082 | 3300032004 | Bacteria | 2509 |
| 412 | Ga0307414_10096749 | 3300032004 | Bacteria | 2210 |
| 413 | Ga0307414_10127997 | 3300032004 | Bacteria | 1966 |
| 414 | Ga0307414_10222659 | 3300032004 | Bacteria | 1550 |
| 415 | Ga0307414_10297239 | 3300032004 | Bacteria | 1364 |
| 416 | Ga0307414_10312218 | 3300032004 | Bacteria | 1335 |
| 417 | Ga0307411_10009234 | 3300032005 | Bacteria | 5170 |
| 418 | Ga0307411_10013833 | 3300032005 | Bacteria | 4470 |
| 419 | Ga0307411_10033958 | 3300032005 | Bacteria | 3169 |
| 420 | Ga0307411_10037936 | 3300032005 | Bacteria | 3035 |
| 421 | Ga0307411_10045018 | 3300032005 | Bacteria | 2836 |
| 422 | Ga0307411_10161600 | 3300032005 | Bacteria | 1678 |
| 423 | Ga0307415_100001701 | 3300032126 | Bacteria | 10692 |
| 424 | Ga0307415_100006638 | 3300032126 | Bacteria | 6260 |
| 425 | Ga0307415_100026115 | 3300032126 | Bacteria | 3678 |
| 426 | Ga0307415_100161571 | 3300032126 | Bacteria | 1737 |
| 427 | Ga0316580_10013952 | 3300032139 | Bacteria | 2450 |
| 428 | Ga0307510_10001091 | 3300033180 | Bacteria | 28923 |
| 429 | Ga0316212_1001669 | 3300033547 | Unclassified | 3061 |
| 430 | Ga0316212_1002260 | 3300033547 | Bacteria | 2736 |
| 431 | Ga0373930_0021121 | 3300034816 | Bacteria | 1275 |
| 432 | Ga0373926_0071783 | 3300035083 | Bacteria | 1273 |
| 433 | Ga0373940_0004493 | 3300035088 | Bacteria | 2950 |
| 434 | Ga0373932_0025561 | 3300035112 | Bacteria | 1600 |
| 435 | Ga0373955_0091868 | 3300035172 | Unclassified | 1731 |
| 436 | Ga0373931_0023779 | 3300035691 | Bacteria | 3096 |
| 437 | Ga0373931_0024584 | 3300035691 | Bacteria | 3053 |
| 438 | Ga0373933_0041714 | 3300035724 | Bacteria | 2710 |
| 439 | Ga0373937_0355910 | 3300036401 | Bacteria | 1387 |
| 440 | Ga0316582_0009201 | 3300036647 | Bacteria | 5349 |
| 441 | Ga0316582_0024164 | 3300036647 | Bacteria | 3634 |
| 442 | Ga0316584_0002980 | 3300036712 | Bacteria | 10891 |
| 443 | Ga0373925_0224152 | 3300037068 | Bacteria | 1501 |
| 444 | Ga0373925_0268855 | 3300037068 | Bacteria | 1371 |
| 445 | Ga0395899_0006954 | 3300037312 | Bacteria | 8764 |
| 446 | Ga0395899_0007594 | 3300037312 | Bacteria | 8364 |
| 447 | Ga0395899_0012626 | 3300037312 | Bacteria | 6474 |
| 448 | Ga0395899_0062700 | 3300037312 | Unclassified | 2737 |
| 449 | Ga0395900_0016874 | 3300037418 | Bacteria | 7452 |
| 450 | Ga0395900_0047098 | 3300037418 | Bacteria | 4439 |
| 451 | Ga0395900_0091042 | 3300037418 | Unclassified | 3134 |
| 452 | Ga0395900_0442233 | 3300037418 | Bacteria | 1257 |
| 453 | Ga0395898_0003612 | 3300037466 | Bacteria | 17220 |
| 454 | Ga0395898_0053989 | 3300037466 | Bacteria | 3922 |
| 455 | Ga0395898_0101731 | 3300037466 | Bacteria | 2759 |
| 456 | Ga0395898_0153441 | 3300037466 | Unclassified | 2203 |
| 457 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 458 | Ga0395905_0057101 | 3300037471 | Unclassified | 3651 |
| 459 | Ga0395905_0301602 | 3300037471 | Bacteria | 1490 |
| 460 | Ga0316581_0001034 | 3300037588 | Bacteria | 5971 |
| 461 | Ga0436364_0297591 | 3300037853 | Bacteria | 3028 |
| 462 | Ga0436364_1307424 | 3300037853 | Bacteria | 22417 |
| 463 | Ga0395901_0000279 | 3300038443 | Bacteria | 63353 |
| 464 | Ga0395901_0001337 | 3300038443 | Bacteria | 25839 |
| 465 | Ga0395901_0001993 | 3300038443 | Bacteria | 21012 |
| 466 | Ga0395901_0004556 | 3300038443 | Bacteria | 13986 |
| 467 | Ga0395901_0039033 | 3300038443 | Bacteria | 4912 |
| 468 | Ga0395901_0371422 | 3300038443 | Bacteria | 1473 |
| 469 | Ga0436365_0070120 | 3300039437 | Bacteria | 4026 |
| 470 | Ga0436365_0643609 | 3300039437 | Bacteria | 115180 |
| 471 | Ga0436362_0603024 | 3300039453 | Bacteria | 1685 |
| 472 | Ga0439431_0000125 | 3300041997 | Bacteria | 13494 |
| 473 | Ga0439449_0051961 | 3300042007 | Bacteria | 1516 |
| 474 | Ga0466972_0001361 | 3300044658 | Bacteria | 11856 |
| 475 | Ga0466972_0227300 | 3300044658 | Bacteria | 873 |
| 476 | Ga0453683_0000036 | 3300044673 | Bacteria | 232009 |
| 477 | Ga0466965_0002217 | 3300044683 | Bacteria | 8185 |
| 478 | Ga0466965_0005733 | 3300044683 | Bacteria | 5604 |
| 479 | Ga0466966_0097862 | 3300044684 | Bacteria | 1817 |
| 480 | Ga0466963_0101285 | 3300044694 | Bacteria | 1972 |
| 481 | Ga0453684_0002808 | 3300044712 | Bacteria | 41155 |
| 482 | Ga0453684_0058811 | 3300044712 | Bacteria | 4962 |
| 483 | Ga0453684_0069727 | 3300044712 | Bacteria | 4457 |
| 484 | Ga0466968_0002707 | 3300044735 | Bacteria | 6539 |
| 485 | Ga0466957_0043195 | 3300044842 | Bacteria | 2729 |
| 486 | Ga0466957_0195151 | 3300044842 | Bacteria | 1328 |
| 487 | Ga0466959_0019904 | 3300045049 | Bacteria | 4940 |
| 488 | Ga0451576_0000069 | 3300045051 | Bacteria | 259862 |
| 489 | Ga0451576_0531037 | 3300045051 | Bacteria | 1236 |
| 490 | Ga0466967_0013966 | 3300045976 | Bacteria | 6233 |
| 491 | Ga0495627_006558 | 3300046453 | Bacteria | 4551 |
| 492 | Ga0495592_0006086 | 3300046454 | Bacteria | 8967 |
| 493 | Ga0495592_0159593 | 3300046454 | Bacteria | 1553 |
| 494 | Ga0495603_0006449 | 3300046455 | Bacteria | 7025 |
| 495 | Ga0495629_0034883 | 3300046459 | Bacteria | 3556 |
| 496 | Ga0495651_0000075 | 3300046462 | Bacteria | 73020 |
| 497 | Ga0495651_0012963 | 3300046462 | Bacteria | 6443 |
| 498 | Ga0495653_0005508 | 3300046463 | Bacteria | 10313 |
| 499 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 500 | Ga0495650_0002096 | 3300046471 | Bacteria | 17160 |
| 501 | Ga0495580_0038724 | 3300046472 | Bacteria | 3413 |
| 502 | Ga0495580_0100457 | 3300046472 | Unclassified | 2012 |
| 503 | Ga0495580_0113002 | 3300046472 | Bacteria | 1886 |
| 504 | Ga0495639_0011600 | 3300046475 | Bacteria | 3802 |
| 505 | Ga0495594_0000609 | 3300046499 | Bacteria | 18428 |
| 506 | Ga0495594_0080085 | 3300046499 | Bacteria | 1823 |
| 507 | Ga0495596_0011908 | 3300046500 | Bacteria | 3734 |
| 508 | Ga0495583_0003402 | 3300046506 | Bacteria | 12167 |
| 509 | Ga0495606_0003562 | 3300046507 | Bacteria | 16425 |
| 510 | Ga0495606_0090662 | 3300046507 | Bacteria | 1881 |
| 511 | Ga0495618_0183576 | 3300046514 | Bacteria | 1329 |
| 512 | Ga0495618_0254772 | 3300046514 | Bacteria | 1100 |
| 513 | Ga0495620_0001135 | 3300046515 | Bacteria | 16252 |
| 514 | Ga0495628_0005563 | 3300046516 | Bacteria | 11033 |
| 515 | Ga0495630_0061676 | 3300046517 | Bacteria | 2816 |
| 516 | Ga0495630_0207019 | 3300046517 | Bacteria | 1497 |
| 517 | Ga0495631_0006473 | 3300046518 | Bacteria | 6042 |
| 518 | Ga0495631_0008024 | 3300046518 | Bacteria | 5335 |
| 519 | Ga0495666_0038873 | 3300046526 | Bacteria | 2313 |
| 520 | Ga0495666_0061257 | 3300046526 | Bacteria | 1798 |
| 521 | Ga0495665_0078694 | 3300046531 | Bacteria | 1734 |
| 522 | Ga0495640_0022054 | 3300046533 | Bacteria | 4663 |
| 523 | Ga0495586_0005192 | 3300046535 | Bacteria | 6971 |
| 524 | Ga0495587_0029043 | 3300046536 | Bacteria | 3359 |
| 525 | Ga0495622_0001198 | 3300046557 | Bacteria | 13394 |
| 526 | Ga0495633_0000022 | 3300046558 | Bacteria | 226582 |
| 527 | Ga0495667_0000317 | 3300046559 | Bacteria | 30459 |
| 528 | Ga0495667_0148198 | 3300046559 | Bacteria | 1511 |
| 529 | Ga0495667_0269144 | 3300046559 | Bacteria | 1083 |
| 530 | Ga0495656_0113829 | 3300046615 | Bacteria | 1269 |
| 531 | Ga0495668_0003772 | 3300046616 | Bacteria | 11107 |
| 532 | Ga0495634_0031899 | 3300046642 | Bacteria | 3627 |
| 533 | Ga0495611_0003403 | 3300046648 | Bacteria | 7023 |
| 534 | Ga0495625_0000814 | 3300046660 | Bacteria | 43131 |
| 535 | Ga0495625_0002581 | 3300046660 | Bacteria | 19455 |
| 536 | Ga0495635_0010647 | 3300046663 | Bacteria | 6439 |
| 537 | Ga0495635_0099059 | 3300046663 | Bacteria | 1992 |
| 538 | Ga0495661_0065068 | 3300046665 | Bacteria | 2149 |
| 539 | Ga0495657_0002991 | 3300046675 | Bacteria | 13994 |
| 540 | Ga0495657_0026450 | 3300046675 | Bacteria | 4108 |
| 541 | Ga0495599_0011134 | 3300046678 | Bacteria | 5520 |
| 542 | Ga0495647_0002103 | 3300046681 | Bacteria | 6224 |
| 543 | Ga0495658_0007656 | 3300046683 | Bacteria | 5355 |
| 544 | Ga0495613_0024783 | 3300046689 | Bacteria | 4470 |
| 545 | Ga0495613_0058417 | 3300046689 | Bacteria | 2830 |
| 546 | Ga0495624_0013917 | 3300046690 | Bacteria | 5476 |
| 547 | Ga0495624_0018159 | 3300046690 | Bacteria | 4706 |
| 548 | Ga0495649_0200506 | 3300046694 | Bacteria | 1036 |
| 549 | Ga0495589_0002429 | 3300046794 | Bacteria | 10476 |
| 550 | Ga0495581_0018224 | 3300047315 | Bacteria | 4078 |
| 551 | Ga0495604_0008185 | 3300047317 | Bacteria | 8272 |
| 552 | Ga0495674_0058998 | 3300047319 | Bacteria | 3353 |
| 553 | Ga0495674_0060030 | 3300047319 | Bacteria | 3319 |
| 554 | Ga0495674_0067190 | 3300047319 | Unclassified | 3107 |
| 555 | Ga0495674_0195888 | 3300047319 | Bacteria | 1678 |
| 556 | Ga0495674_0275831 | 3300047319 | Bacteria | 1379 |
| 557 | Ga0495672_0000875 | 3300047320 | Bacteria | 31630 |
| 558 | Ga0495676_0015768 | 3300047321 | Bacteria | 6716 |
| 559 | Ga0495676_0051064 | 3300047321 | Bacteria | 3311 |
| 560 | Ga0495680_0000274 | 3300047322 | Bacteria | 57527 |
| 561 | Ga0495680_0016743 | 3300047322 | Bacteria | 6286 |
| 562 | Ga0495680_0056700 | 3300047322 | Unclassified | 3032 |
| 563 | Ga0495683_0002147 | 3300047323 | Bacteria | 12127 |
| 564 | Ga0495675_0075432 | 3300047444 | Unclassified | 2125 |
| 565 | Ga0495685_000407 | 3300047447 | Bacteria | 13643 |
| 566 | Ga0495684_0012037 | 3300047471 | Bacteria | 6672 |
| 567 | Ga0495686_0000737 | 3300047472 | Bacteria | 43637 |
| 568 | Ga0495686_0009364 | 3300047472 | Bacteria | 7062 |
| 569 | Ga0495686_0060005 | 3300047472 | Bacteria | 2365 |
| 570 | Ga0495593_0041388 | 3300047673 | Bacteria | 2477 |
| 571 | Ga0495602_0195313 | 3300048088 | Unclassified | 1548 |
| 572 | Ga0495614_0012363 | 3300048089 | Bacteria | 3746 |
| 573 | Ga0495614_0016960 | 3300048089 | Bacteria | 3166 |
| 574 | Ga0495614_0038560 | 3300048089 | Bacteria | 2050 |
| 575 | Ga0495626_0007110 | 3300048091 | Bacteria | 6269 |
| 576 | Ga0496100_0128744 | 3300048903 | Bacteria | 1780 |
| 577 | Ga0496102_0013502 | 3300048905 | Bacteria | 7075 |
| 578 | Ga0496102_0181570 | 3300048905 | Bacteria | 1983 |
| 579 | Ga0496103_0014765 | 3300048906 | Bacteria | 4642 |
| 580 | Ga0496104_0008797 | 3300048907 | Bacteria | 8976 |
| 581 | Ga0496104_0085328 | 3300048907 | Bacteria | 3014 |
| 582 | Ga0496104_0433116 | 3300048907 | Bacteria | 1227 |
| 583 | Ga0496105_0137184 | 3300048908 | Bacteria | 2015 |
| 584 | Ga0496106_0063877 | 3300048909 | Bacteria | 2799 |
| 585 | Ga0496107_0182530 | 3300048910 | Bacteria | 1558 |
| 586 | Ga0496108_0004141 | 3300048911 | Bacteria | 11659 |
| 587 | Ga0496108_0058414 | 3300048911 | Bacteria | 3242 |
| 588 | Ga0496109_0003590 | 3300048912 | Bacteria | 12953 |
| 589 | Ga0496109_0012623 | 3300048912 | Bacteria | 7296 |
| 590 | Ga0496110_0065983 | 3300048913 | Bacteria | 3200 |
| 591 | Ga0496110_0186228 | 3300048913 | Bacteria | 1885 |
| 592 | Ga0496111_0013416 | 3300048914 | Bacteria | 5576 |
| 593 | Ga0496111_0058754 | 3300048914 | Bacteria | 2785 |
| 594 | Ga0496112_0002880 | 3300048915 | Bacteria | 13997 |
| 595 | Ga0496112_0319835 | 3300048915 | Bacteria | 1496 |
| 596 | Ga0496113_0000741 | 3300048916 | Bacteria | 16766 |
| 597 | Ga0496113_0132429 | 3300048916 | Bacteria | 1957 |
| 598 | Ga0496114_0052108 | 3300048917 | Bacteria | 3409 |
| 599 | Ga0496114_0162071 | 3300048917 | Bacteria | 1945 |
| 600 | Ga0496115_0005244 | 3300048918 | Bacteria | 9417 |
| 601 | Ga0496115_0155922 | 3300048918 | Bacteria | 1887 |
| 602 | Ga0496117_0004000 | 3300048920 | Bacteria | 16644 |
| 603 | Ga0496118_0002784 | 3300048921 | Bacteria | 22888 |
| 604 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 605 | Ga0496122_0002421 | 3300048925 | Bacteria | 26557 |
| 606 | Ga0496123_0008155 | 3300048926 | Bacteria | 9665 |
| 607 | Ga0496126_0000020 | 3300048929 | Bacteria | 490805 |
| 608 | Ga0501031_0133037 | 3300049568 | Bacteria | 1625 |
| 609 | Ga0501032_0138448 | 3300049569 | Bacteria | 1604 |
| 610 | Ga0501033_0039590 | 3300049570 | Bacteria | 3521 |
| 611 | Ga0501033_0292938 | 3300049570 | Bacteria | 1147 |
| 612 | Ga0501034_0003719 | 3300049571 | Bacteria | 17227 |
| 613 | Ga0501034_0052256 | 3300049571 | Bacteria | 4117 |
| 614 | Ga0501034_0227502 | 3300049571 | Bacteria | 1815 |
| 615 | Ga0501036_0070283 | 3300049572 | Bacteria | 2960 |
| 616 | Ga0501036_0115103 | 3300049572 | Bacteria | 2272 |
| 617 | Ga0501037_0192482 | 3300049573 | Bacteria | 1444 |
| 618 | Ga0501038_0372256 | 3300049574 | Bacteria | 1109 |
| 619 | Ga0501040_0019566 | 3300049576 | Bacteria | 4505 |
| 620 | Ga0501040_0026269 | 3300049576 | Bacteria | 3916 |
| 621 | Ga0501040_0106504 | 3300049576 | Bacteria | 1959 |
| 622 | Ga0501041_0016606 | 3300049577 | Bacteria | 4379 |
| 623 | Ga0501042_0073414 | 3300049578 | Bacteria | 2447 |
| 624 | Ga0501046_0176883 | 3300049580 | Bacteria | 1598 |
| 625 | Ga0501047_0174021 | 3300049581 | Bacteria | 2021 |
| 626 | Ga0501048_0020442 | 3300049582 | Bacteria | 4852 |
| 627 | Ga0501067_0011567 | 3300049583 | Bacteria | 4889 |
| 628 | Ga0501067_0041825 | 3300049583 | Bacteria | 2545 |
| 629 | Ga0501068_0009496 | 3300049584 | Bacteria | 5447 |
| 630 | Ga0501070_0053878 | 3300049586 | Bacteria | 3336 |
| 631 | Ga0501072_0191820 | 3300049588 | Bacteria | 1629 |
| 632 | Ga0501076_0003750 | 3300049592 | Bacteria | 10685 |
| 633 | Ga0501076_0058581 | 3300049592 | Bacteria | 3062 |
| 634 | Ga0501076_0139491 | 3300049592 | Bacteria | 1969 |
| 635 | Ga0501077_0014567 | 3300049593 | Bacteria | 4943 |
| 636 | Ga0501209_013208 | 3300049656 | Bacteria | 1781 |
| 637 | Ga0501079_0016325 | 3300049741 | Bacteria | 5674 |
| 638 | Ga0501079_0053803 | 3300049741 | Bacteria | 3105 |
| 639 | Ga0501080_0038029 | 3300049742 | Bacteria | 4495 |
| 640 | Ga0501080_0110650 | 3300049742 | Bacteria | 2546 |
| 641 | Ga0501081_0011673 | 3300049743 | Bacteria | 5752 |
| 642 | Ga0501083_0044704 | 3300049744 | Bacteria | 2998 |
| 643 | Ga0501241_000418 | 3300049758 | Bacteria | 9344 |
| 644 | Ga0501241_002808 | 3300049758 | Bacteria | 3347 |
| 645 | Ga0501273_000510 | 3300049770 | Bacteria | 3149 |
| 646 | Ga0501035_0170050 | 3300049822 | Bacteria | 1883 |
| 647 | Ga0501044_0113523 | 3300049823 | Bacteria | 2716 |
| 648 | Ga0501044_0223098 | 3300049823 | Bacteria | 1835 |
| 649 | nmdc:mga05p37_391440_c1 | 3300050507 | Bacteria | 1625 |
| 650 | nmdc:mga0qj67_16368_c1 | 3300050509 | Bacteria | 5622 |
| 651 | nmdc:mga0qj67_323984_c1 | 3300050509 | Bacteria | 1247 |
| 652 | nmdc:mga06r32_15049_c1 | 3300050510 | Bacteria | 7024 |
| 653 | nmdc:mga0n895_82764_c1 | 3300050512 | Bacteria | 3199 |
| 654 | nmdc:mga0a205_143549_c1 | 3300050515 | Bacteria | 2287 |
| 655 | Ga0495601_0057087 | 3300053077 | Bacteria | 2473 |
| 656 | Ga0500635_0002802 | 3300053080 | Bacteria | 4326 |
| 657 | Ga0500643_037877 | 3300053087 | Bacteria | 1433 |
| 658 | Ga0500644_0000240 | 3300053088 | Bacteria | 31306 |
| 659 | Ga0500646_0005886 | 3300053090 | Bacteria | 3112 |
| 660 | Ga0500651_0000108 | 3300053093 | Bacteria | 50821 |
| 661 | Ga0500651_0001193 | 3300053093 | Bacteria | 12892 |
| 662 | Ga0500569_000902 | 3300053109 | Bacteria | 5316 |
| 663 | Ga0500642_0034757 | 3300053130 | Bacteria | 2136 |
| 664 | Ga0500652_015058 | 3300053131 | Bacteria | 2781 |
| 665 | Ga0500568_0038280 | 3300053139 | Bacteria | 1941 |
| 666 | Ga0500616_0004435 | 3300053153 | Bacteria | 10007 |
| 667 | Ga0500622_0000616 | 3300053156 | Bacteria | 32195 |
| 668 | Ga0500636_0123366 | 3300053177 | Bacteria | 1451 |
| 669 | Ga0501084_0023329 | 3300054114 | Bacteria | 5164 |
| 670 | Ga0501084_0041515 | 3300054114 | Bacteria | 3849 |
| 671 | Ga0500661_005595 | 3300055283 | Bacteria | 2343 |
| 672 | Ga0590071_005972 | 3300059421 | Bacteria | 2914 |
| 673 | Ga0590071_009001 | 3300059421 | Bacteria | 2348 |
| 674 | Ga0590074_006296 | 3300059423 | Bacteria | 1970 |
| 675 | Ga0590074_012025 | 3300059423 | Bacteria | 1454 |
| 676 | Ga0590077_007285 | 3300059426 | Bacteria | 2264 |
| 677 | Ga0501082_0050125 | 3300060353 | Bacteria | 3601 |
| 678 | Ga0501082_0343186 | 3300060353 | Bacteria | 1301 |
| 679 | Ga0530510_0040539 | 3300061734 | Bacteria | 3361 |
| 680 | 2616701179 | 2616644814 | Bacteria | 11555299 |
| 681 | 2738758307 | 2738541283 | Bacteria | 7222293 |
| 682 | 2738763154 | 2738541284 | Bacteria | 5199923 |
| 683 | 2739303835 | 2738543023 | Bacteria | 6767879 |
| 684 | 2776616309 | 2775506987 | Bacteria | 5373360 |
| 685 | 2809228887 | 2808606448 | Bacteria | 8656184 |
| 686 | 2819571998 | 2818991442 | Bacteria | 8318214 |
| 687 | 2819677767 | 2818991460 | Bacteria | 7595395 |
| 688 | 2821141758 | 2821136567 | Bacteria | 8080116 |
| 689 | 2831906975 | 2831905167 | Bacteria | 3319172 |
| 690 | 2852629664 | 2852627209 | Bacteria | 5896285 |
| 691 | 2883073197 | 2883068021 | Bacteria | 6192739 |
| 692 | 2884797716 | 2884791551 | Bacteria | 8511252 |
| 693 | 2896114726 | 2896109856 | Bacteria | 7140722 |
| 694 | 2904469827 | 2904467357 | Bacteria | 8057758 |
| 695 | 2919191061 | 2919186247 | Bacteria | 6244071 |
| 696 | 2929183236 | 2929177148 | Bacteria | 7883697 |
| 697 | 2929245362 | 2929239360 | Bacteria | 7745570 |
| 698 | 2929927614 | 2929921140 | Bacteria | 8649150 |
| 699 | 2939669341 | 2939664404 | Bacteria | 6364494 |
| 700 | 2945979195 | 2945977869 | Bacteria | 7777518 |
| 701 | 2946014936 | 2946013367 | Bacteria | 7766675 |
| 702 | 8003151461 | 8003151029 | Bacteria | 8187759 |
| 703 | Ga0501033_0120961 | |||
| 704 | SwRhRL2b_contig_1653087 | |||
| 705 | JGI24736J21556_1007625 | |||
| 706 | JGI25154J39366_1000587 | |||
| 707 | JGI25158J39367_1006219 | |||
| 708 | JGI25406J46586_10013591 | |||
| 709 | JGI25153J46596_10000224 | |||
| 710 | rootH2_10004419 | |||
| 711 | rootH2_10241813 | |||
| 712 | rootL2_10160258 | |||
| 713 | rootL2_10281962 | |||
| 714 | rootL2_10289050 | |||
| 715 | rootH1_10024117 | |||
| 716 | rootH1_10040132 | |||
| 717 | Ga0055542_1002717 | |||
| 718 | Ga0055531_10000132 | |||
| 719 | Ga0058859_11782272 | |||
| 720 | Ga0065165_1028129 | |||
| 721 | Ga0065714_10003722 | |||
| 722 | Ga0065714_10006151 | |||
| 723 | Ga0065714_10069901 | |||
| 724 | Ga0065714_10107029 | |||
| 725 | Ga0065704_10000425 | |||
| 726 | Ga0065704_10074258 | |||
| 727 | Ga0065704_10096285 | |||
| 728 | Ga0070658_10020104 | |||
| 729 | Ga0070658_10076261 | |||
| 730 | Ga0070676_10002188 | |||
| 731 | Ga0070683_100039163 | |||
| 732 | Ga0070683_100354695 | |||
| 733 | Ga0070683_100449933 | |||
| 734 | Ga0070670_100000292 | |||
| 735 | Ga0070670_100197294 | |||
| 736 | Ga0068869_100340433 | |||
| 737 | Ga0070680_100020355 | |||
| 738 | Ga0070680_100221815 | |||
| 739 | Ga0070680_100371885 | |||
| 740 | Ga0070689_100096183 | |||
| 741 | Ga0070687_100147145 | |||
| 742 | Ga0070668_100095027 | |||
| 743 | Ga0070673_100011603 | |||
| 744 | Ga0070688_100175590 | |||
| 745 | Ga0070659_100095172 | |||
| 746 | Ga0070659_100111135 | |||
| 747 | Ga0070659_100147183 | |||
| 748 | Ga0070667_100000415 | |||
| 749 | Ga0070703_10005421 | |||
| 750 | Ga0070709_10005139 | |||
| 751 | Ga0070709_10026716 | |||
| 752 | Ga0070714_100046381 | |||
| 753 | Ga0070713_100096679 | |||
| 754 | Ga0070710_10000342 | |||
| 755 | Ga0070701_10220886 | |||
| 756 | Ga0070711_100005710 | |||
| 757 | Ga0070711_100025090 | |||
| 758 | Ga0070705_100013439 | |||
| 759 | Ga0070705_100156190 | |||
| 760 | Ga0070700_100084526 | |||
| 761 | Ga0070694_100001094 | |||
| 762 | Ga0070708_100004098 | |||
| 763 | Ga0070708_100039982 | |||
| 764 | Ga0070708_100127425 | |||
| 765 | Ga0070708_100189257 | |||
| 766 | Ga0070708_100263674 | |||
| 767 | Ga0070678_100001564 | |||
| 768 | Ga0070662_100000043 | |||
| 769 | Ga0070662_100272345 | |||
| 770 | Ga0070681_10004632 | |||
| 771 | Ga0070681_10347638 | |||
| 772 | Ga0068867_100000970 | |||
| 773 | Ga0070706_100005569 | |||
| 774 | Ga0070706_100068254 | |||
| 775 | Ga0070707_100007438 | |||
| 776 | Ga0070707_100010931 | |||
| 777 | Ga0070707_100351689 | |||
| 778 | Ga0070707_100452337 | |||
| 779 | Ga0070698_100015876 | |||
| 780 | Ga0070698_100056214 | |||
| 781 | Ga0070698_100063498 | |||
| 782 | Ga0070698_100172939 | |||
| 783 | Ga0070698_100210880 | |||
| 784 | Ga0070699_100009581 | |||
| 785 | Ga0070699_100051477 | |||
| 786 | Ga0070699_100299399 | |||
| 787 | Ga0070679_100000575 | |||
| 788 | Ga0070679_100001256 | |||
| 789 | Ga0070679_100120140 | |||
| 790 | Ga0070684_100072257 | |||
| 791 | Ga0070697_100001294 | |||
| 792 | Ga0070697_100003459 | |||
| 793 | Ga0070697_100004739 | |||
| 794 | Ga0070697_100013284 | |||
| 795 | Ga0070697_100236227 | |||
| 796 | Ga0068853_100086942 | |||
| 797 | Ga0070672_100233351 | |||
| 798 | Ga0070686_100014764 | |||
| 799 | Ga0070695_100006098 | |||
| 800 | Ga0070695_100064043 | |||
| 801 | Ga0070696_100000740 | |||
| 802 | Ga0070696_100050526 | |||
| 803 | Ga0070696_100098818 | |||
| 804 | Ga0070693_100001006 | |||
| 805 | Ga0070693_100018101 | |||
| 806 | Ga0070665_100000017 | |||
| 807 | Ga0070665_100043298 | |||
| 808 | Ga0070704_100006564 | |||
| 809 | Ga0070704_100178865 | |||
| 810 | Ga0068855_100067792 | |||
| 811 | Ga0068855_100092300 | |||
| 812 | Ga0068855_100352685 | |||
| 813 | Ga0070664_100173869 | |||
| 814 | Ga0068857_100032705 | |||
| 815 | Ga0068856_100093074 | |||
| 816 | Ga0068852_100004240 | |||
| 817 | Ga0068852_100121571 | |||
| 818 | Ga0068859_100064410 | |||
| 819 | Ga0068859_100101848 | |||
| 820 | Ga0068859_100155823 | |||
| 821 | Ga0068864_100000300 | |||
| 822 | Ga0068864_100045885 | |||
| 823 | Ga0068864_100166504 | |||
| 824 | Ga0068861_100014168 | |||
| 825 | Ga0068863_100000073 | |||
| 826 | Ga0068863_100087106 | |||
| 827 | Ga0068858_100354133 | |||
| 828 | Ga0068858_100571358 | |||
| 829 | Ga0068860_100002227 | |||
| 830 | Ga0068860_100034591 | |||
| 831 | Ga0068862_100000431 | |||
| 832 | Ga0081455_10089200 | |||
| 833 | Ga0081539_10000597 | |||
| 834 | Ga0081539_10028543 | |||
| 835 | Ga0070717_10143433 | |||
| 836 | Ga0075363_100048553 | |||
| 837 | Ga0070716_100001859 | |||
| 838 | Ga0070716_100004211 | |||
| 839 | Ga0070716_100040475 | |||
| 840 | Ga0070716_100052372 | |||
| 841 | Ga0070712_100029338 | |||
| 842 | Ga0097621_100000099 | |||
| 843 | Ga0068871_100000290 | |||
| 844 | Ga0075428_100148069 | |||
| 845 | Ga0075430_100198118 | |||
| 846 | Ga0075431_100018982 | |||
| 847 | Ga0075433_10127260 | |||
| 848 | Ga0075433_10156906 | |||
| 849 | Ga0075434_100113670 | |||
| 850 | Ga0075434_100151391 | |||
| 851 | Ga0075436_100095937 | |||
| 852 | Ga0097620_100064412 | |||
| 853 | Ga0097620_100101847 | |||
| 854 | Ga0097620_100155833 | |||
| 855 | Ga0099794_10001609 | |||
| 856 | Ga0099794_10002978 | |||
| 857 | Ga0099794_10016218 | |||
| 858 | Ga0099794_10110523 | |||
| 859 | Ga0105251_10000296 | |||
| 860 | Ga0105240_10004537 | |||
| 861 | Ga0105240_10083212 | |||
| 862 | Ga0105240_10115941 | |||
| 863 | Ga0105240_10143457 | |||
| 864 | Ga0105240_10150951 | |||
| 865 | Ga0105245_10002109 | |||
| 866 | Ga0105247_10012063 | |||
| 867 | Ga0114129_10515386 | |||
| 868 | Ga0105241_10005263 | |||
| 869 | Ga0105241_10015656 | |||
| 870 | Ga0105241_10110294 | |||
| 871 | Ga0105241_10125282 | |||
| 872 | Ga0105241_10710227 | |||
| 873 | Ga0105242_10029962 | |||
| 874 | Ga0105248_10000029 | |||
| 875 | Ga0105248_10005459 | |||
| 876 | Ga0105248_10028360 | |||
| 877 | Ga0105248_10152135 | |||
| 878 | Ga0105237_10000805 | |||
| 879 | Ga0105237_10001937 | |||
| 880 | Ga0105237_10065636 | |||
| 881 | Ga0105238_10020964 | |||
| 882 | Ga0105238_10047639 | |||
| 883 | Ga0105249_10300880 | |||
| 884 | Ga0099796_10014533 | |||
| 885 | Ga0099796_10019493 | |||
| 886 | Ga0105239_10000095 | |||
| 887 | Ga0105239_10092634 | |||
| 888 | Ga0105239_10240584 | |||
| 889 | Ga0105239_10571685 | |||
| 890 | Ga0105246_10083985 | |||
| 891 | Ga0157373_10000034 | |||
| 892 | Ga0157373_10002835 | |||
| 893 | Ga0157373_10006316 | |||
| 894 | Ga0157373_10028380 | |||
| 895 | Ga0157373_10294336 | |||
| 896 | Ga0157371_10001448 | |||
| 897 | Ga0157371_10003042 | |||
| 898 | Ga0157371_10003741 | |||
| 899 | Ga0157371_10015852 | |||
| 900 | Ga0157371_10050713 | |||
| 901 | Ga0157371_10054552 | |||
| 902 | Ga0157370_10000083 | |||
| 903 | Ga0157370_10003843 | |||
| 904 | Ga0157370_10025903 | |||
| 905 | Ga0157370_10044375 | |||
| 906 | Ga0157370_10128696 | |||
| 907 | Ga0157369_10092689 | |||
| 908 | Ga0157369_10093339 | |||
| 909 | Ga0157369_10102491 | |||
| 910 | Ga0157369_10142776 | |||
| 911 | Ga0157369_10388570 | |||
| 912 | Ga0157374_10001159 | |||
| 913 | Ga0157374_10001894 | |||
| 914 | Ga0157374_10009460 | |||
| 915 | Ga0157378_10000560 | |||
| 916 | Ga0157378_10001056 | |||
| 917 | Ga0163162_10000051 | |||
| 918 | Ga0163162_10017425 | |||
| 919 | Ga0163162_10214228 | |||
| 920 | Ga0157372_10002554 | |||
| 921 | Ga0157372_10003988 | |||
| 922 | Ga0157372_10004195 | |||
| 923 | Ga0157372_10033289 | |||
| 924 | Ga0157372_10210633 | |||
| 925 | Ga0157375_10195387 | |||
| 926 | Ga0157375_10297419 | |||
| 927 | Ga0157380_10046279 | |||
| 928 | Ga0182008_10000022 | |||
| 929 | Ga0182008_10000104 | |||
| 930 | Ga0157377_10101298 | |||
| 931 | Ga0157379_10070427 | |||
| 932 | Ga0157379_10082915 | |||
| 933 | Ga0157379_10383703 | |||
| 934 | Ga0157376_10016366 | |||
| 935 | Ga0182006_1000279 | |||
| 936 | Ga0182006_1010075 | |||
| 937 | Ga0182007_10011886 | |||
| 938 | Ga0182005_1000209 | |||
| 939 | Ga0163161_10000828 | |||
| 940 | Ga0213876_10000909 | |||
| 941 | Ga0213875_10004925 | |||
| 942 | Ga0209436_104141 | |||
| 943 | Ga0209436_108603 | |||
| 944 | Ga0209258_100075 | |||
| 945 | Ga0209646_1000005 | |||
| 946 | Ga0209026_1000198 | |||
| 947 | Ga0209026_1000199 | |||
| 948 | Ga0209148_1000085 | |||
| 949 | Ga0209129_1007780 | |||
| 950 | Ga0209758_1000742 | |||
| 951 | Ga0207426_1000057 | |||
| 952 | Ga0207426_1000888 | |||
| 953 | Ga0209257_1000004 | |||
| 954 | Ga0207713_1002770 | |||
| 955 | Ga0207653_10005977 | |||
| 956 | Ga0207692_10000633 | |||
| 957 | Ga0207710_10006368 | |||
| 958 | Ga0207647_10000036 | |||
| 959 | Ga0207647_10008554 | |||
| 960 | Ga0207699_10006337 | |||
| 961 | Ga0207699_10019145 | |||
| 962 | Ga0207699_10020705 | |||
| 963 | Ga0207699_10244510 | |||
| 964 | Ga0207645_10000312 | |||
| 965 | Ga0207705_10016332 | |||
| 966 | Ga0207705_10044980 | |||
| 967 | Ga0207684_10011618 | |||
| 968 | Ga0207684_10031677 | |||
| 969 | Ga0207684_10073185 | |||
| 970 | Ga0207654_10009434 | |||
| 971 | Ga0207654_10011141 | |||
| 972 | Ga0207707_10176083 | |||
| 973 | Ga0207695_10001548 | |||
| 974 | Ga0207695_10013446 | |||
| 975 | Ga0207695_10046307 | |||
| 976 | Ga0207695_10098003 | |||
| 977 | Ga0207671_10002974 | |||
| 978 | Ga0207671_10005112 | |||
| 979 | Ga0207671_10007229 | |||
| 980 | Ga0207693_10137464 | |||
| 981 | Ga0207693_10267033 | |||
| 982 | Ga0207663_10012107 | |||
| 983 | Ga0207663_10030522 | |||
| 984 | Ga0207660_10051504 | |||
| 985 | Ga0207660_10146516 | |||
| 986 | Ga0207657_10092205 | |||
| 987 | Ga0207657_10192169 | |||
| 988 | Ga0207652_10000051 | |||
| 989 | Ga0207652_10000791 | |||
| 990 | Ga0207652_10011674 | |||
| 991 | Ga0207646_10000481 | |||
| 992 | Ga0207646_10000572 | |||
| 993 | Ga0207646_10373084 | |||
| 994 | Ga0207681_10424609 | |||
| 995 | Ga0207694_10096180 | |||
| 996 | Ga0207687_10349342 | |||
| 997 | Ga0207700_10069255 | |||
| 998 | Ga0207700_10099169 | |||
| 999 | Ga0207664_10046416 | |||
| 1000 | Ga0207664_10380495 | |||
| 1001 | Ga0207690_10060358 | |||
| 1002 | Ga0207690_10113976 | |||
| 1003 | Ga0207706_10000125 | |||
| 1004 | Ga0207706_10236649 | |||
| 1005 | Ga0207686_10111386 | |||
| 1006 | Ga0207670_10072705 | |||
| 1007 | Ga0207704_10000335 | |||
| 1008 | Ga0207665_10000023 | |||
| 1009 | Ga0207665_10003362 | |||
| 1010 | Ga0207665_10032079 | |||
| 1011 | Ga0207665_10052077 | |||
| 1012 | Ga0207665_10062870 | |||
| 1013 | Ga0207665_10408651 | |||
| 1014 | Ga0207691_10151605 | |||
| 1015 | Ga0207711_10000004 | |||
| 1016 | Ga0207711_10048440 | |||
| 1017 | Ga0207689_10213628 | |||
| 1018 | Ga0207661_10027845 | |||
| 1019 | Ga0207667_10002789 | |||
| 1020 | Ga0207667_10021474 | |||
| 1021 | Ga0207667_10070847 | |||
| 1022 | Ga0207651_10002492 | |||
| 1023 | Ga0207712_10187994 | |||
| 1024 | Ga0207658_10001129 | |||
| 1025 | Ga0207703_10387617 | |||
| 1026 | Ga0207639_10067588 | |||
| 1027 | Ga0207678_10156920 | |||
| 1028 | Ga0207708_10032968 | |||
| 1029 | Ga0207702_10005819 | |||
| 1030 | Ga0207702_10065757 | |||
| 1031 | Ga0207641_10000018 | |||
| 1032 | Ga0207641_10500897 | |||
| 1033 | Ga0207648_10000961 | |||
| 1034 | Ga0207648_10184925 | |||
| 1035 | Ga0207648_10258703 | |||
| 1036 | Ga0207676_10000276 | |||
| 1037 | Ga0207676_10033700 | |||
| 1038 | Ga0207676_10562444 | |||
| 1039 | Ga0207674_10084633 | |||
| 1040 | Ga0207675_100011052 | |||
| 1041 | Ga0207683_10010707 | |||
| 1042 | Ga0207683_10239986 | |||
| 1043 | Ga0207698_10003948 | |||
| 1044 | Ga0209588_1002151 | |||
| 1045 | Ga0209588_1002685 | |||
| 1046 | Ga0209588_1003067 | |||
| 1047 | Ga0209588_1016128 | |||
| 1048 | Ga0265354_1000026 | |||
| 1049 | Ga0268266_10000037 | |||
| 1050 | Ga0268266_10012805 | |||
| 1051 | Ga0268266_10213270 | |||
| 1052 | Ga0268265_10000097 | |||
| 1053 | Ga0268264_10444098 | |||
| 1054 | Ga0265318_10004764 | |||
| 1055 | Ga0265770_1001077 | |||
| 1056 | Ga0265765_1000099 | |||
| 1057 | Ga0265332_10044009 | |||
| 1058 | Ga0265320_10049766 | |||
| 1059 | Ga0265325_10031694 | |||
| 1060 | Ga0265325_10050234 | |||
| 1061 | Ga0265329_10000084 | |||
| 1062 | Ga0265339_10044764 | |||
| 1063 | Ga0265331_10000047 | |||
| 1064 | Ga0265331_10061485 | |||
| 1065 | Ga0265327_10006221 | |||
| 1066 | Ga0265316_10215532 | |||
| 1067 | Ga0307408_100013148 | |||
| 1068 | Ga0307408_100045499 | |||
| 1069 | Ga0307408_100099563 | |||
| 1070 | Ga0307408_100329279 | |||
| 1071 | Ga0265313_10007149 | |||
| 1072 | Ga0265313_10012298 | |||
| 1073 | Ga0265313_10021254 | |||
| 1074 | Ga0316579_10002311 | |||
| 1075 | Ga0265314_10038296 | |||
| 1076 | Ga0265342_10000158 | |||
| 1077 | Ga0265342_10095010 | |||
| 1078 | Ga0316576_10040864 | |||
| 1079 | Ga0316576_10100099 | |||
| 1080 | Ga0316578_10000651 | |||
| 1081 | Ga0307405_10012885 | |||
| 1082 | Ga0316577_10002446 | |||
| 1083 | Ga0316577_10010268 | |||
| 1084 | Ga0307413_10018598 | |||
| 1085 | Ga0307413_10108715 | |||
| 1086 | Ga0307410_10006614 | |||
| 1087 | Ga0307410_10018286 | |||
| 1088 | Ga0307410_10041176 | |||
| 1089 | Ga0307410_10107511 | |||
| 1090 | Ga0307406_10011431 | |||
| 1091 | Ga0307406_10030864 | |||
| 1092 | Ga0307407_10009430 | |||
| 1093 | Ga0307407_10018970 | |||
| 1094 | Ga0307412_10000001 | |||
| 1095 | Ga0307412_10026545 | |||
| 1096 | Ga0307412_10249432 | |||
| 1097 | Ga0307409_100003739 | |||
| 1098 | Ga0307409_100008700 | |||
| 1099 | Ga0307409_100015405 | |||
| 1100 | Ga0307409_100102773 | |||
| 1101 | Ga0307409_100533225 | |||
| 1102 | Ga0307416_100001429 | |||
| 1103 | Ga0307416_100004343 | |||
| 1104 | Ga0307416_100038689 | |||
| 1105 | Ga0307416_100170194 | |||
| 1106 | Ga0307416_100376135 | |||
| 1107 | Ga0307414_10000268 | |||
| 1108 | Ga0307414_10000987 | |||
| 1109 | Ga0307414_10017542 | |||
| 1110 | Ga0307414_10043983 | |||
| 1111 | Ga0307414_10051328 | |||
| 1112 | Ga0307414_10067852 | |||
| 1113 | Ga0307414_10071082 | |||
| 1114 | Ga0307414_10096749 | |||
| 1115 | Ga0307414_10127997 | |||
| 1116 | Ga0307414_10222659 | |||
| 1117 | Ga0307414_10297239 | |||
| 1118 | Ga0307414_10312218 | |||
| 1119 | Ga0307411_10009234 | |||
| 1120 | Ga0307411_10013833 | |||
| 1121 | Ga0307411_10033958 | |||
| 1122 | Ga0307411_10037936 | |||
| 1123 | Ga0307411_10045018 | |||
| 1124 | Ga0307411_10161600 | |||
| 1125 | Ga0307415_100001701 | |||
| 1126 | Ga0307415_100006638 | |||
| 1127 | Ga0307415_100026115 | |||
| 1128 | Ga0307415_100161571 | |||
| 1129 | Ga0316580_10013952 | |||
| 1130 | Ga0307510_10001091 | |||
| 1131 | Ga0316212_1001669 | |||
| 1132 | Ga0316212_1002260 | |||
| 1133 | Ga0373930_0021121 | |||
| 1134 | Ga0373926_0071783 | |||
| 1135 | Ga0373940_0004493 | |||
| 1136 | Ga0373932_0025561 | |||
| 1137 | Ga0373955_0091868 | |||
| 1138 | Ga0373931_0023779 | |||
| 1139 | Ga0373931_0024584 | |||
| 1140 | Ga0373933_0041714 | |||
| 1141 | Ga0373937_0355910 | |||
| 1142 | Ga0316582_0009201 | |||
| 1143 | Ga0316582_0024164 | |||
| 1144 | Ga0316584_0002980 | |||
| 1145 | Ga0373925_0224152 | |||
| 1146 | Ga0373925_0268855 | |||
| 1147 | Ga0395899_0006954 | |||
| 1148 | Ga0395899_0007594 | |||
| 1149 | Ga0395899_0012626 | |||
| 1150 | Ga0395899_0062700 | |||
| 1151 | Ga0395900_0016874 | |||
| 1152 | Ga0395900_0047098 | |||
| 1153 | Ga0395900_0091042 | |||
| 1154 | Ga0395900_0442233 | |||
| 1155 | Ga0395898_0003612 | |||
| 1156 | Ga0395898_0053989 | |||
| 1157 | Ga0395898_0101731 | |||
| 1158 | Ga0395898_0153441 | |||
| 1159 | Ga0395905_0000001 | |||
| 1160 | Ga0395905_0057101 | |||
| 1161 | Ga0395905_0301602 | |||
| 1162 | Ga0316581_0001034 | |||
| 1163 | Ga0436364_0297591 | |||
| 1164 | Ga0436364_1307424 | |||
| 1165 | Ga0395901_0000279 | |||
| 1166 | Ga0395901_0001337 | |||
| 1167 | Ga0395901_0001993 | |||
| 1168 | Ga0395901_0004556 | |||
| 1169 | Ga0395901_0039033 | |||
| 1170 | Ga0395901_0371422 | |||
| 1171 | Ga0436365_0070120 | |||
| 1172 | Ga0436365_0643609 | |||
| 1173 | Ga0436362_0603024 | |||
| 1174 | Ga0439431_0000125 | |||
| 1175 | Ga0439449_0051961 | |||
| 1176 | Ga0466972_0001361 | |||
| 1177 | Ga0466972_0227300 | |||
| 1178 | Ga0453683_0000036 | |||
| 1179 | Ga0466965_0002217 | |||
| 1180 | Ga0466965_0005733 | |||
| 1181 | Ga0466966_0097862 | |||
| 1182 | Ga0466963_0101285 | |||
| 1183 | Ga0453684_0002808 | |||
| 1184 | Ga0453684_0058811 | |||
| 1185 | Ga0453684_0069727 | |||
| 1186 | Ga0466968_0002707 | |||
| 1187 | Ga0466957_0043195 | |||
| 1188 | Ga0466957_0195151 | |||
| 1189 | Ga0466959_0019904 | |||
| 1190 | Ga0451576_0000069 | |||
| 1191 | Ga0451576_0531037 | |||
| 1192 | Ga0466967_0013966 | |||
| 1193 | Ga0495627_006558 | |||
| 1194 | Ga0495592_0006086 | |||
| 1195 | Ga0495592_0159593 | |||
| 1196 | Ga0495603_0006449 | |||
| 1197 | Ga0495629_0034883 | |||
| 1198 | Ga0495651_0000075 | |||
| 1199 | Ga0495651_0012963 | |||
| 1200 | Ga0495653_0005508 | |||
| 1201 | Ga0495650_0000038 | |||
| 1202 | Ga0495650_0002096 | |||
| 1203 | Ga0495580_0038724 | |||
| 1204 | Ga0495580_0100457 | |||
| 1205 | Ga0495580_0113002 | |||
| 1206 | Ga0495639_0011600 | |||
| 1207 | Ga0495594_0000609 | |||
| 1208 | Ga0495594_0080085 | |||
| 1209 | Ga0495596_0011908 | |||
| 1210 | Ga0495583_0003402 | |||
| 1211 | Ga0495606_0003562 | |||
| 1212 | Ga0495606_0090662 | |||
| 1213 | Ga0495618_0183576 | |||
| 1214 | Ga0495618_0254772 | |||
| 1215 | Ga0495620_0001135 | |||
| 1216 | Ga0495628_0005563 | |||
| 1217 | Ga0495630_0061676 | |||
| 1218 | Ga0495630_0207019 | |||
| 1219 | Ga0495631_0006473 | |||
| 1220 | Ga0495631_0008024 | |||
| 1221 | Ga0495666_0038873 | |||
| 1222 | Ga0495666_0061257 | |||
| 1223 | Ga0495665_0078694 | |||
| 1224 | Ga0495640_0022054 | |||
| 1225 | Ga0495586_0005192 | |||
| 1226 | Ga0495587_0029043 | |||
| 1227 | Ga0495622_0001198 | |||
| 1228 | Ga0495633_0000022 | |||
| 1229 | Ga0495667_0000317 | |||
| 1230 | Ga0495667_0148198 | |||
| 1231 | Ga0495667_0269144 | |||
| 1232 | Ga0495656_0113829 | |||
| 1233 | Ga0495668_0003772 | |||
| 1234 | Ga0495634_0031899 | |||
| 1235 | Ga0495611_0003403 | |||
| 1236 | Ga0495625_0000814 | |||
| 1237 | Ga0495625_0002581 | |||
| 1238 | Ga0495635_0010647 | |||
| 1239 | Ga0495635_0099059 | |||
| 1240 | Ga0495661_0065068 | |||
| 1241 | Ga0495657_0002991 | |||
| 1242 | Ga0495657_0026450 | |||
| 1243 | Ga0495599_0011134 | |||
| 1244 | Ga0495647_0002103 | |||
| 1245 | Ga0495658_0007656 | |||
| 1246 | Ga0495613_0024783 | |||
| 1247 | Ga0495613_0058417 | |||
| 1248 | Ga0495624_0013917 | |||
| 1249 | Ga0495624_0018159 | |||
| 1250 | Ga0495649_0200506 | |||
| 1251 | Ga0495589_0002429 | |||
| 1252 | Ga0495581_0018224 | |||
| 1253 | Ga0495604_0008185 | |||
| 1254 | Ga0495674_0058998 | |||
| 1255 | Ga0495674_0060030 | |||
| 1256 | Ga0495674_0067190 | |||
| 1257 | Ga0495674_0195888 | |||
| 1258 | Ga0495674_0275831 | |||
| 1259 | Ga0495672_0000875 | |||
| 1260 | Ga0495676_0015768 | |||
| 1261 | Ga0495676_0051064 | |||
| 1262 | Ga0495680_0000274 | |||
| 1263 | Ga0495680_0016743 | |||
| 1264 | Ga0495680_0056700 | |||
| 1265 | Ga0495683_0002147 | |||
| 1266 | Ga0495675_0075432 | |||
| 1267 | Ga0495685_000407 | |||
| 1268 | Ga0495684_0012037 | |||
| 1269 | Ga0495686_0000737 | |||
| 1270 | Ga0495686_0009364 | |||
| 1271 | Ga0495686_0060005 | |||
| 1272 | Ga0495593_0041388 | |||
| 1273 | Ga0495602_0195313 | |||
| 1274 | Ga0495614_0012363 | |||
| 1275 | Ga0495614_0016960 | |||
| 1276 | Ga0495614_0038560 | |||
| 1277 | Ga0495626_0007110 | |||
| 1278 | Ga0496100_0128744 | |||
| 1279 | Ga0496102_0013502 | |||
| 1280 | Ga0496102_0181570 | |||
| 1281 | Ga0496103_0014765 | |||
| 1282 | Ga0496104_0008797 | |||
| 1283 | Ga0496104_0085328 | |||
| 1284 | Ga0496104_0433116 | |||
| 1285 | Ga0496105_0137184 | |||
| 1286 | Ga0496106_0063877 | |||
| 1287 | Ga0496107_0182530 | |||
| 1288 | Ga0496108_0004141 | |||
| 1289 | Ga0496108_0058414 | |||
| 1290 | Ga0496109_0003590 | |||
| 1291 | Ga0496109_0012623 | |||
| 1292 | Ga0496110_0065983 | |||
| 1293 | Ga0496110_0186228 | |||
| 1294 | Ga0496111_0013416 | |||
| 1295 | Ga0496111_0058754 | |||
| 1296 | Ga0496112_0002880 | |||
| 1297 | Ga0496112_0319835 | |||
| 1298 | Ga0496113_0000741 | |||
| 1299 | Ga0496113_0132429 | |||
| 1300 | Ga0496114_0052108 | |||
| 1301 | Ga0496114_0162071 | |||
| 1302 | Ga0496115_0005244 | |||
| 1303 | Ga0496115_0155922 | |||
| 1304 | Ga0496117_0004000 | |||
| 1305 | Ga0496118_0002784 | |||
| 1306 | Ga0496121_0000010 | |||
| 1307 | Ga0496122_0002421 | |||
| 1308 | Ga0496123_0008155 | |||
| 1309 | Ga0496126_0000020 | |||
| 1310 | Ga0501031_0133037 | |||
| 1311 | Ga0501032_0138448 | |||
| 1312 | Ga0501033_0039590 | |||
| 1313 | Ga0501033_0292938 | |||
| 1314 | Ga0501034_0003719 | |||
| 1315 | Ga0501034_0052256 | |||
| 1316 | Ga0501034_0227502 | |||
| 1317 | Ga0501036_0070283 | |||
| 1318 | Ga0501036_0115103 | |||
| 1319 | Ga0501037_0192482 | |||
| 1320 | Ga0501038_0372256 | |||
| 1321 | Ga0501040_0019566 | |||
| 1322 | Ga0501040_0026269 | |||
| 1323 | Ga0501040_0106504 | |||
| 1324 | Ga0501041_0016606 | |||
| 1325 | Ga0501042_0073414 | |||
| 1326 | Ga0501046_0176883 | |||
| 1327 | Ga0501047_0174021 | |||
| 1328 | Ga0501048_0020442 | |||
| 1329 | Ga0501067_0011567 | |||
| 1330 | Ga0501067_0041825 | |||
| 1331 | Ga0501068_0009496 | |||
| 1332 | Ga0501070_0053878 | |||
| 1333 | Ga0501072_0191820 | |||
| 1334 | Ga0501076_0003750 | |||
| 1335 | Ga0501076_0058581 | |||
| 1336 | Ga0501076_0139491 | |||
| 1337 | Ga0501077_0014567 | |||
| 1338 | Ga0501209_013208 | |||
| 1339 | Ga0501079_0016325 | |||
| 1340 | Ga0501079_0053803 | |||
| 1341 | Ga0501080_0038029 | |||
| 1342 | Ga0501080_0110650 | |||
| 1343 | Ga0501081_0011673 | |||
| 1344 | Ga0501083_0044704 | |||
| 1345 | Ga0501241_000418 | |||
| 1346 | Ga0501241_002808 | |||
| 1347 | Ga0501273_000510 | |||
| 1348 | Ga0501035_0170050 | |||
| 1349 | Ga0501044_0113523 | |||
| 1350 | Ga0501044_0223098 | |||
| 1351 | nmdc:mga05p37_391440_c1 | |||
| 1352 | nmdc:mga0qj67_16368_c1 | |||
| 1353 | nmdc:mga0qj67_323984_c1 | |||
| 1354 | nmdc:mga06r32_15049_c1 | |||
| 1355 | nmdc:mga0n895_82764_c1 | |||
| 1356 | nmdc:mga0a205_143549_c1 | |||
| 1357 | Ga0495601_0057087 | |||
| 1358 | Ga0500635_0002802 | |||
| 1359 | Ga0500643_037877 | |||
| 1360 | Ga0500644_0000240 | |||
| 1361 | Ga0500646_0005886 | |||
| 1362 | Ga0500651_0000108 | |||
| 1363 | Ga0500651_0001193 | |||
| 1364 | Ga0500569_000902 | |||
| 1365 | Ga0500642_0034757 | |||
| 1366 | Ga0500652_015058 | |||
| 1367 | Ga0500568_0038280 | |||
| 1368 | Ga0500616_0004435 | |||
| 1369 | Ga0500622_0000616 | |||
| 1370 | Ga0500636_0123366 | |||
| 1371 | Ga0501084_0023329 | |||
| 1372 | Ga0501084_0041515 | |||
| 1373 | Ga0500661_005595 | |||
| 1374 | Ga0590071_005972 | |||
| 1375 | Ga0590071_009001 | |||
| 1376 | Ga0590074_006296 | |||
| 1377 | Ga0590074_012025 | |||
| 1378 | Ga0590077_007285 | |||
| 1379 | Ga0501082_0050125 | |||
| 1380 | Ga0501082_0343186 | |||
| 1381 | Ga0530510_0040539 | |||
| 1382 | 2616701179 | |||
| 1383 | 2738758307 | |||
| 1384 | 2738763154 | |||
| 1385 | 2739303835 | |||
| 1386 | 2776616309 | |||
| 1387 | 2809228887 | |||
| 1388 | 2819571998 | |||
| 1389 | 2819677767 | |||
| 1390 | 2821141758 | |||
| 1391 | 2831906975 | |||
| 1392 | 2852629664 | |||
| 1393 | 2883073197 | |||
| 1394 | 2884797716 | |||
| 1395 | 2896114726 | |||
| 1396 | 2904469827 | |||
| 1397 | 2919191061 | |||
| 1398 | 2929183236 | |||
| 1399 | 2929245362 | |||
| 1400 | 2929927614 | |||
| 1401 | 2939669341 | |||
| 1402 | 2945979195 | |||
| 1403 | 2946014936 | |||
| 1404 | 8003151461 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9713 | 6 | 327 |
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9669 | 5 | 327 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9668 | 5 | 327 |
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9651 | 6 | 327 |
| 1ebl-assembly1.cif.gz_B | the 1.8 a crystal structure and active site architecture of beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) from escherichia coli | 0.965 | 5 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3il4B01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9834 | 5 | 171 | 3.40.47.10 |
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9787 | 5 | 171 | 3.40.47.10 |
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9646 | 5 | 327 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9643 | 5 | 329 | 3.40.47.10 |
| 1mzjA01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9609 | 5 | 167 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3EMF0-F1-model_v4 | 3-oxoacyl-ACP synthase | 1 | 245 | 329 |
GO:0016020
GO:0016746 GO:0044550 |
| AF-A0A399T4J9-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.996 | 1 | 329 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 GO:0044550 |
| AF-A0A176TEF8-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9951 | 1 | 329 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 GO:0044550 |
| AF-A0A5C8LMJ0-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9949 | 1 | 329 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 GO:0044550 |
| AF-A0A239AFL5-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9948 | 1 | 329 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 GO:0044550 |