F476258

General Info

Members Datasets Scaffolds Average Seq Length
703 274 1406 204

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101042533|Ga0070680_1010425331
Length 227
Sequence MNRKRVAVLISGRGSNMAALIEAAKDKTYPAEIAVVISNRPDAGGLMAARANGITTEVVDHTAHGKDRTAFESALQAVLEKHRIDIVCLAGFMRLLTAGFVKQWQHRILNIHPALLPAFKGLDTHRRALEAGVEVHGATVHFVVPEMDSGPIIAQAAVNVRPGDNEKDLAARVLKAEHQIYPLALKLVAEGRVNTDGDRCLIDGAPLPNTKTLAAGTIIPRCSSTGK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
117 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
218 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.55
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 12.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101042533 3300005336 Bacteria 707
2 JGI24752J21851_1004380 3300001976 Bacteria 1852
3 JGI24034J26672_10001681 3300002239 Bacteria 2974
4 JGI24751J29686_10005031 3300002459 Bacteria 2695
5 Ga0065704_10268208 3300005289 Bacteria 949
6 Ga0065715_10101096 3300005293 Bacteria 3237
7 Ga0065715_10323663 3300005293 Bacteria 990
8 Ga0070676_10006611 3300005328 Bacteria 6201
9 Ga0070683_100066179 3300005329 Unclassified 3366
10 Ga0070683_100143766 3300005329 Bacteria 2260
11 Ga0070690_100481731 3300005330 Bacteria 925
12 Ga0070670_100003141 3300005331 Bacteria 13665
13 Ga0070670_100093759 3300005331 Bacteria 2582
14 Ga0068869_100005138 3300005334 Bacteria 8207
15 Ga0068869_100226506 3300005334 Bacteria 1484
16 Ga0070680_100032188 3300005336 Bacteria 4220
17 Ga0070680_100173161 3300005336 Unclassified 1817
18 Ga0070680_100174046 3300005336 Unclassified 1812
19 Ga0070680_100750231 3300005336 Bacteria 840
20 Ga0070682_100075621 3300005337 Bacteria 2166
21 Ga0070682_100230916 3300005337 Unclassified 1322
22 Ga0068868_100002767 3300005338 Bacteria 12151
23 Ga0068868_100004502 3300005338 Bacteria 9781
24 Ga0068868_100035727 3300005338 Bacteria 3843
25 Ga0068868_100105114 3300005338 Bacteria 2289
26 Ga0070660_100005413 3300005339 Bacteria 8839
27 Ga0070689_100013667 3300005340 Bacteria 5879
28 Ga0070691_10060474 3300005341 Bacteria 1821
29 Ga0070691_10103441 3300005341 Bacteria 1417
30 Ga0070691_10248875 3300005341 Bacteria 952
31 Ga0070687_100576395 3300005343 Unclassified 769
32 Ga0070661_100003838 3300005344 Bacteria 10344
33 Ga0070661_100101243 3300005344 Bacteria 2143
34 Ga0070669_100053790 3300005353 Bacteria 2947
35 Ga0070675_100019034 3300005354 Bacteria 5470
36 Ga0070675_100206304 3300005354 Unclassified 1707
37 Ga0070671_100211690 3300005355 Bacteria 1644
38 Ga0070671_100551979 3300005355 Unclassified 993
39 Ga0070671_101112376 3300005355 Unclassified 694
40 Ga0070674_100110215 3300005356 Bacteria 2020
41 Ga0070673_100090318 3300005364 Bacteria 2502
42 Ga0070688_100055667 3300005365 Bacteria 2481
43 Ga0070659_100115862 3300005366 Unclassified 2166
44 Ga0070659_100159911 3300005366 Bacteria 1841
45 Ga0070659_100293491 3300005366 Bacteria 1354
46 Ga0070667_100290452 3300005367 Bacteria 1470
47 Ga0070709_10000684 3300005434 Bacteria 19264
48 Ga0070709_10014685 3300005434 Bacteria 4433
49 Ga0070709_10017575 3300005434 Bacteria 4104
50 Ga0070709_10162061 3300005434 Bacteria 1556
51 Ga0070709_10411343 3300005434 Bacteria 1012
52 Ga0070709_10450133 3300005434 Bacteria 970
53 Ga0070714_100055630 3300005435 Bacteria 3382
54 Ga0070714_100486716 3300005435 Bacteria 1175
55 Ga0070714_100501343 3300005435 Archaea 1158
56 Ga0070714_100685591 3300005435 Bacteria 988
57 Ga0070713_100000029 3300005436 Bacteria 90705
58 Ga0070713_100188193 3300005436 Bacteria 1859
59 Ga0070713_100268059 3300005436 Unclassified 1563
60 Ga0070713_100299546 3300005436 Bacteria 1480
61 Ga0070713_100331204 3300005436 Bacteria 1408
62 Ga0070713_100401097 3300005436 Unclassified 1281
63 Ga0070713_100436288 3300005436 Bacteria 1228
64 Ga0070713_100501702 3300005436 Bacteria 1145
65 Ga0070710_10000350 3300005437 Bacteria 21784
66 Ga0070710_10002217 3300005437 Bacteria 9174
67 Ga0070710_10047517 3300005437 Unclassified 2394
68 Ga0070710_10084895 3300005437 Unclassified 1856
69 Ga0070710_10100815 3300005437 Bacteria 1719
70 Ga0070710_10110246 3300005437 Bacteria 1652
71 Ga0070710_10172039 3300005437 Bacteria 1350
72 Ga0070711_100002974 3300005439 Bacteria 9780
73 Ga0070711_100019314 3300005439 Bacteria 4371
74 Ga0070711_100024338 3300005439 Bacteria 3949
75 Ga0070711_100106327 3300005439 Bacteria 2051
76 Ga0070711_100162903 3300005439 Unclassified 1692
77 Ga0070705_100167177 3300005440 Unclassified 1476
78 Ga0070705_100607166 3300005440 Bacteria 847
79 Ga0070694_100316251 3300005444 Bacteria 1200
80 Ga0070708_100000137 3300005445 Bacteria 50233
81 Ga0070708_100003186 3300005445 Bacteria 12789
82 Ga0070708_100008541 3300005445 Bacteria 8230
83 Ga0070708_100016509 3300005445 Bacteria 6129
84 Ga0070708_100738470 3300005445 Unclassified 926
85 Ga0070708_100821693 3300005445 Bacteria 873
86 Ga0070663_100129293 3300005455 Bacteria 1916
87 Ga0070678_100627004 3300005456 Unclassified 962
88 Ga0070662_100034349 3300005457 Unclassified 3575
89 Ga0070681_10000516 3300005458 Bacteria 31602
90 Ga0070681_10090637 3300005458 Bacteria 3007
91 Ga0070681_10129925 3300005458 Unclassified 2451
92 Ga0070681_10171893 3300005458 Bacteria 2089
93 Ga0070681_10220514 3300005458 Bacteria 1812
94 Ga0068867_100010239 3300005459 Bacteria 6615
95 Ga0068867_100025087 3300005459 Bacteria 4276
96 Ga0070706_100000430 3300005467 Bacteria 50312
97 Ga0070706_100029741 3300005467 Bacteria 5032
98 Ga0070706_100053272 3300005467 Bacteria 3734
99 Ga0070706_100199116 3300005467 Bacteria 1871
100 Ga0070707_100000651 3300005468 Bacteria 34704
101 Ga0070707_100029389 3300005468 Bacteria 5233
102 Ga0070707_100460296 3300005468 Unclassified 1233
103 Ga0070707_100531127 3300005468 Bacteria 1138
104 Ga0070698_100000012 3300005471 Bacteria 116260
105 Ga0070698_100028467 3300005471 Bacteria 5803
106 Ga0070698_100061897 3300005471 Bacteria 3777
107 Ga0070698_100809689 3300005471 Unclassified 881
108 Ga0070699_100000439 3300005518 Bacteria 39981
109 Ga0070699_100006190 3300005518 Bacteria 10454
110 Ga0070699_100006417 3300005518 Bacteria 10244
111 Ga0070699_100147535 3300005518 Bacteria 2079
112 Ga0070699_100426291 3300005518 Bacteria 1201
113 Ga0070679_100007084 3300005530 Bacteria 10462
114 Ga0070679_100008832 3300005530 Bacteria 9508
115 Ga0070679_100080649 3300005530 Unclassified 3243
116 Ga0070679_100102971 3300005530 Unclassified 2841
117 Ga0070679_100463706 3300005530 Bacteria 1211
118 Ga0070684_100004173 3300005535 Bacteria 10946
119 Ga0070684_100019796 3300005535 Bacteria 5573
120 Ga0070684_100020544 3300005535 Bacteria 5478
121 Ga0070697_100000415 3300005536 Bacteria 32903
122 Ga0070697_100000873 3300005536 Bacteria 22668
123 Ga0070697_100008695 3300005536 Bacteria 7930
124 Ga0070697_100011527 3300005536 Bacteria 6908
125 Ga0070697_100012935 3300005536 Bacteria 6539
126 Ga0070697_100021163 3300005536 Bacteria 5152
127 Ga0068853_100004532 3300005539 Bacteria 10780
128 Ga0068853_100307448 3300005539 Unclassified 1467
129 Ga0068853_100439938 3300005539 Bacteria 1225
130 Ga0068853_100668686 3300005539 Unclassified 989
131 Ga0070672_100061407 3300005543 Bacteria 2962
132 Ga0070686_100002933 3300005544 Bacteria 9360
133 Ga0070686_100106476 3300005544 Bacteria 1903
134 Ga0070686_100197851 3300005544 Bacteria 1439
135 Ga0070695_100011271 3300005545 Bacteria 5346
136 Ga0070695_100170231 3300005545 Bacteria 1536
137 Ga0070695_100179811 3300005545 Unclassified 1498
138 Ga0070696_100019055 3300005546 Bacteria 4645
139 Ga0070696_100137431 3300005546 Bacteria 1783
140 Ga0070693_100007313 3300005547 Bacteria 5393
141 Ga0070693_100053281 3300005547 Unclassified 2322
142 Ga0070693_100106561 3300005547 Bacteria 1716
143 Ga0070665_100015058 3300005548 Bacteria 7763
144 Ga0068855_100001369 3300005563 Bacteria 30177
145 Ga0068855_100028469 3300005563 Bacteria 6683
146 Ga0068855_100036304 3300005563 Bacteria 5867
147 Ga0068855_100169971 3300005563 Bacteria 2469
148 Ga0070664_100000897 3300005564 Bacteria 23165
149 Ga0070664_100121885 3300005564 Bacteria 2284
150 Ga0070664_100221215 3300005564 Bacteria 1694
151 Ga0068857_100000335 3300005577 Bacteria 32411
152 Ga0068857_100002120 3300005577 Bacteria 16140
153 Ga0068857_100028064 3300005577 Unclassified 4965
154 Ga0068854_100028909 3300005578 Bacteria 3834
155 Ga0068854_100250875 3300005578 Unclassified 1413
156 Ga0068856_100000995 3300005614 Bacteria 30196
157 Ga0068856_100001225 3300005614 Bacteria 26895
158 Ga0068856_100002789 3300005614 Bacteria 17882
159 Ga0068856_100015031 3300005614 Bacteria 7475
160 Ga0068856_100025696 3300005614 Bacteria 5742
161 Ga0068856_100203177 3300005614 Bacteria 1996
162 Ga0070702_100003077 3300005615 Bacteria 7384
163 Ga0070702_100687374 3300005615 Bacteria 778
164 Ga0068852_100029488 3300005616 Unclassified 4509
165 Ga0068852_100366305 3300005616 Bacteria 1411
166 Ga0068859_100002226 3300005617 Bacteria 19660
167 Ga0068859_100029564 3300005617 Bacteria 5498
168 Ga0068859_100175829 3300005617 Bacteria 2222
169 Ga0068864_100012155 3300005618 Bacteria 7115
170 Ga0068864_100015408 3300005618 Bacteria 6357
171 Ga0068866_10016713 3300005718 Bacteria 3286
172 Ga0068866_10035742 3300005718 Bacteria 2429
173 Ga0068866_10175516 3300005718 Bacteria 1261
174 Ga0068866_10325525 3300005718 Bacteria 968
175 Ga0068870_10000328 3300005840 Bacteria 17644
176 Ga0068863_100046300 3300005841 Bacteria 4128
177 Ga0068863_100197031 3300005841 Bacteria 1936
178 Ga0068858_100000404 3300005842 Bacteria 44997
179 Ga0068858_100008344 3300005842 Bacteria 9966
180 Ga0068858_100028323 3300005842 Bacteria 5205
181 Ga0068858_100038311 3300005842 Unclassified 4447
182 Ga0068858_100038858 3300005842 Bacteria 4414
183 Ga0068858_100775799 3300005842 Unclassified 935
184 Ga0068860_100028876 3300005843 Bacteria 5336
185 Ga0068860_100109033 3300005843 Unclassified 2646
186 Ga0068860_100213112 3300005843 Bacteria 1874
187 Ga0068862_100067378 3300005844 Bacteria 3086
188 Ga0068862_100369143 3300005844 Bacteria 1335
189 Ga0081455_10000009 3300005937 Bacteria 249885
190 Ga0081540_1064851 3300005983 Bacteria 1721
191 Ga0070717_10002369 3300006028 Bacteria 13286
192 Ga0070717_10005102 3300006028 Bacteria 9577
193 Ga0070717_10022289 3300006028 Bacteria 5003
194 Ga0070717_10064615 3300006028 Bacteria 3040
195 Ga0070717_10138497 3300006028 Bacteria 2098
196 Ga0070717_10171508 3300006028 Bacteria 1887
197 Ga0070717_10177690 3300006028 Bacteria 1854
198 Ga0070717_10202686 3300006028 Bacteria 1738
199 Ga0070717_10217598 3300006028 Bacteria 1678
200 Ga0070717_10491849 3300006028 Unclassified 1108
201 Ga0070717_10560282 3300006028 Bacteria 1035
202 Ga0070717_10613355 3300006028 Bacteria 987
203 Ga0070717_10866679 3300006028 Unclassified 822
204 Ga0070715_10000381 3300006163 Bacteria 11109
205 Ga0070715_10007977 3300006163 Bacteria 3669
206 Ga0070715_10036628 3300006163 Bacteria 2025
207 Ga0070716_100001342 3300006173 Bacteria 10893
208 Ga0070716_100011095 3300006173 Bacteria 4534
209 Ga0070716_100019252 3300006173 Bacteria 3565
210 Ga0070716_100023139 3300006173 Bacteria 3291
211 Ga0070716_100056000 3300006173 Bacteria 2259
212 Ga0070716_100110239 3300006173 Bacteria 1704
213 Ga0070716_100139600 3300006173 Bacteria 1543
214 Ga0070716_100177179 3300006173 Unclassified 1396
215 Ga0070716_100296451 3300006173 Bacteria 1123
216 Ga0070716_100328682 3300006173 Bacteria 1074
217 Ga0070716_100475985 3300006173 Bacteria 916
218 Ga0070712_100000080 3300006175 Bacteria 49781
219 Ga0070712_100000123 3300006175 Bacteria 40899
220 Ga0070712_100006237 3300006175 Bacteria 7383
221 Ga0070712_100022903 3300006175 Bacteria 4119
222 Ga0070712_100030592 3300006175 Bacteria 3620
223 Ga0070712_100059492 3300006175 Bacteria 2691
224 Ga0070712_101004081 3300006175 Bacteria 722
225 Ga0097621_100000866 3300006237 Bacteria 21263
226 Ga0097621_100002200 3300006237 Bacteria 13355
227 Ga0097621_100032652 3300006237 Bacteria 4140
228 Ga0097621_100107058 3300006237 Bacteria 2359
229 Ga0097621_100641236 3300006237 Bacteria 974
230 Ga0097621_100871823 3300006237 Unclassified 837
231 Ga0097621_100898469 3300006237 Bacteria 825
232 Ga0068871_100000389 3300006358 Bacteria 30917
233 Ga0068871_100000941 3300006358 Bacteria 19435
234 Ga0068871_100039295 3300006358 Bacteria 3785
235 Ga0068871_100058016 3300006358 Bacteria 3151
236 Ga0068871_100061555 3300006358 Bacteria 3066
237 Ga0068871_100170932 3300006358 Bacteria 1863
238 Ga0068871_100185193 3300006358 Bacteria 1791
239 Ga0068871_100612100 3300006358 Bacteria 991
240 Ga0068871_100797135 3300006358 Bacteria 870
241 Ga0075434_100001903 3300006871 Bacteria 18086
242 Ga0075434_100026500 3300006871 Bacteria 5680
243 Ga0075434_100047111 3300006871 Bacteria 4279
244 Ga0075434_100174639 3300006871 Bacteria 2168
245 Ga0068865_100020197 3300006881 Bacteria 4319
246 Ga0068865_100022098 3300006881 Bacteria 4144
247 Ga0068865_100174857 3300006881 Unclassified 1649
248 Ga0075436_100053462 3300006914 Bacteria 2788
249 Ga0075436_100086600 3300006914 Bacteria 2176
250 Ga0097620_100002226 3300006931 Bacteria 19660
251 Ga0097620_100029564 3300006931 Bacteria 5498
252 Ga0097620_100175833 3300006931 Bacteria 2222
253 Ga0075435_100009445 3300007076 Bacteria 7062
254 Ga0105240_10052198 3300009093 Bacteria 5141
255 Ga0105240_10261769 3300009093 Bacteria 1995
256 Ga0105240_11082666 3300009093 Bacteria 854
257 Ga0111539_10003123 3300009094 Bacteria 21932
258 Ga0105245_10068088 3300009098 Bacteria 3225
259 Ga0105245_10165523 3300009098 Bacteria 2102
260 Ga0105245_10308614 3300009098 Unclassified 1555
261 Ga0105247_10004769 3300009101 Bacteria 8635
262 Ga0105247_10327847 3300009101 Bacteria 1070
263 Ga0114129_10064122 3300009147 Bacteria 5127
264 Ga0105243_10187527 3300009148 Bacteria 1804
265 Ga0105241_10004936 3300009174 Bacteria 9837
266 Ga0105241_10045416 3300009174 Bacteria 3333
267 Ga0105241_10152795 3300009174 Bacteria 1890
268 Ga0105241_10196146 3300009174 Bacteria 1683
269 Ga0105242_10034283 3300009176 Bacteria 4069
270 Ga0105242_10070111 3300009176 Bacteria 2906
271 Ga0105242_10143933 3300009176 Unclassified 2072
272 Ga0105242_11036693 3300009176 Bacteria 830
273 Ga0105248_10005502 3300009177 Bacteria 13908
274 Ga0105248_10020606 3300009177 Bacteria 7308
275 Ga0105248_10290061 3300009177 Bacteria 1842
276 Ga0105248_10409716 3300009177 Bacteria 1526
277 Ga0105237_10087833 3300009545 Bacteria 3098
278 Ga0105237_10187014 3300009545 Bacteria 2071
279 Ga0105237_10281058 3300009545 Bacteria 1667
280 Ga0105237_10361211 3300009545 Bacteria 1456
281 Ga0105238_10000214 3300009551 Bacteria 64373
282 Ga0105238_10030478 3300009551 Bacteria 5491
283 Ga0105238_10081927 3300009551 Bacteria 3217
284 Ga0105238_10154526 3300009551 Bacteria 2269
285 Ga0105238_10484296 3300009551 Bacteria 1237
286 Ga0105249_10768564 3300009553 Unclassified 1026
287 Ga0099796_10339234 3300010159 Bacteria 645
288 Ga0105239_10009275 3300010375 Bacteria 11123
289 Ga0105239_10012476 3300010375 Bacteria 9464
290 Ga0105239_10113314 3300010375 Unclassified 3007
291 Ga0105239_10145264 3300010375 Bacteria 2645
292 Ga0105239_10187037 3300010375 Bacteria 2318
293 Ga0105239_10464747 3300010375 Bacteria 1436
294 Ga0105246_10000514 3300011119 Bacteria 21093
295 Ga0105246_10444858 3300011119 Unclassified 1087
296 Ga0105246_10573407 3300011119 Bacteria 971
297 Ga0157373_10004305 3300013100 Bacteria 10717
298 Ga0157373_10010474 3300013100 Bacteria 6820
299 Ga0157373_10047333 3300013100 Bacteria 3067
300 Ga0157371_10050683 3300013102 Unclassified 2950
301 Ga0157371_10271441 3300013102 Bacteria 1224
302 Ga0157370_10111394 3300013104 Bacteria 2558
303 Ga0157370_10380889 3300013104 Unclassified 1299
304 Ga0157369_10001356 3300013105 Bacteria 30251
305 Ga0157369_10020633 3300013105 Bacteria 7368
306 Ga0157369_10065831 3300013105 Bacteria 3900
307 Ga0157369_10072253 3300013105 Unclassified 3703
308 Ga0157369_10407541 3300013105 Bacteria 1410
309 Ga0157374_10000634 3300013296 Bacteria 30935
310 Ga0157374_10002242 3300013296 Bacteria 16283
311 Ga0157374_10003412 3300013296 Bacteria 13346
312 Ga0157374_10015250 3300013296 Bacteria 6739
313 Ga0157374_10024622 3300013296 Bacteria 5397
314 Ga0157374_10032440 3300013296 Bacteria 4755
315 Ga0157378_10000202 3300013297 Bacteria 58070
316 Ga0157378_10000725 3300013297 Bacteria 30797
317 Ga0157378_10028193 3300013297 Bacteria 4952
318 Ga0157378_10070322 3300013297 Bacteria 3142
319 Ga0157378_10411851 3300013297 Bacteria 1334
320 Ga0157378_10480048 3300013297 Bacteria 1238
321 Ga0163162_10042351 3300013306 Bacteria 4557
322 Ga0163162_10046852 3300013306 Bacteria 4334
323 Ga0163162_10146046 3300013306 Bacteria 2482
324 Ga0163162_10749838 3300013306 Bacteria 1096
325 Ga0157372_10001366 3300013307 Bacteria 26403
326 Ga0157372_10001445 3300013307 Bacteria 25697
327 Ga0157372_10004574 3300013307 Bacteria 14720
328 Ga0157372_10018291 3300013307 Bacteria 7532
329 Ga0157372_10060462 3300013307 Bacteria 4240
330 Ga0157372_10108472 3300013307 Bacteria 3177
331 Ga0157372_10188691 3300013307 Bacteria 2387
332 Ga0157372_10981391 3300013307 Unclassified 979
333 Ga0157375_10044023 3300013308 Bacteria 4332
334 Ga0157375_10071884 3300013308 Bacteria 3474
335 Ga0157375_10377031 3300013308 Bacteria 1585
336 Ga0163163_10025828 3300014325 Bacteria 5603
337 Ga0163163_10065407 3300014325 Bacteria 3609
338 Ga0163163_10435877 3300014325 Bacteria 1370
339 Ga0163163_10469040 3300014325 Bacteria 1320
340 Ga0163163_10650058 3300014325 Bacteria 1118
341 Ga0163163_10669050 3300014325 Bacteria 1102
342 Ga0157380_10058096 3300014326 Bacteria 3083
343 Ga0157377_10001169 3300014745 Bacteria 11142
344 Ga0157379_10002808 3300014968 Bacteria 14676
345 Ga0157379_10052468 3300014968 Bacteria 3643
346 Ga0157379_10069123 3300014968 Bacteria 3158
347 Ga0157379_10375187 3300014968 Bacteria 1304
348 Ga0157376_10006530 3300014969 Bacteria 8248
349 Ga0157376_10033462 3300014969 Bacteria 4139
350 Ga0157376_10046292 3300014969 Bacteria 3587
351 Ga0157376_10076500 3300014969 Bacteria 2860
352 Ga0157376_10105250 3300014969 Bacteria 2474
353 Ga0157376_10155838 3300014969 Bacteria 2065
354 Ga0157376_10286698 3300014969 Unclassified 1553
355 Ga0157376_10633027 3300014969 Bacteria 1068
356 Ga0182006_1184326 3300015261 Viruses 695
357 Ga0182007_10004903 3300015262 Bacteria 5975
358 Ga0163161_10006648 3300017792 Bacteria 8004
359 Ga0154015_1022330 3300020610 Bacteria 1286
360 Ga0213871_10051565 3300021441 Bacteria 1129
361 Ga0224572_1000226 3300024225 Bacteria 5572
362 Ga0224572_1007351 3300024225 Bacteria 2017
363 Ga0228598_1000004 3300024227 Bacteria 30534
364 Ga0228598_1029151 3300024227 Unclassified 1085
365 Ga0207697_10002002 3300025315 Bacteria 10794
366 Ga0207656_10028796 3300025321 Bacteria 2283
367 Ga0207656_10050858 3300025321 Unclassified 1791
368 Ga0207692_10000653 3300025898 Bacteria 12208
369 Ga0207692_10007191 3300025898 Bacteria 4548
370 Ga0207692_10028517 3300025898 Bacteria 2642
371 Ga0207692_10094955 3300025898 Bacteria 1625
372 Ga0207642_10034430 3300025899 Bacteria 2154
373 Ga0207642_10047757 3300025899 Bacteria 1915
374 Ga0207710_10032121 3300025900 Bacteria 2299
375 Ga0207688_10002641 3300025901 Bacteria 9698
376 Ga0207680_10003203 3300025903 Bacteria 7695
377 Ga0207647_10002678 3300025904 Bacteria 13433
378 Ga0207647_10042767 3300025904 Bacteria 2840
379 Ga0207685_10003391 3300025905 Bacteria 3866
380 Ga0207685_10021909 3300025905 Bacteria 2150
381 Ga0207685_10103691 3300025905 Unclassified 1221
382 Ga0207699_10000501 3300025906 Bacteria 19563
383 Ga0207699_10011356 3300025906 Bacteria 4496
384 Ga0207699_10215155 3300025906 Bacteria 1309
385 Ga0207699_10228549 3300025906 Bacteria 1273
386 Ga0207645_10008976 3300025907 Bacteria 6942
387 Ga0207643_10004729 3300025908 Bacteria 7305
388 Ga0207684_10002258 3300025910 Bacteria 19627
389 Ga0207684_10003707 3300025910 Bacteria 14797
390 Ga0207684_10007707 3300025910 Bacteria 9648
391 Ga0207684_10174921 3300025910 Bacteria 1851
392 Ga0207654_10016907 3300025911 Bacteria 3807
393 Ga0207707_10020369 3300025912 Bacteria 5791
394 Ga0207707_10040127 3300025912 Unclassified 4090
395 Ga0207707_10040331 3300025912 Bacteria 4077
396 Ga0207707_10065433 3300025912 Bacteria 3167
397 Ga0207707_10141544 3300025912 Bacteria 2103
398 Ga0207707_10456775 3300025912 Bacteria 1093
399 Ga0207695_10031007 3300025913 Bacteria 5876
400 Ga0207695_10031164 3300025913 Bacteria 5855
401 Ga0207695_10032754 3300025913 Bacteria 5682
402 Ga0207695_10241769 3300025913 Bacteria 1706
403 Ga0207671_10156223 3300025914 Bacteria 1764
404 Ga0207671_10269368 3300025914 Bacteria 1341
405 Ga0207693_10000031 3300025915 Bacteria 117500
406 Ga0207693_10004486 3300025915 Bacteria 11807
407 Ga0207693_10005596 3300025915 Bacteria 10444
408 Ga0207693_10020239 3300025915 Bacteria 5293
409 Ga0207693_10020971 3300025915 Bacteria 5195
410 Ga0207693_10077881 3300025915 Bacteria 2595
411 Ga0207693_10170497 3300025915 Bacteria 1714
412 Ga0207663_10005262 3300025916 Bacteria 6515
413 Ga0207663_10016739 3300025916 Bacteria 4073
414 Ga0207663_10062130 3300025916 Bacteria 2373
415 Ga0207663_10132228 3300025916 Unclassified 1726
416 Ga0207663_10236815 3300025916 Bacteria 1337
417 Ga0207663_10394014 3300025916 Bacteria 1058
418 Ga0207660_10026216 3300025917 Bacteria 3967
419 Ga0207660_10134220 3300025917 Bacteria 1887
420 Ga0207660_10157767 3300025917 Bacteria 1748
421 Ga0207660_10317927 3300025917 Bacteria 1243
422 Ga0207662_10015656 3300025918 Bacteria 4269
423 Ga0207657_10008967 3300025919 Bacteria 10105
424 Ga0207657_10504546 3300025919 Bacteria 948
425 Ga0207649_10000250 3300025920 Bacteria 43495
426 Ga0207649_10155414 3300025920 Bacteria 1580
427 Ga0207652_10020896 3300025921 Bacteria 5397
428 Ga0207652_10022027 3300025921 Bacteria 5266
429 Ga0207652_10075129 3300025921 Bacteria 2944
430 Ga0207646_10000287 3300025922 Bacteria 69461
431 Ga0207646_10000494 3300025922 Bacteria 52791
432 Ga0207646_11084176 3300025922 Bacteria 705
433 Ga0207681_10105708 3300025923 Bacteria 2038
434 Ga0207694_10002173 3300025924 Bacteria 16132
435 Ga0207694_10130803 3300025924 Bacteria 2011
436 Ga0207694_10528084 3300025924 Bacteria 989
437 Ga0207650_10000124 3300025925 Bacteria 97031
438 Ga0207650_10013750 3300025925 Bacteria 5613
439 Ga0207659_10304291 3300025926 Bacteria 1310
440 Ga0207687_10289374 3300025927 Unclassified 1316
441 Ga0207700_10060720 3300025928 Bacteria 2864
442 Ga0207700_10067806 3300025928 Bacteria 2733
443 Ga0207700_10142058 3300025928 Bacteria 1974
444 Ga0207700_10225249 3300025928 Unclassified 1592
445 Ga0207700_10440943 3300025928 Bacteria 1146
446 Ga0207700_10453820 3300025928 Unclassified 1130
447 Ga0207700_10622400 3300025928 Bacteria 961
448 Ga0207700_10637181 3300025928 Bacteria 950
449 Ga0207700_10663755 3300025928 Bacteria 930
450 Ga0207700_11081414 3300025928 Bacteria 717
451 Ga0207664_10082439 3300025929 Bacteria 2619
452 Ga0207664_10165309 3300025929 Bacteria 1890
453 Ga0207664_10314376 3300025929 Archaea 1381
454 Ga0207664_10611545 3300025929 Bacteria 979
455 Ga0207644_10051351 3300025931 Bacteria 2959
456 Ga0207644_10326795 3300025931 Unclassified 1241
457 Ga0207644_10432849 3300025931 Bacteria 1079
458 Ga0207690_10021654 3300025932 Bacteria 3989
459 Ga0207690_10241291 3300025932 Bacteria 1392
460 Ga0207706_10007858 3300025933 Bacteria 9845
461 Ga0207706_10051928 3300025933 Unclassified 3620
462 Ga0207686_10033468 3300025934 Bacteria 3069
463 Ga0207686_10156751 3300025934 Bacteria 1591
464 Ga0207686_10170933 3300025934 Unclassified 1533
465 Ga0207670_10001940 3300025936 Bacteria 10836
466 Ga0207704_10035737 3300025938 Unclassified 2851
467 Ga0207704_10052508 3300025938 Bacteria 2472
468 Ga0207665_10000091 3300025939 Bacteria 58755
469 Ga0207665_10011166 3300025939 Bacteria 5894
470 Ga0207665_10020925 3300025939 Bacteria 4299
471 Ga0207665_10023087 3300025939 Bacteria 4098
472 Ga0207665_10034513 3300025939 Bacteria 3356
473 Ga0207665_10122246 3300025939 Bacteria 1840
474 Ga0207665_10174462 3300025939 Bacteria 1554
475 Ga0207665_10181882 3300025939 Unclassified 1523
476 Ga0207665_10219595 3300025939 Bacteria 1392
477 Ga0207665_10317707 3300025939 Bacteria 1168
478 Ga0207691_10017083 3300025940 Bacteria 6884
479 Ga0207711_10011891 3300025941 Bacteria 7235
480 Ga0207711_10108257 3300025941 Bacteria 2469
481 Ga0207689_10002848 3300025942 Bacteria 15961
482 Ga0207689_10004365 3300025942 Bacteria 12868
483 Ga0207689_10130513 3300025942 Unclassified 2068
484 Ga0207661_10001369 3300025944 Bacteria 16357
485 Ga0207661_10114002 3300025944 Bacteria 2291
486 Ga0207679_10000651 3300025945 Bacteria 23234
487 Ga0207679_10001734 3300025945 Bacteria 13580
488 Ga0207679_10076039 3300025945 Bacteria 2550
489 Ga0207667_10002400 3300025949 Bacteria 23462
490 Ga0207667_10002495 3300025949 Bacteria 22930
491 Ga0207667_10223122 3300025949 Bacteria 1931
492 Ga0207651_10002544 3300025960 Bacteria 8712
493 Ga0207651_10074399 3300025960 Bacteria 2419
494 Ga0207712_10268239 3300025961 Unclassified 1387
495 Ga0207640_10094344 3300025981 Unclassified 2081
496 Ga0207640_10102254 3300025981 Bacteria 2012
497 Ga0207640_10875253 3300025981 Bacteria 783
498 Ga0207658_10023861 3300025986 Bacteria 4273
499 Ga0207677_10010671 3300026023 Bacteria 5206
500 Ga0207677_10014343 3300026023 Bacteria 4625
501 Ga0207703_10002963 3300026035 Bacteria 14394
502 Ga0207703_10032127 3300026035 Unclassified 4154
503 Ga0207703_10045456 3300026035 Bacteria 3532
504 Ga0207703_10173678 3300026035 Bacteria 1897
505 Ga0207639_10065578 3300026041 Bacteria 2819
506 Ga0207639_10396376 3300026041 Bacteria 1243
507 Ga0207678_10002295 3300026067 Bacteria 17319
508 Ga0207702_10000866 3300026078 Bacteria 31529
509 Ga0207702_10001116 3300026078 Bacteria 27436
510 Ga0207702_10001193 3300026078 Bacteria 26376
511 Ga0207702_10082259 3300026078 Bacteria 2799
512 Ga0207702_10111443 3300026078 Bacteria 2433
513 Ga0207641_10000006 3300026088 Bacteria 442569
514 Ga0207641_10016516 3300026088 Bacteria 6045
515 Ga0207648_10006340 3300026089 Bacteria 11763
516 Ga0207648_10022758 3300026089 Bacteria 5623
517 Ga0207648_10038004 3300026089 Bacteria 4237
518 Ga0207648_10169702 3300026089 Bacteria 1928
519 Ga0207648_11124999 3300026089 Bacteria 737
520 Ga0207676_10000272 3300026095 Bacteria 44817
521 Ga0207676_10007844 3300026095 Bacteria 7591
522 Ga0207676_10010511 3300026095 Bacteria 6594
523 Ga0207674_10000269 3300026116 Bacteria 65505
524 Ga0207674_10001665 3300026116 Bacteria 28586
525 Ga0207674_10037557 3300026116 Bacteria 5036
526 Ga0207683_10018880 3300026121 Bacteria 5882
527 Ga0207698_10185130 3300026142 Bacteria 1849
528 Ga0209968_1009117 3300027526 Bacteria 1516
529 Ga0209983_1018086 3300027665 Bacteria 1462
530 Ga0209971_1006511 3300027682 Bacteria 2763
531 Ga0209966_1002417 3300027695 Bacteria 3116
532 Ga0209974_10002204 3300027876 Bacteria 7105
533 Ga0268266_10010563 3300028379 Bacteria 8056
534 Ga0268265_10041883 3300028380 Bacteria 3393
535 Ga0268265_10210879 3300028380 Bacteria 1692
536 Ga0268264_10012015 3300028381 Bacteria 7128
537 Ga0268264_10016431 3300028381 Bacteria 6059
538 Ga0268264_10118272 3300028381 Bacteria 2332
539 Ga0265338_10024280 3300028800 Bacteria 6197
540 Ga0265338_10071947 3300028800 Bacteria 2954
541 Ga0265338_10100690 3300028800 Bacteria 2355
542 Ga0265338_10128008 3300028800 Unclassified 2011
543 Ga0265760_10001390 3300031090 Bacteria 7105
544 Ga0265760_10006244 3300031090 Bacteria 3410
545 Ga0265760_10010918 3300031090 Bacteria 2594
546 Ga0265760_10048693 3300031090 Bacteria 1273
547 Ga0265332_10021977 3300031238 Unclassified 2816
548 Ga0265332_10126292 3300031238 Unclassified 1074
549 Ga0265328_10008690 3300031239 Bacteria 4172
550 Ga0265328_10127792 3300031239 Unclassified 950
551 Ga0265325_10004607 3300031241 Bacteria 8662
552 Ga0265325_10044346 3300031241 Bacteria 2316
553 Ga0265340_10003611 3300031247 Bacteria 8703
554 Ga0265340_10065504 3300031247 Bacteria 1730
555 Ga0265339_10006590 3300031249 Bacteria 7605
556 Ga0265339_10007921 3300031249 Bacteria 6814
557 Ga0265339_10060245 3300031249 Bacteria 2046
558 Ga0265331_10055613 3300031250 Unclassified 1881
559 Ga0265327_10025154 3300031251 Bacteria 3478
560 Ga0265316_10002094 3300031344 Bacteria 20982
561 Ga0265316_10032659 3300031344 Bacteria 4246
562 Ga0265313_10010672 3300031595 Bacteria 5784
563 Ga0265314_10001915 3300031711 Bacteria 22231
564 Ga0265314_10068136 3300031711 Unclassified 2394
565 Ga0265342_10164438 3300031712 Unclassified 1225
566 Ga0316214_1006969 3300033545 Bacteria 1502
567 Ga0373926_0026115 3300035083 Bacteria 2042
568 Ga0373929_0052752 3300035085 Bacteria 933
569 Ga0373923_0095978 3300035111 Bacteria 1302
570 Ga0373936_0030981 3300035113 Unclassified 2111
571 Ga0373936_0225788 3300035113 Bacteria 832
572 Ga0373956_0159370 3300035119 Bacteria 1063
573 Ga0373943_0005123 3300035170 Bacteria 5898
574 Ga0373943_0020892 3300035170 Bacteria 3022
575 Ga0373943_0045269 3300035170 Bacteria 2144
576 Ga0373943_0152326 3300035170 Bacteria 1253
577 Ga0373943_0337746 3300035170 Bacteria 861
578 Ga0373946_0147649 3300035171 Unclassified 1095
579 Ga0373961_0017354 3300035241 Bacteria 1866
580 Ga0373935_0003300 3300035692 Bacteria 9337
581 Ga0373935_0044471 3300035692 Bacteria 2798
582 Ga0373927_0019005 3300035695 Bacteria 4508
583 Ga0373927_0071047 3300035695 Unclassified 2253
584 Ga0373927_0119356 3300035695 Bacteria 1721
585 Ga0373927_0236670 3300035695 Bacteria 1200
586 Ga0373933_0037987 3300035724 Bacteria 2828
587 Ga0373947_0005953 3300035725 Bacteria 7104
588 Ga0373947_0031670 3300035725 Bacteria 3114
589 Ga0373947_0048016 3300035725 Bacteria 2560
590 Ga0373947_0136348 3300035725 Unclassified 1571
591 Ga0373937_0096379 3300036401 Bacteria 2744
592 Ga0373937_0142599 3300036401 Bacteria 2242
593 Ga0373937_0415149 3300036401 Bacteria 1277
594 Ga0373937_0777864 3300036401 Bacteria 905
595 Ga0373925_0001460 3300037068 Bacteria 20404
596 Ga0373925_0036179 3300037068 Bacteria 3644
597 Ga0436365_0822824 3300039437 Bacteria 918
598 Ga0436360_0051954 3300039438 Bacteria 875
599 Ga0436363_1265412 3300039450 Bacteria 1647
600 Ga0439455_0010882 3300042012 Bacteria 2011
601 Ga0439458_0123449 3300042157 Bacteria 683
602 Ga0439464_0139855 3300042439 Bacteria 753
603 Ga0466963_0003451 3300044694 Bacteria 9054
604 Ga0466963_0013031 3300044694 Bacteria 5098
605 Ga0466963_0088630 3300044694 Unclassified 2105
606 Ga0466968_0284739 3300044735 Unclassified 792
607 Ga0466957_0096274 3300044842 Bacteria 1860
608 Ga0466959_0045867 3300045049 Unclassified 3218
609 Ga0451576_0099781 3300045051 Bacteria 3020
610 Ga0451576_0781686 3300045051 Bacteria 1003
611 Ga0466958_0231417 3300045836 Bacteria 1180
612 Ga0466967_0007475 3300045976 Bacteria 7884
613 Ga0466967_0009923 3300045976 Bacteria 7106
614 Ga0466967_0025290 3300045976 Bacteria 4894
615 Ga0466967_1034707 3300045976 Unclassified 818
616 Ga0495603_0148483 3300046455 Bacteria 1362
617 Ga0495629_0004799 3300046459 Bacteria 10139
618 Ga0495653_0480007 3300046463 Bacteria 778
619 Ga0495580_0001297 3300046472 Bacteria 22071
620 Ga0495580_0002452 3300046472 Bacteria 16221
621 Ga0495580_0002726 3300046472 Bacteria 15264
622 Ga0495580_0005046 3300046472 Bacteria 10999
623 Ga0495580_0007515 3300046472 Bacteria 8754
624 Ga0495580_0009627 3300046472 Bacteria 7588
625 Ga0495580_0025716 3300046472 Bacteria 4300
626 Ga0495580_0131210 3300046472 Bacteria 1738
627 Ga0495580_0175505 3300046472 Unclassified 1480
628 Ga0495580_0233972 3300046472 Bacteria 1261
629 Ga0495582_0024024 3300046473 Bacteria 3333
630 Ga0495662_0137100 3300046476 Bacteria 1204
631 Ga0495594_0151477 3300046499 Bacteria 1317
632 Ga0495630_0396002 3300046517 Bacteria 1058
633 Ga0495665_0009075 3300046531 Bacteria 5394
634 Ga0495665_0015792 3300046531 Bacteria 4066
635 Ga0495665_0019617 3300046531 Bacteria 3637
636 Ga0495586_0375071 3300046535 Unclassified 818
637 Ga0495587_0404774 3300046536 Bacteria 758
638 Ga0495659_0190781 3300046664 Bacteria 837
639 Ga0495588_0045734 3300046674 Bacteria 2245
640 Ga0495623_0302327 3300046679 Bacteria 883
641 Ga0495658_0052417 3300046683 Bacteria 2314
642 Ga0495658_0105642 3300046683 Bacteria 1687
643 Ga0495624_0115653 3300046690 Unclassified 1649
644 Ga0495675_0039177 3300047444 Unclassified 3018
645 Ga0495602_0028489 3300048088 Bacteria 5343
646 Ga0495602_0084622 3300048088 Bacteria 2653
647 Ga0495602_0396465 3300048088 Bacteria 985
648 Ga0495614_0128023 3300048089 Bacteria 1122
649 Ga0496100_0009636 3300048903 Bacteria 5430
650 Ga0496100_0038304 3300048903 Bacteria 3038
651 Ga0496100_0917593 3300048903 Unclassified 688
652 Ga0496101_0094335 3300048904 Bacteria 2230
653 Ga0496101_0219568 3300048904 Unclassified 1475
654 Ga0496102_0006262 3300048905 Bacteria 10146
655 Ga0496102_0101910 3300048905 Bacteria 2668
656 Ga0496102_0132330 3300048905 Bacteria 2335
657 Ga0496102_0180868 3300048905 Bacteria 1987
658 Ga0496103_0001097 3300048906 Bacteria 18843
659 Ga0496103_0031365 3300048906 Bacteria 3238
660 Ga0496103_0144061 3300048906 Bacteria 1525
661 Ga0496104_0018726 3300048907 Bacteria 6321
662 Ga0496105_0075874 3300048908 Bacteria 2776
663 Ga0496105_0201442 3300048908 Bacteria 1625
664 Ga0496106_0027445 3300048909 Bacteria 4240
665 Ga0496106_0052420 3300048909 Bacteria 3078
666 Ga0496107_0046661 3300048910 Bacteria 3118
667 Ga0496107_0063979 3300048910 Bacteria 2666
668 Ga0496108_0000200 3300048911 Bacteria 55323
669 Ga0496109_0002994 3300048912 Bacteria 14118
670 Ga0496109_0087859 3300048912 Bacteria 2872
671 Ga0496109_0158825 3300048912 Bacteria 2118
672 Ga0496110_0001074 3300048913 Bacteria 19279
673 Ga0496110_0065849 3300048913 Bacteria 3203
674 Ga0496111_0004593 3300048914 Bacteria 8741
675 Ga0496111_0009147 3300048914 Bacteria 6593
676 Ga0496112_0000070 3300048915 Bacteria 67934
677 Ga0496112_0002144 3300048915 Bacteria 15666
678 Ga0496112_0014295 3300048915 Bacteria 7355
679 Ga0496112_0056363 3300048915 Bacteria 3867
680 Ga0496112_0060462 3300048915 Bacteria 3734
681 Ga0496112_0176515 3300048915 Unclassified 2101
682 Ga0496112_0690941 3300048915 Bacteria 949
683 Ga0496113_0000064 3300048916 Bacteria 45691
684 Ga0496114_0048998 3300048917 Bacteria 3514
685 Ga0496114_0861868 3300048917 Unclassified 786
686 Ga0496115_0009016 3300048918 Bacteria 7400
687 Ga0496115_0370307 3300048918 Unclassified 1166
688 Ga0501298_005823 3300049521 Bacteria 1995
689 Ga0501075_0587444 3300049591 Bacteria 850
690 Ga0501076_0251652 3300049592 Bacteria 1446
691 Ga0501077_0034524 3300049593 Bacteria 3219
692 Ga0501261_010400 3300049690 Bacteria 1225
693 Ga0501079_0088317 3300049741 Bacteria 2400
694 nmdc:mga05p37_453847_c1 3300050507 Bacteria 1483
695 nmdc:mga08y16_261997_c1 3300050511 Bacteria 1785
696 nmdc:mga0n895_121218_c1 3300050512 Bacteria 2636
697 nmdc:mga0n895_203562_c1 3300050512 Bacteria 2010
698 nmdc:mga08x19_19007_c1 3300050514 Bacteria 4214
699 nmdc:mga08x19_738942_c1 3300050514 Unclassified 699
700 nmdc:mga0a205_26252_c1 3300050515 Bacteria 5551
701 Ga0495601_0017794 3300053077 Bacteria 4318
702 Ga0495601_0218018 3300053077 Bacteria 1246
703 Ga0495619_0028602 3300053085 Bacteria 3597
704 Ga0070680_101042533
705 JGI24752J21851_1004380
706 JGI24034J26672_10001681
707 JGI24751J29686_10005031
708 Ga0065704_10268208
709 Ga0065715_10101096
710 Ga0065715_10323663
711 Ga0070676_10006611
712 Ga0070683_100066179
713 Ga0070683_100143766
714 Ga0070690_100481731
715 Ga0070670_100003141
716 Ga0070670_100093759
717 Ga0068869_100005138
718 Ga0068869_100226506
719 Ga0070680_100032188
720 Ga0070680_100173161
721 Ga0070680_100174046
722 Ga0070680_100750231
723 Ga0070682_100075621
724 Ga0070682_100230916
725 Ga0068868_100002767
726 Ga0068868_100004502
727 Ga0068868_100035727
728 Ga0068868_100105114
729 Ga0070660_100005413
730 Ga0070689_100013667
731 Ga0070691_10060474
732 Ga0070691_10103441
733 Ga0070691_10248875
734 Ga0070687_100576395
735 Ga0070661_100003838
736 Ga0070661_100101243
737 Ga0070669_100053790
738 Ga0070675_100019034
739 Ga0070675_100206304
740 Ga0070671_100211690
741 Ga0070671_100551979
742 Ga0070671_101112376
743 Ga0070674_100110215
744 Ga0070673_100090318
745 Ga0070688_100055667
746 Ga0070659_100115862
747 Ga0070659_100159911
748 Ga0070659_100293491
749 Ga0070667_100290452
750 Ga0070709_10000684
751 Ga0070709_10014685
752 Ga0070709_10017575
753 Ga0070709_10162061
754 Ga0070709_10411343
755 Ga0070709_10450133
756 Ga0070714_100055630
757 Ga0070714_100486716
758 Ga0070714_100501343
759 Ga0070714_100685591
760 Ga0070713_100000029
761 Ga0070713_100188193
762 Ga0070713_100268059
763 Ga0070713_100299546
764 Ga0070713_100331204
765 Ga0070713_100401097
766 Ga0070713_100436288
767 Ga0070713_100501702
768 Ga0070710_10000350
769 Ga0070710_10002217
770 Ga0070710_10047517
771 Ga0070710_10084895
772 Ga0070710_10100815
773 Ga0070710_10110246
774 Ga0070710_10172039
775 Ga0070711_100002974
776 Ga0070711_100019314
777 Ga0070711_100024338
778 Ga0070711_100106327
779 Ga0070711_100162903
780 Ga0070705_100167177
781 Ga0070705_100607166
782 Ga0070694_100316251
783 Ga0070708_100000137
784 Ga0070708_100003186
785 Ga0070708_100008541
786 Ga0070708_100016509
787 Ga0070708_100738470
788 Ga0070708_100821693
789 Ga0070663_100129293
790 Ga0070678_100627004
791 Ga0070662_100034349
792 Ga0070681_10000516
793 Ga0070681_10090637
794 Ga0070681_10129925
795 Ga0070681_10171893
796 Ga0070681_10220514
797 Ga0068867_100010239
798 Ga0068867_100025087
799 Ga0070706_100000430
800 Ga0070706_100029741
801 Ga0070706_100053272
802 Ga0070706_100199116
803 Ga0070707_100000651
804 Ga0070707_100029389
805 Ga0070707_100460296
806 Ga0070707_100531127
807 Ga0070698_100000012
808 Ga0070698_100028467
809 Ga0070698_100061897
810 Ga0070698_100809689
811 Ga0070699_100000439
812 Ga0070699_100006190
813 Ga0070699_100006417
814 Ga0070699_100147535
815 Ga0070699_100426291
816 Ga0070679_100007084
817 Ga0070679_100008832
818 Ga0070679_100080649
819 Ga0070679_100102971
820 Ga0070679_100463706
821 Ga0070684_100004173
822 Ga0070684_100019796
823 Ga0070684_100020544
824 Ga0070697_100000415
825 Ga0070697_100000873
826 Ga0070697_100008695
827 Ga0070697_100011527
828 Ga0070697_100012935
829 Ga0070697_100021163
830 Ga0068853_100004532
831 Ga0068853_100307448
832 Ga0068853_100439938
833 Ga0068853_100668686
834 Ga0070672_100061407
835 Ga0070686_100002933
836 Ga0070686_100106476
837 Ga0070686_100197851
838 Ga0070695_100011271
839 Ga0070695_100170231
840 Ga0070695_100179811
841 Ga0070696_100019055
842 Ga0070696_100137431
843 Ga0070693_100007313
844 Ga0070693_100053281
845 Ga0070693_100106561
846 Ga0070665_100015058
847 Ga0068855_100001369
848 Ga0068855_100028469
849 Ga0068855_100036304
850 Ga0068855_100169971
851 Ga0070664_100000897
852 Ga0070664_100121885
853 Ga0070664_100221215
854 Ga0068857_100000335
855 Ga0068857_100002120
856 Ga0068857_100028064
857 Ga0068854_100028909
858 Ga0068854_100250875
859 Ga0068856_100000995
860 Ga0068856_100001225
861 Ga0068856_100002789
862 Ga0068856_100015031
863 Ga0068856_100025696
864 Ga0068856_100203177
865 Ga0070702_100003077
866 Ga0070702_100687374
867 Ga0068852_100029488
868 Ga0068852_100366305
869 Ga0068859_100002226
870 Ga0068859_100029564
871 Ga0068859_100175829
872 Ga0068864_100012155
873 Ga0068864_100015408
874 Ga0068866_10016713
875 Ga0068866_10035742
876 Ga0068866_10175516
877 Ga0068866_10325525
878 Ga0068870_10000328
879 Ga0068863_100046300
880 Ga0068863_100197031
881 Ga0068858_100000404
882 Ga0068858_100008344
883 Ga0068858_100028323
884 Ga0068858_100038311
885 Ga0068858_100038858
886 Ga0068858_100775799
887 Ga0068860_100028876
888 Ga0068860_100109033
889 Ga0068860_100213112
890 Ga0068862_100067378
891 Ga0068862_100369143
892 Ga0081455_10000009
893 Ga0081540_1064851
894 Ga0070717_10002369
895 Ga0070717_10005102
896 Ga0070717_10022289
897 Ga0070717_10064615
898 Ga0070717_10138497
899 Ga0070717_10171508
900 Ga0070717_10177690
901 Ga0070717_10202686
902 Ga0070717_10217598
903 Ga0070717_10491849
904 Ga0070717_10560282
905 Ga0070717_10613355
906 Ga0070717_10866679
907 Ga0070715_10000381
908 Ga0070715_10007977
909 Ga0070715_10036628
910 Ga0070716_100001342
911 Ga0070716_100011095
912 Ga0070716_100019252
913 Ga0070716_100023139
914 Ga0070716_100056000
915 Ga0070716_100110239
916 Ga0070716_100139600
917 Ga0070716_100177179
918 Ga0070716_100296451
919 Ga0070716_100328682
920 Ga0070716_100475985
921 Ga0070712_100000080
922 Ga0070712_100000123
923 Ga0070712_100006237
924 Ga0070712_100022903
925 Ga0070712_100030592
926 Ga0070712_100059492
927 Ga0070712_101004081
928 Ga0097621_100000866
929 Ga0097621_100002200
930 Ga0097621_100032652
931 Ga0097621_100107058
932 Ga0097621_100641236
933 Ga0097621_100871823
934 Ga0097621_100898469
935 Ga0068871_100000389
936 Ga0068871_100000941
937 Ga0068871_100039295
938 Ga0068871_100058016
939 Ga0068871_100061555
940 Ga0068871_100170932
941 Ga0068871_100185193
942 Ga0068871_100612100
943 Ga0068871_100797135
944 Ga0075434_100001903
945 Ga0075434_100026500
946 Ga0075434_100047111
947 Ga0075434_100174639
948 Ga0068865_100020197
949 Ga0068865_100022098
950 Ga0068865_100174857
951 Ga0075436_100053462
952 Ga0075436_100086600
953 Ga0097620_100002226
954 Ga0097620_100029564
955 Ga0097620_100175833
956 Ga0075435_100009445
957 Ga0105240_10052198
958 Ga0105240_10261769
959 Ga0105240_11082666
960 Ga0111539_10003123
961 Ga0105245_10068088
962 Ga0105245_10165523
963 Ga0105245_10308614
964 Ga0105247_10004769
965 Ga0105247_10327847
966 Ga0114129_10064122
967 Ga0105243_10187527
968 Ga0105241_10004936
969 Ga0105241_10045416
970 Ga0105241_10152795
971 Ga0105241_10196146
972 Ga0105242_10034283
973 Ga0105242_10070111
974 Ga0105242_10143933
975 Ga0105242_11036693
976 Ga0105248_10005502
977 Ga0105248_10020606
978 Ga0105248_10290061
979 Ga0105248_10409716
980 Ga0105237_10087833
981 Ga0105237_10187014
982 Ga0105237_10281058
983 Ga0105237_10361211
984 Ga0105238_10000214
985 Ga0105238_10030478
986 Ga0105238_10081927
987 Ga0105238_10154526
988 Ga0105238_10484296
989 Ga0105249_10768564
990 Ga0099796_10339234
991 Ga0105239_10009275
992 Ga0105239_10012476
993 Ga0105239_10113314
994 Ga0105239_10145264
995 Ga0105239_10187037
996 Ga0105239_10464747
997 Ga0105246_10000514
998 Ga0105246_10444858
999 Ga0105246_10573407
1000 Ga0157373_10004305
1001 Ga0157373_10010474
1002 Ga0157373_10047333
1003 Ga0157371_10050683
1004 Ga0157371_10271441
1005 Ga0157370_10111394
1006 Ga0157370_10380889
1007 Ga0157369_10001356
1008 Ga0157369_10020633
1009 Ga0157369_10065831
1010 Ga0157369_10072253
1011 Ga0157369_10407541
1012 Ga0157374_10000634
1013 Ga0157374_10002242
1014 Ga0157374_10003412
1015 Ga0157374_10015250
1016 Ga0157374_10024622
1017 Ga0157374_10032440
1018 Ga0157378_10000202
1019 Ga0157378_10000725
1020 Ga0157378_10028193
1021 Ga0157378_10070322
1022 Ga0157378_10411851
1023 Ga0157378_10480048
1024 Ga0163162_10042351
1025 Ga0163162_10046852
1026 Ga0163162_10146046
1027 Ga0163162_10749838
1028 Ga0157372_10001366
1029 Ga0157372_10001445
1030 Ga0157372_10004574
1031 Ga0157372_10018291
1032 Ga0157372_10060462
1033 Ga0157372_10108472
1034 Ga0157372_10188691
1035 Ga0157372_10981391
1036 Ga0157375_10044023
1037 Ga0157375_10071884
1038 Ga0157375_10377031
1039 Ga0163163_10025828
1040 Ga0163163_10065407
1041 Ga0163163_10435877
1042 Ga0163163_10469040
1043 Ga0163163_10650058
1044 Ga0163163_10669050
1045 Ga0157380_10058096
1046 Ga0157377_10001169
1047 Ga0157379_10002808
1048 Ga0157379_10052468
1049 Ga0157379_10069123
1050 Ga0157379_10375187
1051 Ga0157376_10006530
1052 Ga0157376_10033462
1053 Ga0157376_10046292
1054 Ga0157376_10076500
1055 Ga0157376_10105250
1056 Ga0157376_10155838
1057 Ga0157376_10286698
1058 Ga0157376_10633027
1059 Ga0182006_1184326
1060 Ga0182007_10004903
1061 Ga0163161_10006648
1062 Ga0154015_1022330
1063 Ga0213871_10051565
1064 Ga0224572_1000226
1065 Ga0224572_1007351
1066 Ga0228598_1000004
1067 Ga0228598_1029151
1068 Ga0207697_10002002
1069 Ga0207656_10028796
1070 Ga0207656_10050858
1071 Ga0207692_10000653
1072 Ga0207692_10007191
1073 Ga0207692_10028517
1074 Ga0207692_10094955
1075 Ga0207642_10034430
1076 Ga0207642_10047757
1077 Ga0207710_10032121
1078 Ga0207688_10002641
1079 Ga0207680_10003203
1080 Ga0207647_10002678
1081 Ga0207647_10042767
1082 Ga0207685_10003391
1083 Ga0207685_10021909
1084 Ga0207685_10103691
1085 Ga0207699_10000501
1086 Ga0207699_10011356
1087 Ga0207699_10215155
1088 Ga0207699_10228549
1089 Ga0207645_10008976
1090 Ga0207643_10004729
1091 Ga0207684_10002258
1092 Ga0207684_10003707
1093 Ga0207684_10007707
1094 Ga0207684_10174921
1095 Ga0207654_10016907
1096 Ga0207707_10020369
1097 Ga0207707_10040127
1098 Ga0207707_10040331
1099 Ga0207707_10065433
1100 Ga0207707_10141544
1101 Ga0207707_10456775
1102 Ga0207695_10031007
1103 Ga0207695_10031164
1104 Ga0207695_10032754
1105 Ga0207695_10241769
1106 Ga0207671_10156223
1107 Ga0207671_10269368
1108 Ga0207693_10000031
1109 Ga0207693_10004486
1110 Ga0207693_10005596
1111 Ga0207693_10020239
1112 Ga0207693_10020971
1113 Ga0207693_10077881
1114 Ga0207693_10170497
1115 Ga0207663_10005262
1116 Ga0207663_10016739
1117 Ga0207663_10062130
1118 Ga0207663_10132228
1119 Ga0207663_10236815
1120 Ga0207663_10394014
1121 Ga0207660_10026216
1122 Ga0207660_10134220
1123 Ga0207660_10157767
1124 Ga0207660_10317927
1125 Ga0207662_10015656
1126 Ga0207657_10008967
1127 Ga0207657_10504546
1128 Ga0207649_10000250
1129 Ga0207649_10155414
1130 Ga0207652_10020896
1131 Ga0207652_10022027
1132 Ga0207652_10075129
1133 Ga0207646_10000287
1134 Ga0207646_10000494
1135 Ga0207646_11084176
1136 Ga0207681_10105708
1137 Ga0207694_10002173
1138 Ga0207694_10130803
1139 Ga0207694_10528084
1140 Ga0207650_10000124
1141 Ga0207650_10013750
1142 Ga0207659_10304291
1143 Ga0207687_10289374
1144 Ga0207700_10060720
1145 Ga0207700_10067806
1146 Ga0207700_10142058
1147 Ga0207700_10225249
1148 Ga0207700_10440943
1149 Ga0207700_10453820
1150 Ga0207700_10622400
1151 Ga0207700_10637181
1152 Ga0207700_10663755
1153 Ga0207700_11081414
1154 Ga0207664_10082439
1155 Ga0207664_10165309
1156 Ga0207664_10314376
1157 Ga0207664_10611545
1158 Ga0207644_10051351
1159 Ga0207644_10326795
1160 Ga0207644_10432849
1161 Ga0207690_10021654
1162 Ga0207690_10241291
1163 Ga0207706_10007858
1164 Ga0207706_10051928
1165 Ga0207686_10033468
1166 Ga0207686_10156751
1167 Ga0207686_10170933
1168 Ga0207670_10001940
1169 Ga0207704_10035737
1170 Ga0207704_10052508
1171 Ga0207665_10000091
1172 Ga0207665_10011166
1173 Ga0207665_10020925
1174 Ga0207665_10023087
1175 Ga0207665_10034513
1176 Ga0207665_10122246
1177 Ga0207665_10174462
1178 Ga0207665_10181882
1179 Ga0207665_10219595
1180 Ga0207665_10317707
1181 Ga0207691_10017083
1182 Ga0207711_10011891
1183 Ga0207711_10108257
1184 Ga0207689_10002848
1185 Ga0207689_10004365
1186 Ga0207689_10130513
1187 Ga0207661_10001369
1188 Ga0207661_10114002
1189 Ga0207679_10000651
1190 Ga0207679_10001734
1191 Ga0207679_10076039
1192 Ga0207667_10002400
1193 Ga0207667_10002495
1194 Ga0207667_10223122
1195 Ga0207651_10002544
1196 Ga0207651_10074399
1197 Ga0207712_10268239
1198 Ga0207640_10094344
1199 Ga0207640_10102254
1200 Ga0207640_10875253
1201 Ga0207658_10023861
1202 Ga0207677_10010671
1203 Ga0207677_10014343
1204 Ga0207703_10002963
1205 Ga0207703_10032127
1206 Ga0207703_10045456
1207 Ga0207703_10173678
1208 Ga0207639_10065578
1209 Ga0207639_10396376
1210 Ga0207678_10002295
1211 Ga0207702_10000866
1212 Ga0207702_10001116
1213 Ga0207702_10001193
1214 Ga0207702_10082259
1215 Ga0207702_10111443
1216 Ga0207641_10000006
1217 Ga0207641_10016516
1218 Ga0207648_10006340
1219 Ga0207648_10022758
1220 Ga0207648_10038004
1221 Ga0207648_10169702
1222 Ga0207648_11124999
1223 Ga0207676_10000272
1224 Ga0207676_10007844
1225 Ga0207676_10010511
1226 Ga0207674_10000269
1227 Ga0207674_10001665
1228 Ga0207674_10037557
1229 Ga0207683_10018880
1230 Ga0207698_10185130
1231 Ga0209968_1009117
1232 Ga0209983_1018086
1233 Ga0209971_1006511
1234 Ga0209966_1002417
1235 Ga0209974_10002204
1236 Ga0268266_10010563
1237 Ga0268265_10041883
1238 Ga0268265_10210879
1239 Ga0268264_10012015
1240 Ga0268264_10016431
1241 Ga0268264_10118272
1242 Ga0265338_10024280
1243 Ga0265338_10071947
1244 Ga0265338_10100690
1245 Ga0265338_10128008
1246 Ga0265760_10001390
1247 Ga0265760_10006244
1248 Ga0265760_10010918
1249 Ga0265760_10048693
1250 Ga0265332_10021977
1251 Ga0265332_10126292
1252 Ga0265328_10008690
1253 Ga0265328_10127792
1254 Ga0265325_10004607
1255 Ga0265325_10044346
1256 Ga0265340_10003611
1257 Ga0265340_10065504
1258 Ga0265339_10006590
1259 Ga0265339_10007921
1260 Ga0265339_10060245
1261 Ga0265331_10055613
1262 Ga0265327_10025154
1263 Ga0265316_10002094
1264 Ga0265316_10032659
1265 Ga0265313_10010672
1266 Ga0265314_10001915
1267 Ga0265314_10068136
1268 Ga0265342_10164438
1269 Ga0316214_1006969
1270 Ga0373926_0026115
1271 Ga0373929_0052752
1272 Ga0373923_0095978
1273 Ga0373936_0030981
1274 Ga0373936_0225788
1275 Ga0373956_0159370
1276 Ga0373943_0005123
1277 Ga0373943_0020892
1278 Ga0373943_0045269
1279 Ga0373943_0152326
1280 Ga0373943_0337746
1281 Ga0373946_0147649
1282 Ga0373961_0017354
1283 Ga0373935_0003300
1284 Ga0373935_0044471
1285 Ga0373927_0019005
1286 Ga0373927_0071047
1287 Ga0373927_0119356
1288 Ga0373927_0236670
1289 Ga0373933_0037987
1290 Ga0373947_0005953
1291 Ga0373947_0031670
1292 Ga0373947_0048016
1293 Ga0373947_0136348
1294 Ga0373937_0096379
1295 Ga0373937_0142599
1296 Ga0373937_0415149
1297 Ga0373937_0777864
1298 Ga0373925_0001460
1299 Ga0373925_0036179
1300 Ga0436365_0822824
1301 Ga0436360_0051954
1302 Ga0436363_1265412
1303 Ga0439455_0010882
1304 Ga0439458_0123449
1305 Ga0439464_0139855
1306 Ga0466963_0003451
1307 Ga0466963_0013031
1308 Ga0466963_0088630
1309 Ga0466968_0284739
1310 Ga0466957_0096274
1311 Ga0466959_0045867
1312 Ga0451576_0099781
1313 Ga0451576_0781686
1314 Ga0466958_0231417
1315 Ga0466967_0007475
1316 Ga0466967_0009923
1317 Ga0466967_0025290
1318 Ga0466967_1034707
1319 Ga0495603_0148483
1320 Ga0495629_0004799
1321 Ga0495653_0480007
1322 Ga0495580_0001297
1323 Ga0495580_0002452
1324 Ga0495580_0002726
1325 Ga0495580_0005046
1326 Ga0495580_0007515
1327 Ga0495580_0009627
1328 Ga0495580_0025716
1329 Ga0495580_0131210
1330 Ga0495580_0175505
1331 Ga0495580_0233972
1332 Ga0495582_0024024
1333 Ga0495662_0137100
1334 Ga0495594_0151477
1335 Ga0495630_0396002
1336 Ga0495665_0009075
1337 Ga0495665_0015792
1338 Ga0495665_0019617
1339 Ga0495586_0375071
1340 Ga0495587_0404774
1341 Ga0495659_0190781
1342 Ga0495588_0045734
1343 Ga0495623_0302327
1344 Ga0495658_0052417
1345 Ga0495658_0105642
1346 Ga0495624_0115653
1347 Ga0495675_0039177
1348 Ga0495602_0028489
1349 Ga0495602_0084622
1350 Ga0495602_0396465
1351 Ga0495614_0128023
1352 Ga0496100_0009636
1353 Ga0496100_0038304
1354 Ga0496100_0917593
1355 Ga0496101_0094335
1356 Ga0496101_0219568
1357 Ga0496102_0006262
1358 Ga0496102_0101910
1359 Ga0496102_0132330
1360 Ga0496102_0180868
1361 Ga0496103_0001097
1362 Ga0496103_0031365
1363 Ga0496103_0144061
1364 Ga0496104_0018726
1365 Ga0496105_0075874
1366 Ga0496105_0201442
1367 Ga0496106_0027445
1368 Ga0496106_0052420
1369 Ga0496107_0046661
1370 Ga0496107_0063979
1371 Ga0496108_0000200
1372 Ga0496109_0002994
1373 Ga0496109_0087859
1374 Ga0496109_0158825
1375 Ga0496110_0001074
1376 Ga0496110_0065849
1377 Ga0496111_0004593
1378 Ga0496111_0009147
1379 Ga0496112_0000070
1380 Ga0496112_0002144
1381 Ga0496112_0014295
1382 Ga0496112_0056363
1383 Ga0496112_0060462
1384 Ga0496112_0176515
1385 Ga0496112_0690941
1386 Ga0496113_0000064
1387 Ga0496114_0048998
1388 Ga0496114_0861868
1389 Ga0496115_0009016
1390 Ga0496115_0370307
1391 Ga0501298_005823
1392 Ga0501075_0587444
1393 Ga0501076_0251652
1394 Ga0501077_0034524
1395 Ga0501261_010400
1396 Ga0501079_0088317
1397 nmdc:mga05p37_453847_c1
1398 nmdc:mga08y16_261997_c1
1399 nmdc:mga0n895_121218_c1
1400 nmdc:mga0n895_203562_c1
1401 nmdc:mga08x19_19007_c1
1402 nmdc:mga08x19_738942_c1
1403 nmdc:mga0a205_26252_c1
1404 Ga0495601_0017794
1405 Ga0495601_0218018
1406 Ga0495619_0028602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

4

185

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ds3-assembly1.cif.gz_A-2 crystal structure of phosphoribosylglycinamide formyltransferase from brucella melitensis 0.9289 2 185
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9181 1 199
3tqr-assembly1.cif.gz_A structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii 0.9135 2 199
3da8-assembly3.cif.gz_B crystal structure of purn from mycobacterium tuberculosis 0.9126 2 199
3n0v-assembly1.cif.gz_B crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9101 2 199
ID Description Score Start End Superfamily
4ds3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9289 2 185 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9238 1 186 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9181 1 199 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.914 2 188 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9098 1 186 3.40.50.170
ID Description Score Start End GO Terms
AF-Q1IM87-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9514 1 202 GO:0004644
GO:0005737
GO:0006189
AF-E6W594-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9457 2 199 GO:0004644
GO:0005737
GO:0006189
AF-A0A7S2D4M0-F1-model_v4 Trifunctional purine biosynthetic protein adenosine-3 (EC 2.1.2.2) (EC 6.3.3.1) (EC 6.3.4.13) 0.9452 3 188 GO:0004637
GO:0004641
GO:0004644
GO:0005524
GO:0005829
GO:0006189
GO:0046084
GO:0046872
AF-A0A3L7PW45-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.94 2 94 GO:0004644
GO:0005737
GO:0006189
AF-A0A7J2HN10-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9398 2 116 GO:0004644
GO:0005737
GO:0006189

Map