F476261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 703 | 311 | 1406 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100003479|Ga0070664_10000347911 |
| Length | 358 |
| Sequence | VAAGRGGFLPFSRGWGGTSVPADMSACGPKMNMDPALHREQKPSWIKVRLPNNPVFWSTKSMVQDLKLVTVCEEAQCPNRWECWGQGTATFMIAGDKCTRACGFCAVKTARPDALEADEPERVATATQRMGLKHVVITAVARDDLKDGGAEHFQQTIEAVREMNPSTIIEVLVPDFNDRDWALQMVMDARPHIFNHNLETVERLTPLVRSRAKYQRSLTVLKKAKAMVNGRVATKSGIMLGLGERREEVLRAFDDLLAHDVTVLTLGQYLRPTPKHLPVVEYIEPSVFDEYKAIALEKGFKHVASGPLVRSSYHAADFRPELDILEAVESDVRAKKGLELGPEHLGLPEAKAELVKNL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 118 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 231 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 232 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 233 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 310 | 2718217752 | Candidatus Xiphinematobacter sp. Idaho Grape | Isolate | Unclassified |
| 311 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.14 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.13 |
| Nodule | 0 |
| Rhizoplane | 3.7 |
| Rhizosphere | 91.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070664_100003479 | 3300005564 | Bacteria | 12710 |
| 2 | CNXas_1000010 | 3300000545 | Bacteria | 39918 |
| 3 | JGI24746J21847_1002232 | 3300001977 | Bacteria | 3095 |
| 4 | JGI24737J22298_10049526 | 3300001990 | Bacteria | 1278 |
| 5 | JGI24743J22301_10000180 | 3300001991 | Bacteria | 6545 |
| 6 | JGI24033J26618_1000267 | 3300002155 | Bacteria | 5726 |
| 7 | JGI24742J22300_10001701 | 3300002244 | Bacteria | 3503 |
| 8 | rootH2_10016017 | 3300003320 | Bacteria | 24516 |
| 9 | rootH2_10064210 | 3300003320 | Bacteria | 4717 |
| 10 | rootH2_10284222 | 3300003320 | Bacteria | 1785 |
| 11 | rootH1_10003502 | 3300003323 | Bacteria | 55174 |
| 12 | JGI25405J52794_10000432 | 3300003911 | Bacteria | 5906 |
| 13 | Ga0065704_10009461 | 3300005289 | Bacteria | 3987 |
| 14 | Ga0065704_10011242 | 3300005289 | Bacteria | 2523 |
| 15 | Ga0065704_10098924 | 3300005289 | Bacteria | 2333 |
| 16 | Ga0065712_10080155 | 3300005290 | Bacteria | 3138 |
| 17 | Ga0065712_10084596 | 3300005290 | Bacteria | 2752 |
| 18 | Ga0065712_10124906 | 3300005290 | Bacteria | 1620 |
| 19 | Ga0065715_10137461 | 3300005293 | Bacteria | 1905 |
| 20 | Ga0065715_10179505 | 3300005293 | Bacteria | 1485 |
| 21 | Ga0065707_10004617 | 3300005295 | Bacteria | 5653 |
| 22 | Ga0065707_10010686 | 3300005295 | Unclassified | 1860 |
| 23 | Ga0065707_10203773 | 3300005295 | Bacteria | 1298 |
| 24 | Ga0065707_10210827 | 3300005295 | Bacteria | 1266 |
| 25 | Ga0070676_10001595 | 3300005328 | Bacteria | 11544 |
| 26 | Ga0070676_10036141 | 3300005328 | Bacteria | 2844 |
| 27 | Ga0070676_10104584 | 3300005328 | Unclassified | 1754 |
| 28 | Ga0070683_100032539 | 3300005329 | Unclassified | 4748 |
| 29 | Ga0070683_100152477 | 3300005329 | Bacteria | 2191 |
| 30 | Ga0070690_100004714 | 3300005330 | Bacteria | 7601 |
| 31 | Ga0070690_100044685 | 3300005330 | Bacteria | 2812 |
| 32 | Ga0070690_100156137 | 3300005330 | Unclassified | 1560 |
| 33 | Ga0070670_100002866 | 3300005331 | Bacteria | 14271 |
| 34 | Ga0070670_100035915 | 3300005331 | Unclassified | 4267 |
| 35 | Ga0070670_100392042 | 3300005331 | Bacteria | 1225 |
| 36 | Ga0070666_10064858 | 3300005335 | Unclassified | 2478 |
| 37 | Ga0068868_100013546 | 3300005338 | Bacteria | 5983 |
| 38 | Ga0068868_100124611 | 3300005338 | Unclassified | 2104 |
| 39 | Ga0068868_100168499 | 3300005338 | Bacteria | 1812 |
| 40 | Ga0070660_100049744 | 3300005339 | Bacteria | 3223 |
| 41 | Ga0070660_100141896 | 3300005339 | Bacteria | 1928 |
| 42 | Ga0070689_100032997 | 3300005340 | Bacteria | 3942 |
| 43 | Ga0070689_100038101 | 3300005340 | Bacteria | 3677 |
| 44 | Ga0070689_100081492 | 3300005340 | Unclassified | 2541 |
| 45 | Ga0070689_100238321 | 3300005340 | Unclassified | 1498 |
| 46 | Ga0070689_100384011 | 3300005340 | Unclassified | 1184 |
| 47 | Ga0070691_10012273 | 3300005341 | Bacteria | 3921 |
| 48 | Ga0070687_100021823 | 3300005343 | Bacteria | 3018 |
| 49 | Ga0070687_100023175 | 3300005343 | Bacteria | 2948 |
| 50 | Ga0070661_100000512 | 3300005344 | Bacteria | 29765 |
| 51 | Ga0070668_100042021 | 3300005347 | Unclassified | 3503 |
| 52 | Ga0070668_100050534 | 3300005347 | Bacteria | 3201 |
| 53 | Ga0070668_100141923 | 3300005347 | Bacteria | 1936 |
| 54 | Ga0070668_100172130 | 3300005347 | Unclassified | 1763 |
| 55 | Ga0070668_100224397 | 3300005347 | Bacteria | 1551 |
| 56 | Ga0070668_100453316 | 3300005347 | Bacteria | 1103 |
| 57 | Ga0070669_100001514 | 3300005353 | Bacteria | 16793 |
| 58 | Ga0070669_100008387 | 3300005353 | Bacteria | 7373 |
| 59 | Ga0070669_100072636 | 3300005353 | Bacteria | 2547 |
| 60 | Ga0070675_100001376 | 3300005354 | Bacteria | 17837 |
| 61 | Ga0070675_100004395 | 3300005354 | Bacteria | 10754 |
| 62 | Ga0070675_100090333 | 3300005354 | Bacteria | 2565 |
| 63 | Ga0070675_100092576 | 3300005354 | Bacteria | 2534 |
| 64 | Ga0070675_100132816 | 3300005354 | Unclassified | 2122 |
| 65 | Ga0070675_100170940 | 3300005354 | Bacteria | 1874 |
| 66 | Ga0070675_100414813 | 3300005354 | Bacteria | 1203 |
| 67 | Ga0070671_100019012 | 3300005355 | Bacteria | 5588 |
| 68 | Ga0070671_100224947 | 3300005355 | Unclassified | 1592 |
| 69 | Ga0070671_100274268 | 3300005355 | Bacteria | 1434 |
| 70 | Ga0070671_100366439 | 3300005355 | Bacteria | 1230 |
| 71 | Ga0070671_100415123 | 3300005355 | Unclassified | 1152 |
| 72 | Ga0070674_100088541 | 3300005356 | Unclassified | 2228 |
| 73 | Ga0070674_100236682 | 3300005356 | Bacteria | 1427 |
| 74 | Ga0070674_100246615 | 3300005356 | Bacteria | 1401 |
| 75 | Ga0070674_100310633 | 3300005356 | Bacteria | 1260 |
| 76 | Ga0070673_100119263 | 3300005364 | Bacteria | 2198 |
| 77 | Ga0070673_100192715 | 3300005364 | Unclassified | 1751 |
| 78 | Ga0070673_100213348 | 3300005364 | Unclassified | 1668 |
| 79 | Ga0070688_100025475 | 3300005365 | Bacteria | 3502 |
| 80 | Ga0070688_100043444 | 3300005365 | Bacteria | 2769 |
| 81 | Ga0070659_100041310 | 3300005366 | Bacteria | 3605 |
| 82 | Ga0070659_100070468 | 3300005366 | Bacteria | 2777 |
| 83 | Ga0070667_100066880 | 3300005367 | Bacteria | 3054 |
| 84 | Ga0070667_100076832 | 3300005367 | Bacteria | 2851 |
| 85 | Ga0070667_100100989 | 3300005367 | Unclassified | 2491 |
| 86 | Ga0070667_100280219 | 3300005367 | Bacteria | 1497 |
| 87 | Ga0070709_10010292 | 3300005434 | Bacteria | 5171 |
| 88 | Ga0070709_10295105 | 3300005434 | Bacteria | 1182 |
| 89 | Ga0070714_100022507 | 3300005435 | Bacteria | 5168 |
| 90 | Ga0070714_100080275 | 3300005435 | Unclassified | 2838 |
| 91 | Ga0070714_100105244 | 3300005435 | Unclassified | 2491 |
| 92 | Ga0070713_100044943 | 3300005436 | Bacteria | 3617 |
| 93 | Ga0070713_100056786 | 3300005436 | Bacteria | 3256 |
| 94 | Ga0070710_10016962 | 3300005437 | Bacteria | 3718 |
| 95 | Ga0070701_10007999 | 3300005438 | Bacteria | 4548 |
| 96 | Ga0070711_100000735 | 3300005439 | Bacteria | 17087 |
| 97 | Ga0070711_100001885 | 3300005439 | Bacteria | 11710 |
| 98 | Ga0070705_100076845 | 3300005440 | Bacteria | 2037 |
| 99 | Ga0070708_100029133 | 3300005445 | Bacteria | 4759 |
| 100 | Ga0070708_100029720 | 3300005445 | Unclassified | 4716 |
| 101 | Ga0070708_100278920 | 3300005445 | Bacteria | 1573 |
| 102 | Ga0070708_100310458 | 3300005445 | Bacteria | 1485 |
| 103 | Ga0070663_100035045 | 3300005455 | Bacteria | 3479 |
| 104 | Ga0070678_100011508 | 3300005456 | Bacteria | 5464 |
| 105 | Ga0070678_100097756 | 3300005456 | Bacteria | 2268 |
| 106 | Ga0070662_100011759 | 3300005457 | Bacteria | 5781 |
| 107 | Ga0070662_100034437 | 3300005457 | Bacteria | 3571 |
| 108 | Ga0070662_100178212 | 3300005457 | Bacteria | 1674 |
| 109 | Ga0070681_10019854 | 3300005458 | Bacteria | 6732 |
| 110 | Ga0068867_100000121 | 3300005459 | Bacteria | 49744 |
| 111 | Ga0068867_100156939 | 3300005459 | Unclassified | 1792 |
| 112 | Ga0070685_10075523 | 3300005466 | Bacteria | 2008 |
| 113 | Ga0070706_100000339 | 3300005467 | Bacteria | 56563 |
| 114 | Ga0070706_100001168 | 3300005467 | Bacteria | 28210 |
| 115 | Ga0070706_100003751 | 3300005467 | Bacteria | 14840 |
| 116 | Ga0070706_100079329 | 3300005467 | Bacteria | 3038 |
| 117 | Ga0070707_100001522 | 3300005468 | Bacteria | 22582 |
| 118 | Ga0070707_100010843 | 3300005468 | Bacteria | 8488 |
| 119 | Ga0070707_100056296 | 3300005468 | Bacteria | 3771 |
| 120 | Ga0070707_100080316 | 3300005468 | Bacteria | 3147 |
| 121 | Ga0070707_100106426 | 3300005468 | Bacteria | 2720 |
| 122 | Ga0070707_100175217 | 3300005468 | Bacteria | 2090 |
| 123 | Ga0070707_100175503 | 3300005468 | Unclassified | 2089 |
| 124 | Ga0070707_100525064 | 3300005468 | Unclassified | 1146 |
| 125 | Ga0070698_100001525 | 3300005471 | Bacteria | 25703 |
| 126 | Ga0070698_100004367 | 3300005471 | Bacteria | 15541 |
| 127 | Ga0070698_100018823 | 3300005471 | Bacteria | 7265 |
| 128 | Ga0070698_100030526 | 3300005471 | Bacteria | 5587 |
| 129 | Ga0070698_100234988 | 3300005471 | Bacteria | 1766 |
| 130 | Ga0070699_100042974 | 3300005518 | Unclassified | 3912 |
| 131 | Ga0070699_100078433 | 3300005518 | Bacteria | 2877 |
| 132 | Ga0070699_100090764 | 3300005518 | Unclassified | 2671 |
| 133 | Ga0070699_100155645 | 3300005518 | Bacteria | 2023 |
| 134 | Ga0070684_100259022 | 3300005535 | Bacteria | 1591 |
| 135 | Ga0070684_100262337 | 3300005535 | Bacteria | 1580 |
| 136 | Ga0070697_100019502 | 3300005536 | Bacteria | 5357 |
| 137 | Ga0070697_100076188 | 3300005536 | Bacteria | 2759 |
| 138 | Ga0070697_100194928 | 3300005536 | Bacteria | 1720 |
| 139 | Ga0068853_100000075 | 3300005539 | Bacteria | 68972 |
| 140 | Ga0068853_100147409 | 3300005539 | Bacteria | 2116 |
| 141 | Ga0070672_100008263 | 3300005543 | Bacteria | 7114 |
| 142 | Ga0070672_100080856 | 3300005543 | Unclassified | 2604 |
| 143 | Ga0070686_100004345 | 3300005544 | Bacteria | 7809 |
| 144 | Ga0070686_100253831 | 3300005544 | Bacteria | 1286 |
| 145 | Ga0070686_100309861 | 3300005544 | Bacteria | 1174 |
| 146 | Ga0070695_100124592 | 3300005545 | Bacteria | 1768 |
| 147 | Ga0070665_100006037 | 3300005548 | Bacteria | 12378 |
| 148 | Ga0070665_100080903 | 3300005548 | Bacteria | 3254 |
| 149 | Ga0070665_100119558 | 3300005548 | Bacteria | 2637 |
| 150 | Ga0070665_100249192 | 3300005548 | Unclassified | 1777 |
| 151 | Ga0070665_100321591 | 3300005548 | Unclassified | 1551 |
| 152 | Ga0070704_100055642 | 3300005549 | Unclassified | 2806 |
| 153 | Ga0070704_100125279 | 3300005549 | Unclassified | 1981 |
| 154 | Ga0068855_100007043 | 3300005563 | Bacteria | 13636 |
| 155 | Ga0068855_100084103 | 3300005563 | Bacteria | 3685 |
| 156 | Ga0068855_100238085 | 3300005563 | Bacteria | 2035 |
| 157 | Ga0068855_100701618 | 3300005563 | Unclassified | 1083 |
| 158 | Ga0070664_100069368 | 3300005564 | Unclassified | 3016 |
| 159 | Ga0070664_100171104 | 3300005564 | Bacteria | 1927 |
| 160 | Ga0068857_100126083 | 3300005577 | Bacteria | 2307 |
| 161 | Ga0068854_100070375 | 3300005578 | Bacteria | 2557 |
| 162 | Ga0068856_100001437 | 3300005614 | Bacteria | 24994 |
| 163 | Ga0068856_100003901 | 3300005614 | Bacteria | 14959 |
| 164 | Ga0068856_100054103 | 3300005614 | Bacteria | 3958 |
| 165 | Ga0068856_100289515 | 3300005614 | Bacteria | 1655 |
| 166 | Ga0068856_100441415 | 3300005614 | Bacteria | 1322 |
| 167 | Ga0068859_100330914 | 3300005617 | Bacteria | 1617 |
| 168 | Ga0068864_100031005 | 3300005618 | Bacteria | 4534 |
| 169 | Ga0068864_100346657 | 3300005618 | Bacteria | 1400 |
| 170 | Ga0068863_100031706 | 3300005841 | Bacteria | 5043 |
| 171 | Ga0068863_100119083 | 3300005841 | Bacteria | 2517 |
| 172 | Ga0068863_100282565 | 3300005841 | Bacteria | 1608 |
| 173 | Ga0068863_100373542 | 3300005841 | Bacteria | 1392 |
| 174 | Ga0068858_100011167 | 3300005842 | Bacteria | 8490 |
| 175 | Ga0068858_100066720 | 3300005842 | Bacteria | 3332 |
| 176 | Ga0068860_100000335 | 3300005843 | Bacteria | 63785 |
| 177 | Ga0068860_100017681 | 3300005843 | Bacteria | 6946 |
| 178 | Ga0068860_100129699 | 3300005843 | Bacteria | 2419 |
| 179 | Ga0068860_100279531 | 3300005843 | Bacteria | 1631 |
| 180 | Ga0068860_100454202 | 3300005843 | Unclassified | 1274 |
| 181 | Ga0068862_100011766 | 3300005844 | Bacteria | 7222 |
| 182 | Ga0081455_10000171 | 3300005937 | Bacteria | 80763 |
| 183 | Ga0081455_10003966 | 3300005937 | Bacteria | 16797 |
| 184 | Ga0081455_10009921 | 3300005937 | Bacteria | 9742 |
| 185 | Ga0081455_10042131 | 3300005937 | Unclassified | 4008 |
| 186 | Ga0081455_10109413 | 3300005937 | Bacteria | 2199 |
| 187 | Ga0081455_10152931 | 3300005937 | Unclassified | 1777 |
| 188 | Ga0081538_10060910 | 3300005981 | Bacteria | 2165 |
| 189 | Ga0081540_1000225 | 3300005983 | Bacteria | 59402 |
| 190 | Ga0081540_1010358 | 3300005983 | Bacteria | 6323 |
| 191 | Ga0081540_1012037 | 3300005983 | Bacteria | 5726 |
| 192 | Ga0081539_10000098 | 3300005985 | Bacteria | 202400 |
| 193 | Ga0081539_10004649 | 3300005985 | Bacteria | 14944 |
| 194 | Ga0081539_10058818 | 3300005985 | Bacteria | 2119 |
| 195 | Ga0081539_10076733 | 3300005985 | Bacteria | 1770 |
| 196 | Ga0070717_10011824 | 3300006028 | Bacteria | 6640 |
| 197 | Ga0070717_10024005 | 3300006028 | Bacteria | 4838 |
| 198 | Ga0070717_10086925 | 3300006028 | Unclassified | 2632 |
| 199 | Ga0070717_10090738 | 3300006028 | Bacteria | 2579 |
| 200 | Ga0070717_10107223 | 3300006028 | Bacteria | 2379 |
| 201 | Ga0070717_10402752 | 3300006028 | Bacteria | 1229 |
| 202 | Ga0075363_100043952 | 3300006048 | Bacteria | 2365 |
| 203 | Ga0070716_100101978 | 3300006173 | Bacteria | 1761 |
| 204 | Ga0070716_100252840 | 3300006173 | Bacteria | 1201 |
| 205 | Ga0070716_100418380 | 3300006173 | Bacteria | 968 |
| 206 | Ga0075362_10000544 | 3300006177 | Bacteria | 10962 |
| 207 | Ga0097621_100009753 | 3300006237 | Bacteria | 6989 |
| 208 | Ga0097621_100023334 | 3300006237 | Bacteria | 4816 |
| 209 | Ga0075370_10039868 | 3300006353 | Bacteria | 2648 |
| 210 | Ga0068871_100127430 | 3300006358 | Bacteria | 2156 |
| 211 | Ga0068871_100286693 | 3300006358 | Bacteria | 1442 |
| 212 | Ga0068871_100433924 | 3300006358 | Bacteria | 1175 |
| 213 | Ga0075431_100032699 | 3300006847 | Bacteria | 5361 |
| 214 | Ga0075433_10228023 | 3300006852 | Bacteria | 1654 |
| 215 | Ga0075433_10313266 | 3300006852 | Unclassified | 1389 |
| 216 | Ga0075434_100167470 | 3300006871 | Bacteria | 2217 |
| 217 | Ga0075434_100214968 | 3300006871 | Bacteria | 1942 |
| 218 | Ga0075436_100114222 | 3300006914 | Bacteria | 1885 |
| 219 | Ga0097620_100330908 | 3300006931 | Bacteria | 1617 |
| 220 | Ga0075435_100043321 | 3300007076 | Bacteria | 3603 |
| 221 | Ga0075435_100236514 | 3300007076 | Bacteria | 1553 |
| 222 | Ga0075435_100444977 | 3300007076 | Unclassified | 1117 |
| 223 | Ga0105240_10000124 | 3300009093 | Bacteria | 160617 |
| 224 | Ga0105240_10006802 | 3300009093 | Bacteria | 16723 |
| 225 | Ga0105240_10058709 | 3300009093 | Bacteria | 4803 |
| 226 | Ga0105240_10232549 | 3300009093 | Bacteria | 2141 |
| 227 | Ga0105240_10610075 | 3300009093 | Bacteria | 1200 |
| 228 | Ga0111539_10092340 | 3300009094 | Bacteria | 3557 |
| 229 | Ga0111539_10317399 | 3300009094 | Unclassified | 1813 |
| 230 | Ga0111539_10727935 | 3300009094 | Bacteria | 1155 |
| 231 | Ga0105245_10049473 | 3300009098 | Bacteria | 3764 |
| 232 | Ga0105245_10124418 | 3300009098 | Unclassified | 2412 |
| 233 | Ga0105247_10250955 | 3300009101 | Bacteria | 1209 |
| 234 | Ga0114129_10236217 | 3300009147 | Bacteria | 2459 |
| 235 | Ga0114129_10342862 | 3300009147 | Bacteria | 1981 |
| 236 | Ga0105243_10000065 | 3300009148 | Bacteria | 124947 |
| 237 | Ga0105237_10107962 | 3300009545 | Bacteria | 2775 |
| 238 | Ga0105237_10285130 | 3300009545 | Bacteria | 1654 |
| 239 | Ga0105237_10331894 | 3300009545 | Bacteria | 1525 |
| 240 | Ga0105238_10000930 | 3300009551 | Bacteria | 30002 |
| 241 | Ga0105238_10058537 | 3300009551 | Unclassified | 3862 |
| 242 | Ga0105249_10001742 | 3300009553 | Bacteria | 18977 |
| 243 | Ga0105249_10250191 | 3300009553 | Bacteria | 1757 |
| 244 | Ga0099796_10105924 | 3300010159 | Bacteria | 1064 |
| 245 | Ga0105239_10821047 | 3300010375 | Bacteria | 1065 |
| 246 | Ga0157373_10001329 | 3300013100 | Bacteria | 18935 |
| 247 | Ga0157370_10000098 | 3300013104 | Bacteria | 98792 |
| 248 | Ga0157370_10073442 | 3300013104 | Unclassified | 3227 |
| 249 | Ga0157374_10000036 | 3300013296 | Bacteria | 176499 |
| 250 | Ga0157374_10024872 | 3300013296 | Bacteria | 5372 |
| 251 | Ga0157374_10042694 | 3300013296 | Unclassified | 4184 |
| 252 | Ga0157374_10044656 | 3300013296 | Bacteria | 4096 |
| 253 | Ga0157374_10107462 | 3300013296 | Bacteria | 2682 |
| 254 | Ga0157374_10109941 | 3300013296 | Bacteria | 2650 |
| 255 | Ga0157374_10171382 | 3300013296 | Bacteria | 2117 |
| 256 | Ga0157374_10210420 | 3300013296 | Unclassified | 1907 |
| 257 | Ga0157374_10263517 | 3300013296 | Bacteria | 1698 |
| 258 | Ga0157378_10006286 | 3300013297 | Bacteria | 10403 |
| 259 | Ga0157378_10015155 | 3300013297 | Bacteria | 6749 |
| 260 | Ga0157378_10028454 | 3300013297 | Bacteria | 4931 |
| 261 | Ga0157378_10111580 | 3300013297 | Bacteria | 2507 |
| 262 | Ga0157378_10140765 | 3300013297 | Bacteria | 2240 |
| 263 | Ga0157378_10186626 | 3300013297 | Unclassified | 1953 |
| 264 | Ga0157378_10302614 | 3300013297 | Bacteria | 1548 |
| 265 | Ga0157378_10392043 | 3300013297 | Unclassified | 1366 |
| 266 | Ga0163162_10044897 | 3300013306 | Bacteria | 4427 |
| 267 | Ga0163162_10110346 | 3300013306 | Bacteria | 2848 |
| 268 | Ga0163162_10111645 | 3300013306 | Bacteria | 2832 |
| 269 | Ga0163162_10328229 | 3300013306 | Unclassified | 1662 |
| 270 | Ga0163162_10338124 | 3300013306 | Bacteria | 1638 |
| 271 | Ga0157372_10369506 | 3300013307 | Unclassified | 1671 |
| 272 | Ga0157372_10503565 | 3300013307 | Bacteria | 1412 |
| 273 | Ga0157375_10000006 | 3300013308 | Bacteria | 384086 |
| 274 | Ga0157375_10000985 | 3300013308 | Bacteria | 24652 |
| 275 | Ga0157375_10041020 | 3300013308 | Unclassified | 4467 |
| 276 | Ga0157375_10058020 | 3300013308 | Unclassified | 3828 |
| 277 | Ga0157375_10110333 | 3300013308 | Bacteria | 2848 |
| 278 | Ga0157375_10113083 | 3300013308 | Unclassified | 2816 |
| 279 | Ga0157375_10263678 | 3300013308 | Bacteria | 1884 |
| 280 | Ga0157375_10303217 | 3300013308 | Bacteria | 1761 |
| 281 | Ga0157375_10533466 | 3300013308 | Unclassified | 1336 |
| 282 | Ga0157375_10805395 | 3300013308 | Bacteria | 1088 |
| 283 | Ga0163163_10007622 | 3300014325 | Bacteria | 9563 |
| 284 | Ga0163163_10142870 | 3300014325 | Bacteria | 2436 |
| 285 | Ga0163163_10521036 | 3300014325 | Unclassified | 1251 |
| 286 | Ga0157380_10439827 | 3300014326 | Bacteria | 1249 |
| 287 | Ga0182008_10025254 | 3300014497 | Unclassified | 3018 |
| 288 | Ga0157377_10016770 | 3300014745 | Bacteria | 3774 |
| 289 | Ga0157377_10020618 | 3300014745 | Bacteria | 3456 |
| 290 | Ga0157377_10030242 | 3300014745 | Unclassified | 2932 |
| 291 | Ga0157379_10009934 | 3300014968 | Bacteria | 8287 |
| 292 | Ga0157376_10000155 | 3300014969 | Bacteria | 47176 |
| 293 | Ga0157376_10057828 | 3300014969 | Bacteria | 3246 |
| 294 | Ga0157376_10078986 | 3300014969 | Bacteria | 2819 |
| 295 | Ga0157376_10094693 | 3300014969 | Bacteria | 2596 |
| 296 | Ga0157376_10103244 | 3300014969 | Unclassified | 2496 |
| 297 | Ga0163161_10012723 | 3300017792 | Bacteria | 5845 |
| 298 | Ga0206355_1514168 | 3300020076 | Bacteria | 3174 |
| 299 | Ga0213872_10002640 | 3300021361 | Bacteria | 10410 |
| 300 | Ga0213872_10105637 | 3300021361 | Bacteria | 1253 |
| 301 | Ga0213874_10039256 | 3300021377 | Bacteria | 1409 |
| 302 | Ga0213876_10000253 | 3300021384 | Bacteria | 50444 |
| 303 | Ga0213876_10001151 | 3300021384 | Bacteria | 16743 |
| 304 | Ga0213876_10051746 | 3300021384 | Bacteria | 2170 |
| 305 | Ga0213876_10099670 | 3300021384 | Bacteria | 1540 |
| 306 | Ga0213876_10135284 | 3300021384 | Bacteria | 1311 |
| 307 | Ga0213871_10020654 | 3300021441 | Bacteria | 1634 |
| 308 | Ga0207666_1001759 | 3300025271 | Bacteria | 2571 |
| 309 | Ga0209050_1000225 | 3300025298 | Bacteria | 125323 |
| 310 | Ga0207697_10000588 | 3300025315 | Bacteria | 20726 |
| 311 | Ga0207697_10000971 | 3300025315 | Bacteria | 16130 |
| 312 | Ga0207697_10001126 | 3300025315 | Bacteria | 14728 |
| 313 | Ga0207697_10001224 | 3300025315 | Bacteria | 14047 |
| 314 | Ga0207697_10008755 | 3300025315 | Bacteria | 4407 |
| 315 | Ga0207697_10013216 | 3300025315 | Unclassified | 3447 |
| 316 | Ga0207697_10031985 | 3300025315 | Unclassified | 2153 |
| 317 | Ga0207697_10055272 | 3300025315 | Bacteria | 1646 |
| 318 | Ga0207697_10139432 | 3300025315 | Unclassified | 1051 |
| 319 | Ga0207692_10058203 | 3300025898 | Unclassified | 1990 |
| 320 | Ga0207688_10010606 | 3300025901 | Bacteria | 5010 |
| 321 | Ga0207688_10040111 | 3300025901 | Bacteria | 2601 |
| 322 | Ga0207680_10197230 | 3300025903 | Unclassified | 1370 |
| 323 | Ga0207680_10323681 | 3300025903 | Bacteria | 1078 |
| 324 | Ga0207647_10019970 | 3300025904 | Unclassified | 4497 |
| 325 | Ga0207699_10013907 | 3300025906 | Bacteria | 4133 |
| 326 | Ga0207645_10000976 | 3300025907 | Bacteria | 23650 |
| 327 | Ga0207645_10002368 | 3300025907 | Bacteria | 14863 |
| 328 | Ga0207645_10074563 | 3300025907 | Unclassified | 2172 |
| 329 | Ga0207645_10245037 | 3300025907 | Bacteria | 1185 |
| 330 | Ga0207705_10007697 | 3300025909 | Bacteria | 7919 |
| 331 | Ga0207705_10183046 | 3300025909 | Bacteria | 1582 |
| 332 | Ga0207684_10000276 | 3300025910 | Bacteria | 75551 |
| 333 | Ga0207684_10001121 | 3300025910 | Bacteria | 29929 |
| 334 | Ga0207684_10003729 | 3300025910 | Bacteria | 14756 |
| 335 | Ga0207684_10027814 | 3300025910 | Bacteria | 4816 |
| 336 | Ga0207684_10340539 | 3300025910 | Unclassified | 1291 |
| 337 | Ga0207707_10022088 | 3300025912 | Bacteria | 5562 |
| 338 | Ga0207695_10000022 | 3300025913 | Bacteria | 659090 |
| 339 | Ga0207695_10022986 | 3300025913 | Bacteria | 7060 |
| 340 | Ga0207695_10154457 | 3300025913 | Bacteria | 2231 |
| 341 | Ga0207695_10254702 | 3300025913 | Bacteria | 1654 |
| 342 | Ga0207693_10002197 | 3300025915 | Bacteria | 17005 |
| 343 | Ga0207693_10082805 | 3300025915 | Bacteria | 2513 |
| 344 | Ga0207693_10132947 | 3300025915 | Bacteria | 1956 |
| 345 | Ga0207663_10000311 | 3300025916 | Bacteria | 21215 |
| 346 | Ga0207663_10015652 | 3300025916 | Unclassified | 4189 |
| 347 | Ga0207663_10025730 | 3300025916 | Bacteria | 3407 |
| 348 | Ga0207663_10036009 | 3300025916 | Bacteria | 2974 |
| 349 | Ga0207663_10490806 | 3300025916 | Unclassified | 953 |
| 350 | Ga0207662_10000226 | 3300025918 | Bacteria | 26114 |
| 351 | Ga0207662_10034428 | 3300025918 | Bacteria | 2956 |
| 352 | Ga0207662_10300462 | 3300025918 | Bacteria | 1067 |
| 353 | Ga0207657_10119684 | 3300025919 | Bacteria | 2167 |
| 354 | Ga0207649_10000716 | 3300025920 | Bacteria | 21824 |
| 355 | Ga0207649_10013978 | 3300025920 | Bacteria | 4491 |
| 356 | Ga0207649_10249616 | 3300025920 | Bacteria | 1277 |
| 357 | Ga0207646_10005760 | 3300025922 | Bacteria | 12982 |
| 358 | Ga0207646_10013358 | 3300025922 | Bacteria | 7857 |
| 359 | Ga0207646_10030576 | 3300025922 | Bacteria | 4879 |
| 360 | Ga0207646_10056564 | 3300025922 | Bacteria | 3505 |
| 361 | Ga0207646_10093028 | 3300025922 | Bacteria | 2699 |
| 362 | Ga0207681_10018045 | 3300025923 | Bacteria | 4439 |
| 363 | Ga0207681_10084732 | 3300025923 | Bacteria | 2248 |
| 364 | Ga0207681_10299848 | 3300025923 | Bacteria | 1271 |
| 365 | Ga0207694_10007009 | 3300025924 | Bacteria | 8557 |
| 366 | Ga0207694_10017549 | 3300025924 | Bacteria | 5411 |
| 367 | Ga0207650_10029039 | 3300025925 | Bacteria | 3971 |
| 368 | Ga0207650_10084107 | 3300025925 | Unclassified | 2418 |
| 369 | Ga0207650_10168317 | 3300025925 | Unclassified | 1740 |
| 370 | Ga0207650_10260920 | 3300025925 | Bacteria | 1405 |
| 371 | Ga0207659_10009476 | 3300025926 | Bacteria | 6088 |
| 372 | Ga0207659_10031596 | 3300025926 | Unclassified | 3626 |
| 373 | Ga0207659_10086875 | 3300025926 | Unclassified | 2327 |
| 374 | Ga0207659_10101180 | 3300025926 | Bacteria | 2173 |
| 375 | Ga0207659_10227298 | 3300025926 | Bacteria | 1503 |
| 376 | Ga0207687_10033830 | 3300025927 | Unclassified | 3468 |
| 377 | Ga0207700_10045183 | 3300025928 | Bacteria | 3248 |
| 378 | Ga0207664_10081457 | 3300025929 | Bacteria | 2634 |
| 379 | Ga0207664_10099006 | 3300025929 | Unclassified | 2405 |
| 380 | Ga0207664_10118958 | 3300025929 | Bacteria | 2208 |
| 381 | Ga0207664_10255707 | 3300025929 | Bacteria | 1530 |
| 382 | Ga0207644_10034307 | 3300025931 | Unclassified | 3550 |
| 383 | Ga0207644_10077245 | 3300025931 | Bacteria | 2452 |
| 384 | Ga0207644_10338342 | 3300025931 | Unclassified | 1220 |
| 385 | Ga0207690_10062553 | 3300025932 | Bacteria | 2534 |
| 386 | Ga0207690_10101568 | 3300025932 | Bacteria | 2055 |
| 387 | Ga0207706_10001556 | 3300025933 | Bacteria | 22738 |
| 388 | Ga0207706_10094025 | 3300025933 | Bacteria | 2637 |
| 389 | Ga0207706_10101830 | 3300025933 | Bacteria | 2527 |
| 390 | Ga0207706_10136412 | 3300025933 | Bacteria | 2158 |
| 391 | Ga0207686_10231704 | 3300025934 | Bacteria | 1339 |
| 392 | Ga0207709_10000407 | 3300025935 | Bacteria | 42024 |
| 393 | Ga0207709_10001248 | 3300025935 | Bacteria | 18270 |
| 394 | Ga0207670_10002689 | 3300025936 | Bacteria | 9347 |
| 395 | Ga0207670_10079402 | 3300025936 | Unclassified | 2291 |
| 396 | Ga0207670_10082033 | 3300025936 | Bacteria | 2259 |
| 397 | Ga0207670_10196254 | 3300025936 | Bacteria | 1530 |
| 398 | Ga0207670_10321437 | 3300025936 | Bacteria | 1218 |
| 399 | Ga0207669_10058476 | 3300025937 | Bacteria | 2352 |
| 400 | Ga0207669_10262931 | 3300025937 | Unclassified | 1291 |
| 401 | Ga0207665_10065606 | 3300025939 | Unclassified | 2469 |
| 402 | Ga0207665_10068290 | 3300025939 | Bacteria | 2422 |
| 403 | Ga0207665_10296442 | 3300025939 | Bacteria | 1207 |
| 404 | Ga0207691_10069706 | 3300025940 | Unclassified | 3176 |
| 405 | Ga0207661_10116184 | 3300025944 | Bacteria | 2271 |
| 406 | Ga0207661_10170762 | 3300025944 | Bacteria | 1893 |
| 407 | Ga0207679_10006349 | 3300025945 | Bacteria | 7470 |
| 408 | Ga0207667_10004393 | 3300025949 | Bacteria | 17267 |
| 409 | Ga0207667_10068169 | 3300025949 | Bacteria | 3705 |
| 410 | Ga0207667_10255515 | 3300025949 | Bacteria | 1792 |
| 411 | Ga0207667_10544182 | 3300025949 | Bacteria | 1175 |
| 412 | Ga0207651_10076720 | 3300025960 | Unclassified | 2390 |
| 413 | Ga0207651_10078568 | 3300025960 | Bacteria | 2367 |
| 414 | Ga0207651_10188530 | 3300025960 | Unclassified | 1643 |
| 415 | Ga0207651_10343605 | 3300025960 | Bacteria | 1254 |
| 416 | Ga0207651_10371105 | 3300025960 | Unclassified | 1210 |
| 417 | Ga0207712_10008366 | 3300025961 | Bacteria | 6538 |
| 418 | Ga0207668_10029176 | 3300025972 | Bacteria | 3614 |
| 419 | Ga0207668_10035542 | 3300025972 | Bacteria | 3318 |
| 420 | Ga0207668_10238998 | 3300025972 | Bacteria | 1468 |
| 421 | Ga0207658_10015864 | 3300025986 | Bacteria | 5172 |
| 422 | Ga0207658_10114244 | 3300025986 | Bacteria | 2140 |
| 423 | Ga0207658_10126617 | 3300025986 | Bacteria | 2045 |
| 424 | Ga0207658_10194568 | 3300025986 | Unclassified | 1688 |
| 425 | Ga0207658_10199903 | 3300025986 | Bacteria | 1668 |
| 426 | Ga0207677_10049537 | 3300026023 | Bacteria | 2835 |
| 427 | Ga0207677_10049775 | 3300026023 | Unclassified | 2830 |
| 428 | Ga0207677_10351136 | 3300026023 | Unclassified | 1236 |
| 429 | Ga0207703_10034768 | 3300026035 | Bacteria | 4001 |
| 430 | Ga0207703_10049662 | 3300026035 | Bacteria | 3392 |
| 431 | Ga0207703_10261692 | 3300026035 | Bacteria | 1564 |
| 432 | Ga0207639_10000012 | 3300026041 | Bacteria | 344067 |
| 433 | Ga0207678_10004819 | 3300026067 | Bacteria | 12116 |
| 434 | Ga0207708_10070349 | 3300026075 | Bacteria | 2679 |
| 435 | Ga0207702_10007889 | 3300026078 | Bacteria | 9026 |
| 436 | Ga0207702_10030806 | 3300026078 | Unclassified | 4469 |
| 437 | Ga0207702_10158448 | 3300026078 | Unclassified | 2065 |
| 438 | Ga0207702_10220214 | 3300026078 | Bacteria | 1768 |
| 439 | Ga0207702_10227830 | 3300026078 | Bacteria | 1740 |
| 440 | Ga0207641_10029953 | 3300026088 | Bacteria | 4503 |
| 441 | Ga0207641_10195468 | 3300026088 | Bacteria | 1862 |
| 442 | Ga0207641_10243465 | 3300026088 | Bacteria | 1677 |
| 443 | Ga0207648_10007911 | 3300026089 | Bacteria | 10365 |
| 444 | Ga0207648_10065936 | 3300026089 | Bacteria | 3157 |
| 445 | Ga0207648_10402825 | 3300026089 | Bacteria | 1240 |
| 446 | Ga0207674_10070922 | 3300026116 | Bacteria | 3503 |
| 447 | Ga0207683_10003154 | 3300026121 | Bacteria | 14397 |
| 448 | Ga0207683_10039078 | 3300026121 | Bacteria | 4139 |
| 449 | Ga0207683_10048248 | 3300026121 | Bacteria | 3729 |
| 450 | Ga0207683_10289318 | 3300026121 | Bacteria | 1498 |
| 451 | Ga0268266_10017501 | 3300028379 | Bacteria | 6113 |
| 452 | Ga0268266_10188719 | 3300028379 | Bacteria | 1881 |
| 453 | Ga0268266_10347235 | 3300028379 | Bacteria | 1394 |
| 454 | Ga0268264_10000490 | 3300028381 | Bacteria | 52433 |
| 455 | Ga0268264_10012947 | 3300028381 | Bacteria | 6859 |
| 456 | Ga0268264_10122236 | 3300028381 | Bacteria | 2296 |
| 457 | Ga0268264_10409847 | 3300028381 | Unclassified | 1305 |
| 458 | Ga0265337_1000557 | 3300028556 | Bacteria | 19622 |
| 459 | Ga0265337_1006696 | 3300028556 | Bacteria | 4399 |
| 460 | Ga0265319_1000179 | 3300028563 | Bacteria | 48318 |
| 461 | Ga0265319_1015602 | 3300028563 | Bacteria | 2940 |
| 462 | Ga0265334_10036442 | 3300028573 | Bacteria | 1942 |
| 463 | Ga0265318_10077917 | 3300028577 | Unclassified | 1225 |
| 464 | Ga0265323_10009094 | 3300028653 | Bacteria | 4075 |
| 465 | Ga0265323_10065356 | 3300028653 | Bacteria | 1255 |
| 466 | Ga0265322_10002988 | 3300028654 | Bacteria | 5146 |
| 467 | Ga0265336_10000520 | 3300028666 | Bacteria | 22239 |
| 468 | Ga0265336_10035461 | 3300028666 | Bacteria | 1538 |
| 469 | Ga0265338_10000008 | 3300028800 | Bacteria | 481542 |
| 470 | Ga0265338_10000210 | 3300028800 | Bacteria | 107885 |
| 471 | Ga0265338_10000248 | 3300028800 | Bacteria | 98976 |
| 472 | Ga0265338_10000269 | 3300028800 | Bacteria | 95081 |
| 473 | Ga0265338_10000652 | 3300028800 | Bacteria | 59926 |
| 474 | Ga0265338_10000774 | 3300028800 | Bacteria | 54489 |
| 475 | Ga0265338_10001504 | 3300028800 | Bacteria | 37705 |
| 476 | Ga0265338_10005506 | 3300028800 | Bacteria | 16502 |
| 477 | Ga0265338_10014273 | 3300028800 | Bacteria | 8854 |
| 478 | Ga0265338_10015897 | 3300028800 | Bacteria | 8234 |
| 479 | Ga0265338_10018803 | 3300028800 | Bacteria | 7371 |
| 480 | Ga0265338_10024645 | 3300028800 | Bacteria | 6139 |
| 481 | Ga0265338_10060900 | 3300028800 | Bacteria | 3311 |
| 482 | Ga0265324_10000319 | 3300029957 | Bacteria | 35387 |
| 483 | Ga0265324_10000975 | 3300029957 | Bacteria | 17727 |
| 484 | Ga0265328_10006569 | 3300031239 | Bacteria | 4902 |
| 485 | Ga0265320_10000501 | 3300031240 | Bacteria | 30510 |
| 486 | Ga0265320_10000683 | 3300031240 | Bacteria | 25874 |
| 487 | Ga0265320_10045857 | 3300031240 | Bacteria | 2145 |
| 488 | Ga0265320_10058820 | 3300031240 | Bacteria | 1839 |
| 489 | Ga0265320_10097340 | 3300031240 | Bacteria | 1357 |
| 490 | Ga0265325_10008471 | 3300031241 | Bacteria | 6067 |
| 491 | Ga0265325_10022606 | 3300031241 | Bacteria | 3442 |
| 492 | Ga0265329_10000449 | 3300031242 | Bacteria | 21635 |
| 493 | Ga0265340_10006049 | 3300031247 | Bacteria | 6672 |
| 494 | Ga0265339_10025191 | 3300031249 | Bacteria | 3418 |
| 495 | Ga0265339_10031631 | 3300031249 | Bacteria | 2989 |
| 496 | Ga0265331_10017179 | 3300031250 | Bacteria | 3780 |
| 497 | Ga0265327_10002552 | 3300031251 | Bacteria | 18929 |
| 498 | Ga0265327_10007710 | 3300031251 | Bacteria | 8234 |
| 499 | Ga0265316_10001824 | 3300031344 | Bacteria | 22401 |
| 500 | Ga0265316_10020997 | 3300031344 | Bacteria | 5542 |
| 501 | Ga0265316_10047577 | 3300031344 | Bacteria | 3392 |
| 502 | Ga0265316_10055099 | 3300031344 | Bacteria | 3112 |
| 503 | Ga0265316_10116025 | 3300031344 | Bacteria | 2024 |
| 504 | Ga0265316_10413330 | 3300031344 | Bacteria | 970 |
| 505 | Ga0307408_100000070 | 3300031548 | Bacteria | 119377 |
| 506 | Ga0307408_100015236 | 3300031548 | Bacteria | 5118 |
| 507 | Ga0265314_10000031 | 3300031711 | Bacteria | 265924 |
| 508 | Ga0265314_10053577 | 3300031711 | Bacteria | 2797 |
| 509 | Ga0265314_10093476 | 3300031711 | Bacteria | 1952 |
| 510 | Ga0265314_10105115 | 3300031711 | Bacteria | 1806 |
| 511 | Ga0265314_10153364 | 3300031711 | Bacteria | 1410 |
| 512 | Ga0265342_10035866 | 3300031712 | Bacteria | 3032 |
| 513 | Ga0307406_10000169 | 3300031901 | Bacteria | 39159 |
| 514 | Ga0307406_10091012 | 3300031901 | Bacteria | 2054 |
| 515 | Ga0307407_10000121 | 3300031903 | Bacteria | 25084 |
| 516 | Ga0307412_10000396 | 3300031911 | Bacteria | 26833 |
| 517 | Ga0307409_100001052 | 3300031995 | Bacteria | 12935 |
| 518 | Ga0307416_100072833 | 3300032002 | Bacteria | 2861 |
| 519 | Ga0307414_10000029 | 3300032004 | Bacteria | 191305 |
| 520 | Ga0373930_0002600 | 3300034816 | Bacteria | 2805 |
| 521 | Ga0373950_0006569 | 3300034818 | Bacteria | 1778 |
| 522 | Ga0373928_0000050 | 3300035084 | Bacteria | 20631 |
| 523 | Ga0373929_0001691 | 3300035085 | Bacteria | 4152 |
| 524 | Ga0373944_0002853 | 3300035089 | Bacteria | 4423 |
| 525 | Ga0373944_0012950 | 3300035089 | Bacteria | 2307 |
| 526 | Ga0373949_0001510 | 3300035090 | Bacteria | 6603 |
| 527 | Ga0373932_0000003 | 3300035112 | Bacteria | 459351 |
| 528 | Ga0373936_0112393 | 3300035113 | Bacteria | 1158 |
| 529 | Ga0373939_0004412 | 3300035114 | Bacteria | 3325 |
| 530 | Ga0373954_0001465 | 3300035118 | Bacteria | 9598 |
| 531 | Ga0373954_0038415 | 3300035118 | Bacteria | 2227 |
| 532 | Ga0373943_0034222 | 3300035170 | Bacteria | 2423 |
| 533 | Ga0373943_0168429 | 3300035170 | Unclassified | 1197 |
| 534 | Ga0373955_0155462 | 3300035172 | Bacteria | 1347 |
| 535 | Ga0373961_0087683 | 3300035241 | Bacteria | 989 |
| 536 | Ga0373962_0000141 | 3300035242 | Bacteria | 14956 |
| 537 | Ga0316574_0031651 | 3300035398 | Bacteria | 3210 |
| 538 | Ga0373931_0000017 | 3300035691 | Bacteria | 207733 |
| 539 | Ga0373931_0129245 | 3300035691 | Bacteria | 1452 |
| 540 | Ga0373935_0011676 | 3300035692 | Bacteria | 5275 |
| 541 | Ga0373935_0022090 | 3300035692 | Bacteria | 3898 |
| 542 | Ga0373935_0103677 | 3300035692 | Bacteria | 1879 |
| 543 | Ga0373927_0008040 | 3300035695 | Bacteria | 7122 |
| 544 | Ga0373927_0120107 | 3300035695 | Bacteria | 1715 |
| 545 | Ga0373933_0289067 | 3300035724 | Bacteria | 1060 |
| 546 | Ga0373947_0110016 | 3300035725 | Bacteria | 1740 |
| 547 | Ga0373947_0132159 | 3300035725 | Bacteria | 1594 |
| 548 | Ga0373937_0006245 | 3300036401 | Bacteria | 10276 |
| 549 | Ga0373925_0001786 | 3300037068 | Bacteria | 17953 |
| 550 | Ga0373925_0286580 | 3300037068 | Bacteria | 1327 |
| 551 | Ga0395899_0041168 | 3300037312 | Unclassified | 3453 |
| 552 | Ga0395898_0000539 | 3300037466 | Bacteria | 71975 |
| 553 | Ga0395898_0010108 | 3300037466 | Bacteria | 9876 |
| 554 | Ga0395898_0445740 | 3300037466 | Bacteria | 1233 |
| 555 | Ga0395905_0144190 | 3300037471 | Unclassified | 2241 |
| 556 | Ga0436364_1116390 | 3300037853 | Bacteria | 4334 |
| 557 | Ga0395901_0127841 | 3300038443 | Unclassified | 2671 |
| 558 | Ga0436365_1021998 | 3300039437 | Bacteria | 1814 |
| 559 | Ga0436365_1508062 | 3300039437 | Bacteria | 22768 |
| 560 | Ga0436365_1788700 | 3300039437 | Bacteria | 67528 |
| 561 | Ga0436360_0313800 | 3300039438 | Bacteria | 2357 |
| 562 | Ga0436360_0663054 | 3300039438 | Unclassified | 2163 |
| 563 | Ga0436360_1111282 | 3300039438 | Unclassified | 1828 |
| 564 | Ga0436361_0024322 | 3300039447 | Bacteria | 1421 |
| 565 | Ga0436361_0346675 | 3300039447 | Bacteria | 3754 |
| 566 | Ga0436361_0420319 | 3300039447 | Bacteria | 4686 |
| 567 | Ga0436361_0558325 | 3300039447 | Bacteria | 4898 |
| 568 | Ga0436361_0690497 | 3300039447 | Bacteria | 1226 |
| 569 | Ga0436362_0945614 | 3300039453 | Bacteria | 1751 |
| 570 | Ga0436362_1173039 | 3300039453 | Bacteria | 1970 |
| 571 | Ga0436362_1264546 | 3300039453 | Bacteria | 1277 |
| 572 | Ga0439453_0000706 | 3300041408 | Bacteria | 3846 |
| 573 | Ga0439437_009729 | 3300042000 | Bacteria | 1091 |
| 574 | Ga0450890_000002 | 3300042127 | Bacteria | 117614 |
| 575 | Ga0450892_000048 | 3300042130 | Bacteria | 12911 |
| 576 | Ga0439458_0007525 | 3300042157 | Bacteria | 2425 |
| 577 | Ga0439464_0049091 | 3300042439 | Unclassified | 1217 |
| 578 | Ga0451577_0001681 | 3300042876 | Bacteria | 28578 |
| 579 | Ga0451577_0356961 | 3300042876 | Bacteria | 1326 |
| 580 | Ga0451577_0401649 | 3300042876 | Bacteria | 1244 |
| 581 | Ga0466965_0007362 | 3300044683 | Bacteria | 5050 |
| 582 | Ga0466964_0010000 | 3300044706 | Bacteria | 3575 |
| 583 | Ga0453684_0063537 | 3300044712 | Bacteria | 4722 |
| 584 | Ga0466971_0000072 | 3300044719 | Bacteria | 37014 |
| 585 | Ga0466957_0017711 | 3300044842 | Bacteria | 4177 |
| 586 | Ga0451576_0039206 | 3300045051 | Bacteria | 5014 |
| 587 | Ga0451576_0116774 | 3300045051 | Bacteria | 2778 |
| 588 | Ga0451576_0176973 | 3300045051 | Unclassified | 2227 |
| 589 | Ga0451576_0201488 | 3300045051 | Bacteria | 2079 |
| 590 | Ga0451576_0340533 | 3300045051 | Bacteria | 1570 |
| 591 | Ga0495592_0000054 | 3300046454 | Bacteria | 107373 |
| 592 | Ga0495592_0133511 | 3300046454 | Bacteria | 1734 |
| 593 | Ga0495651_0024862 | 3300046462 | Bacteria | 4660 |
| 594 | Ga0495662_0010383 | 3300046476 | Bacteria | 4561 |
| 595 | Ga0495664_0114271 | 3300046477 | Bacteria | 1631 |
| 596 | Ga0495618_0002303 | 3300046514 | Bacteria | 12371 |
| 597 | Ga0495618_0004029 | 3300046514 | Bacteria | 9057 |
| 598 | Ga0495628_0015266 | 3300046516 | Bacteria | 6416 |
| 599 | Ga0495628_0069233 | 3300046516 | Bacteria | 2752 |
| 600 | Ga0495628_0098302 | 3300046516 | Bacteria | 2261 |
| 601 | Ga0495630_0057296 | 3300046517 | Bacteria | 2920 |
| 602 | Ga0495630_0070115 | 3300046517 | Bacteria | 2637 |
| 603 | Ga0495643_0000169 | 3300046522 | Bacteria | 103635 |
| 604 | Ga0495666_0048120 | 3300046526 | Unclassified | 2054 |
| 605 | Ga0495666_0103299 | 3300046526 | Bacteria | 1342 |
| 606 | Ga0495642_0029357 | 3300046528 | Bacteria | 2195 |
| 607 | Ga0495652_0065364 | 3300046529 | Bacteria | 3057 |
| 608 | Ga0495652_0360964 | 3300046529 | Bacteria | 1038 |
| 609 | Ga0495640_0128849 | 3300046533 | Bacteria | 1639 |
| 610 | Ga0495586_0000670 | 3300046535 | Bacteria | 19540 |
| 611 | Ga0495586_0002170 | 3300046535 | Bacteria | 10672 |
| 612 | Ga0495587_0069297 | 3300046536 | Bacteria | 2054 |
| 613 | Ga0495645_0001139 | 3300046543 | Bacteria | 18013 |
| 614 | Ga0495645_0098224 | 3300046543 | Bacteria | 2084 |
| 615 | Ga0495645_0146131 | 3300046543 | Bacteria | 1647 |
| 616 | Ga0495634_0001299 | 3300046642 | Bacteria | 22825 |
| 617 | Ga0495635_0163031 | 3300046663 | Unclassified | 1517 |
| 618 | Ga0495599_0007170 | 3300046678 | Bacteria | 6750 |
| 619 | Ga0495599_0061081 | 3300046678 | Bacteria | 2355 |
| 620 | Ga0495599_0070646 | 3300046678 | Bacteria | 2179 |
| 621 | Ga0495647_0123497 | 3300046681 | Unclassified | 1091 |
| 622 | Ga0495613_0003308 | 3300046689 | Bacteria | 12067 |
| 623 | Ga0495604_0172423 | 3300047317 | Bacteria | 1520 |
| 624 | Ga0495674_0028557 | 3300047319 | Bacteria | 5084 |
| 625 | Ga0495674_0102272 | 3300047319 | Bacteria | 2437 |
| 626 | Ga0495674_0445213 | 3300047319 | Bacteria | 1041 |
| 627 | Ga0495676_0097600 | 3300047321 | Unclassified | 2182 |
| 628 | Ga0495675_0130960 | 3300047444 | Bacteria | 1559 |
| 629 | Ga0495684_0066245 | 3300047471 | Bacteria | 2746 |
| 630 | Ga0495684_0155579 | 3300047471 | Bacteria | 1708 |
| 631 | Ga0496100_0089341 | 3300048903 | Bacteria | 2099 |
| 632 | Ga0496102_0034391 | 3300048905 | Bacteria | 4557 |
| 633 | Ga0496104_0118755 | 3300048907 | Bacteria | 2539 |
| 634 | Ga0496104_0531716 | 3300048907 | Unclassified | 1087 |
| 635 | Ga0496106_0018251 | 3300048909 | Bacteria | 5187 |
| 636 | Ga0496106_0189648 | 3300048909 | Bacteria | 1634 |
| 637 | Ga0496106_0326334 | 3300048909 | Bacteria | 1232 |
| 638 | Ga0496107_0012270 | 3300048910 | Bacteria | 5980 |
| 639 | Ga0496107_0093490 | 3300048910 | Bacteria | 2199 |
| 640 | Ga0496108_0019559 | 3300048911 | Bacteria | 5562 |
| 641 | Ga0496108_0102834 | 3300048911 | Unclassified | 2438 |
| 642 | Ga0496109_0012074 | 3300048912 | Bacteria | 7443 |
| 643 | Ga0496110_0099903 | 3300048913 | Bacteria | 2601 |
| 644 | Ga0496111_0191926 | 3300048914 | Bacteria | 1519 |
| 645 | Ga0496111_0255672 | 3300048914 | Bacteria | 1300 |
| 646 | Ga0496112_0087601 | 3300048915 | Unclassified | 3081 |
| 647 | Ga0496112_0153029 | 3300048915 | Bacteria | 2274 |
| 648 | Ga0496112_0180885 | 3300048915 | Bacteria | 2072 |
| 649 | Ga0496112_0308850 | 3300048915 | Bacteria | 1527 |
| 650 | Ga0496112_0429651 | 3300048915 | Unclassified | 1259 |
| 651 | Ga0496112_0680933 | 3300048915 | Bacteria | 957 |
| 652 | Ga0496113_0132375 | 3300048916 | Bacteria | 1958 |
| 653 | Ga0496113_0165434 | 3300048916 | Unclassified | 1750 |
| 654 | Ga0496115_0007891 | 3300048918 | Bacteria | 7852 |
| 655 | Ga0496115_0059318 | 3300048918 | Unclassified | 3081 |
| 656 | Ga0496115_0281956 | 3300048918 | Bacteria | 1364 |
| 657 | Ga0496121_0080873 | 3300048924 | Bacteria | 2574 |
| 658 | Ga0496125_0000102 | 3300048928 | Bacteria | 201692 |
| 659 | Ga0501031_0000012 | 3300049568 | Bacteria | 137943 |
| 660 | Ga0501031_0168897 | 3300049568 | Unclassified | 1429 |
| 661 | Ga0501032_0000441 | 3300049569 | Bacteria | 34085 |
| 662 | Ga0501032_0007268 | 3300049569 | Bacteria | 8101 |
| 663 | Ga0501033_0000018 | 3300049570 | Bacteria | 205482 |
| 664 | Ga0501033_0002389 | 3300049570 | Bacteria | 15988 |
| 665 | Ga0501033_0027773 | 3300049570 | Bacteria | 4254 |
| 666 | Ga0501037_0144755 | 3300049573 | Bacteria | 1700 |
| 667 | Ga0501038_0001861 | 3300049574 | Bacteria | 19481 |
| 668 | Ga0501038_0006224 | 3300049574 | Bacteria | 11034 |
| 669 | Ga0501039_0006972 | 3300049575 | Bacteria | 8606 |
| 670 | Ga0501043_0042069 | 3300049579 | Bacteria | 3589 |
| 671 | Ga0501043_0174909 | 3300049579 | Unclassified | 1674 |
| 672 | Ga0501046_0165224 | 3300049580 | Bacteria | 1663 |
| 673 | Ga0501047_0001289 | 3300049581 | Bacteria | 24753 |
| 674 | Ga0501070_0018105 | 3300049586 | Bacteria | 5909 |
| 675 | Ga0501070_0156970 | 3300049586 | Bacteria | 1876 |
| 676 | Ga0501070_0185720 | 3300049586 | Bacteria | 1710 |
| 677 | Ga0501257_019234 | 3300049686 | Bacteria | 1597 |
| 678 | Ga0501080_0021554 | 3300049742 | Bacteria | 5964 |
| 679 | Ga0501080_0059118 | 3300049742 | Bacteria | 3568 |
| 680 | Ga0501035_0000002 | 3300049822 | Bacteria | 585447 |
| 681 | Ga0501035_0001290 | 3300049822 | Bacteria | 25869 |
| 682 | Ga0501035_0002720 | 3300049822 | Bacteria | 17169 |
| 683 | Ga0501044_0000024 | 3300049823 | Bacteria | 194302 |
| 684 | Ga0501044_0001541 | 3300049823 | Bacteria | 27035 |
| 685 | nmdc:mga03683_141_c1 | 3300050489 | Bacteria | 24374 |
| 686 | nmdc:mga03n38_163466_c1 | 3300050490 | Viruses | 1129 |
| 687 | nmdc:mga0k408_11319_c1 | 3300050493 | Bacteria | 4855 |
| 688 | nmdc:mga0k408_636_c1 | 3300050493 | Bacteria | 19345 |
| 689 | nmdc:mga06r32_20384_c1 | 3300050510 | Bacteria | 6104 |
| 690 | nmdc:mga08y16_184179_c1 | 3300050511 | Unclassified | 2167 |
| 691 | nmdc:mga08y16_291175_c1 | 3300050511 | Unclassified | 1683 |
| 692 | nmdc:mga0n895_289904_c1 | 3300050512 | Bacteria | 1659 |
| 693 | nmdc:mga08x19_20679_c1 | 3300050514 | Bacteria | 4054 |
| 694 | Ga0500555_000044 | 3300053103 | Bacteria | 64435 |
| 695 | Ga0500556_0000010 | 3300053104 | Bacteria | 258288 |
| 696 | Ga0500556_0010796 | 3300053104 | Bacteria | 2688 |
| 697 | Ga0500642_0039191 | 3300053130 | Bacteria | 2036 |
| 698 | Ga0500559_0001396 | 3300053136 | Bacteria | 13742 |
| 699 | Ga0500568_0026447 | 3300053139 | Bacteria | 2435 |
| 700 | Ga0500616_0005714 | 3300053153 | Bacteria | 8373 |
| 701 | Ga0466962_0000139 | 3300061719 | Bacteria | 29705 |
| 702 | 2718716359 | 2718217752 | Bacteria | 915884 |
| 703 | 2787507649 | 2786546548 | Bacteria | 4745694 |
| 704 | Ga0070664_100003479 | |||
| 705 | CNXas_1000010 | |||
| 706 | JGI24746J21847_1002232 | |||
| 707 | JGI24737J22298_10049526 | |||
| 708 | JGI24743J22301_10000180 | |||
| 709 | JGI24033J26618_1000267 | |||
| 710 | JGI24742J22300_10001701 | |||
| 711 | rootH2_10016017 | |||
| 712 | rootH2_10064210 | |||
| 713 | rootH2_10284222 | |||
| 714 | rootH1_10003502 | |||
| 715 | JGI25405J52794_10000432 | |||
| 716 | Ga0065704_10009461 | |||
| 717 | Ga0065704_10011242 | |||
| 718 | Ga0065704_10098924 | |||
| 719 | Ga0065712_10080155 | |||
| 720 | Ga0065712_10084596 | |||
| 721 | Ga0065712_10124906 | |||
| 722 | Ga0065715_10137461 | |||
| 723 | Ga0065715_10179505 | |||
| 724 | Ga0065707_10004617 | |||
| 725 | Ga0065707_10010686 | |||
| 726 | Ga0065707_10203773 | |||
| 727 | Ga0065707_10210827 | |||
| 728 | Ga0070676_10001595 | |||
| 729 | Ga0070676_10036141 | |||
| 730 | Ga0070676_10104584 | |||
| 731 | Ga0070683_100032539 | |||
| 732 | Ga0070683_100152477 | |||
| 733 | Ga0070690_100004714 | |||
| 734 | Ga0070690_100044685 | |||
| 735 | Ga0070690_100156137 | |||
| 736 | Ga0070670_100002866 | |||
| 737 | Ga0070670_100035915 | |||
| 738 | Ga0070670_100392042 | |||
| 739 | Ga0070666_10064858 | |||
| 740 | Ga0068868_100013546 | |||
| 741 | Ga0068868_100124611 | |||
| 742 | Ga0068868_100168499 | |||
| 743 | Ga0070660_100049744 | |||
| 744 | Ga0070660_100141896 | |||
| 745 | Ga0070689_100032997 | |||
| 746 | Ga0070689_100038101 | |||
| 747 | Ga0070689_100081492 | |||
| 748 | Ga0070689_100238321 | |||
| 749 | Ga0070689_100384011 | |||
| 750 | Ga0070691_10012273 | |||
| 751 | Ga0070687_100021823 | |||
| 752 | Ga0070687_100023175 | |||
| 753 | Ga0070661_100000512 | |||
| 754 | Ga0070668_100042021 | |||
| 755 | Ga0070668_100050534 | |||
| 756 | Ga0070668_100141923 | |||
| 757 | Ga0070668_100172130 | |||
| 758 | Ga0070668_100224397 | |||
| 759 | Ga0070668_100453316 | |||
| 760 | Ga0070669_100001514 | |||
| 761 | Ga0070669_100008387 | |||
| 762 | Ga0070669_100072636 | |||
| 763 | Ga0070675_100001376 | |||
| 764 | Ga0070675_100004395 | |||
| 765 | Ga0070675_100090333 | |||
| 766 | Ga0070675_100092576 | |||
| 767 | Ga0070675_100132816 | |||
| 768 | Ga0070675_100170940 | |||
| 769 | Ga0070675_100414813 | |||
| 770 | Ga0070671_100019012 | |||
| 771 | Ga0070671_100224947 | |||
| 772 | Ga0070671_100274268 | |||
| 773 | Ga0070671_100366439 | |||
| 774 | Ga0070671_100415123 | |||
| 775 | Ga0070674_100088541 | |||
| 776 | Ga0070674_100236682 | |||
| 777 | Ga0070674_100246615 | |||
| 778 | Ga0070674_100310633 | |||
| 779 | Ga0070673_100119263 | |||
| 780 | Ga0070673_100192715 | |||
| 781 | Ga0070673_100213348 | |||
| 782 | Ga0070688_100025475 | |||
| 783 | Ga0070688_100043444 | |||
| 784 | Ga0070659_100041310 | |||
| 785 | Ga0070659_100070468 | |||
| 786 | Ga0070667_100066880 | |||
| 787 | Ga0070667_100076832 | |||
| 788 | Ga0070667_100100989 | |||
| 789 | Ga0070667_100280219 | |||
| 790 | Ga0070709_10010292 | |||
| 791 | Ga0070709_10295105 | |||
| 792 | Ga0070714_100022507 | |||
| 793 | Ga0070714_100080275 | |||
| 794 | Ga0070714_100105244 | |||
| 795 | Ga0070713_100044943 | |||
| 796 | Ga0070713_100056786 | |||
| 797 | Ga0070710_10016962 | |||
| 798 | Ga0070701_10007999 | |||
| 799 | Ga0070711_100000735 | |||
| 800 | Ga0070711_100001885 | |||
| 801 | Ga0070705_100076845 | |||
| 802 | Ga0070708_100029133 | |||
| 803 | Ga0070708_100029720 | |||
| 804 | Ga0070708_100278920 | |||
| 805 | Ga0070708_100310458 | |||
| 806 | Ga0070663_100035045 | |||
| 807 | Ga0070678_100011508 | |||
| 808 | Ga0070678_100097756 | |||
| 809 | Ga0070662_100011759 | |||
| 810 | Ga0070662_100034437 | |||
| 811 | Ga0070662_100178212 | |||
| 812 | Ga0070681_10019854 | |||
| 813 | Ga0068867_100000121 | |||
| 814 | Ga0068867_100156939 | |||
| 815 | Ga0070685_10075523 | |||
| 816 | Ga0070706_100000339 | |||
| 817 | Ga0070706_100001168 | |||
| 818 | Ga0070706_100003751 | |||
| 819 | Ga0070706_100079329 | |||
| 820 | Ga0070707_100001522 | |||
| 821 | Ga0070707_100010843 | |||
| 822 | Ga0070707_100056296 | |||
| 823 | Ga0070707_100080316 | |||
| 824 | Ga0070707_100106426 | |||
| 825 | Ga0070707_100175217 | |||
| 826 | Ga0070707_100175503 | |||
| 827 | Ga0070707_100525064 | |||
| 828 | Ga0070698_100001525 | |||
| 829 | Ga0070698_100004367 | |||
| 830 | Ga0070698_100018823 | |||
| 831 | Ga0070698_100030526 | |||
| 832 | Ga0070698_100234988 | |||
| 833 | Ga0070699_100042974 | |||
| 834 | Ga0070699_100078433 | |||
| 835 | Ga0070699_100090764 | |||
| 836 | Ga0070699_100155645 | |||
| 837 | Ga0070684_100259022 | |||
| 838 | Ga0070684_100262337 | |||
| 839 | Ga0070697_100019502 | |||
| 840 | Ga0070697_100076188 | |||
| 841 | Ga0070697_100194928 | |||
| 842 | Ga0068853_100000075 | |||
| 843 | Ga0068853_100147409 | |||
| 844 | Ga0070672_100008263 | |||
| 845 | Ga0070672_100080856 | |||
| 846 | Ga0070686_100004345 | |||
| 847 | Ga0070686_100253831 | |||
| 848 | Ga0070686_100309861 | |||
| 849 | Ga0070695_100124592 | |||
| 850 | Ga0070665_100006037 | |||
| 851 | Ga0070665_100080903 | |||
| 852 | Ga0070665_100119558 | |||
| 853 | Ga0070665_100249192 | |||
| 854 | Ga0070665_100321591 | |||
| 855 | Ga0070704_100055642 | |||
| 856 | Ga0070704_100125279 | |||
| 857 | Ga0068855_100007043 | |||
| 858 | Ga0068855_100084103 | |||
| 859 | Ga0068855_100238085 | |||
| 860 | Ga0068855_100701618 | |||
| 861 | Ga0070664_100069368 | |||
| 862 | Ga0070664_100171104 | |||
| 863 | Ga0068857_100126083 | |||
| 864 | Ga0068854_100070375 | |||
| 865 | Ga0068856_100001437 | |||
| 866 | Ga0068856_100003901 | |||
| 867 | Ga0068856_100054103 | |||
| 868 | Ga0068856_100289515 | |||
| 869 | Ga0068856_100441415 | |||
| 870 | Ga0068859_100330914 | |||
| 871 | Ga0068864_100031005 | |||
| 872 | Ga0068864_100346657 | |||
| 873 | Ga0068863_100031706 | |||
| 874 | Ga0068863_100119083 | |||
| 875 | Ga0068863_100282565 | |||
| 876 | Ga0068863_100373542 | |||
| 877 | Ga0068858_100011167 | |||
| 878 | Ga0068858_100066720 | |||
| 879 | Ga0068860_100000335 | |||
| 880 | Ga0068860_100017681 | |||
| 881 | Ga0068860_100129699 | |||
| 882 | Ga0068860_100279531 | |||
| 883 | Ga0068860_100454202 | |||
| 884 | Ga0068862_100011766 | |||
| 885 | Ga0081455_10000171 | |||
| 886 | Ga0081455_10003966 | |||
| 887 | Ga0081455_10009921 | |||
| 888 | Ga0081455_10042131 | |||
| 889 | Ga0081455_10109413 | |||
| 890 | Ga0081455_10152931 | |||
| 891 | Ga0081538_10060910 | |||
| 892 | Ga0081540_1000225 | |||
| 893 | Ga0081540_1010358 | |||
| 894 | Ga0081540_1012037 | |||
| 895 | Ga0081539_10000098 | |||
| 896 | Ga0081539_10004649 | |||
| 897 | Ga0081539_10058818 | |||
| 898 | Ga0081539_10076733 | |||
| 899 | Ga0070717_10011824 | |||
| 900 | Ga0070717_10024005 | |||
| 901 | Ga0070717_10086925 | |||
| 902 | Ga0070717_10090738 | |||
| 903 | Ga0070717_10107223 | |||
| 904 | Ga0070717_10402752 | |||
| 905 | Ga0075363_100043952 | |||
| 906 | Ga0070716_100101978 | |||
| 907 | Ga0070716_100252840 | |||
| 908 | Ga0070716_100418380 | |||
| 909 | Ga0075362_10000544 | |||
| 910 | Ga0097621_100009753 | |||
| 911 | Ga0097621_100023334 | |||
| 912 | Ga0075370_10039868 | |||
| 913 | Ga0068871_100127430 | |||
| 914 | Ga0068871_100286693 | |||
| 915 | Ga0068871_100433924 | |||
| 916 | Ga0075431_100032699 | |||
| 917 | Ga0075433_10228023 | |||
| 918 | Ga0075433_10313266 | |||
| 919 | Ga0075434_100167470 | |||
| 920 | Ga0075434_100214968 | |||
| 921 | Ga0075436_100114222 | |||
| 922 | Ga0097620_100330908 | |||
| 923 | Ga0075435_100043321 | |||
| 924 | Ga0075435_100236514 | |||
| 925 | Ga0075435_100444977 | |||
| 926 | Ga0105240_10000124 | |||
| 927 | Ga0105240_10006802 | |||
| 928 | Ga0105240_10058709 | |||
| 929 | Ga0105240_10232549 | |||
| 930 | Ga0105240_10610075 | |||
| 931 | Ga0111539_10092340 | |||
| 932 | Ga0111539_10317399 | |||
| 933 | Ga0111539_10727935 | |||
| 934 | Ga0105245_10049473 | |||
| 935 | Ga0105245_10124418 | |||
| 936 | Ga0105247_10250955 | |||
| 937 | Ga0114129_10236217 | |||
| 938 | Ga0114129_10342862 | |||
| 939 | Ga0105243_10000065 | |||
| 940 | Ga0105237_10107962 | |||
| 941 | Ga0105237_10285130 | |||
| 942 | Ga0105237_10331894 | |||
| 943 | Ga0105238_10000930 | |||
| 944 | Ga0105238_10058537 | |||
| 945 | Ga0105249_10001742 | |||
| 946 | Ga0105249_10250191 | |||
| 947 | Ga0099796_10105924 | |||
| 948 | Ga0105239_10821047 | |||
| 949 | Ga0157373_10001329 | |||
| 950 | Ga0157370_10000098 | |||
| 951 | Ga0157370_10073442 | |||
| 952 | Ga0157374_10000036 | |||
| 953 | Ga0157374_10024872 | |||
| 954 | Ga0157374_10042694 | |||
| 955 | Ga0157374_10044656 | |||
| 956 | Ga0157374_10107462 | |||
| 957 | Ga0157374_10109941 | |||
| 958 | Ga0157374_10171382 | |||
| 959 | Ga0157374_10210420 | |||
| 960 | Ga0157374_10263517 | |||
| 961 | Ga0157378_10006286 | |||
| 962 | Ga0157378_10015155 | |||
| 963 | Ga0157378_10028454 | |||
| 964 | Ga0157378_10111580 | |||
| 965 | Ga0157378_10140765 | |||
| 966 | Ga0157378_10186626 | |||
| 967 | Ga0157378_10302614 | |||
| 968 | Ga0157378_10392043 | |||
| 969 | Ga0163162_10044897 | |||
| 970 | Ga0163162_10110346 | |||
| 971 | Ga0163162_10111645 | |||
| 972 | Ga0163162_10328229 | |||
| 973 | Ga0163162_10338124 | |||
| 974 | Ga0157372_10369506 | |||
| 975 | Ga0157372_10503565 | |||
| 976 | Ga0157375_10000006 | |||
| 977 | Ga0157375_10000985 | |||
| 978 | Ga0157375_10041020 | |||
| 979 | Ga0157375_10058020 | |||
| 980 | Ga0157375_10110333 | |||
| 981 | Ga0157375_10113083 | |||
| 982 | Ga0157375_10263678 | |||
| 983 | Ga0157375_10303217 | |||
| 984 | Ga0157375_10533466 | |||
| 985 | Ga0157375_10805395 | |||
| 986 | Ga0163163_10007622 | |||
| 987 | Ga0163163_10142870 | |||
| 988 | Ga0163163_10521036 | |||
| 989 | Ga0157380_10439827 | |||
| 990 | Ga0182008_10025254 | |||
| 991 | Ga0157377_10016770 | |||
| 992 | Ga0157377_10020618 | |||
| 993 | Ga0157377_10030242 | |||
| 994 | Ga0157379_10009934 | |||
| 995 | Ga0157376_10000155 | |||
| 996 | Ga0157376_10057828 | |||
| 997 | Ga0157376_10078986 | |||
| 998 | Ga0157376_10094693 | |||
| 999 | Ga0157376_10103244 | |||
| 1000 | Ga0163161_10012723 | |||
| 1001 | Ga0206355_1514168 | |||
| 1002 | Ga0213872_10002640 | |||
| 1003 | Ga0213872_10105637 | |||
| 1004 | Ga0213874_10039256 | |||
| 1005 | Ga0213876_10000253 | |||
| 1006 | Ga0213876_10001151 | |||
| 1007 | Ga0213876_10051746 | |||
| 1008 | Ga0213876_10099670 | |||
| 1009 | Ga0213876_10135284 | |||
| 1010 | Ga0213871_10020654 | |||
| 1011 | Ga0207666_1001759 | |||
| 1012 | Ga0209050_1000225 | |||
| 1013 | Ga0207697_10000588 | |||
| 1014 | Ga0207697_10000971 | |||
| 1015 | Ga0207697_10001126 | |||
| 1016 | Ga0207697_10001224 | |||
| 1017 | Ga0207697_10008755 | |||
| 1018 | Ga0207697_10013216 | |||
| 1019 | Ga0207697_10031985 | |||
| 1020 | Ga0207697_10055272 | |||
| 1021 | Ga0207697_10139432 | |||
| 1022 | Ga0207692_10058203 | |||
| 1023 | Ga0207688_10010606 | |||
| 1024 | Ga0207688_10040111 | |||
| 1025 | Ga0207680_10197230 | |||
| 1026 | Ga0207680_10323681 | |||
| 1027 | Ga0207647_10019970 | |||
| 1028 | Ga0207699_10013907 | |||
| 1029 | Ga0207645_10000976 | |||
| 1030 | Ga0207645_10002368 | |||
| 1031 | Ga0207645_10074563 | |||
| 1032 | Ga0207645_10245037 | |||
| 1033 | Ga0207705_10007697 | |||
| 1034 | Ga0207705_10183046 | |||
| 1035 | Ga0207684_10000276 | |||
| 1036 | Ga0207684_10001121 | |||
| 1037 | Ga0207684_10003729 | |||
| 1038 | Ga0207684_10027814 | |||
| 1039 | Ga0207684_10340539 | |||
| 1040 | Ga0207707_10022088 | |||
| 1041 | Ga0207695_10000022 | |||
| 1042 | Ga0207695_10022986 | |||
| 1043 | Ga0207695_10154457 | |||
| 1044 | Ga0207695_10254702 | |||
| 1045 | Ga0207693_10002197 | |||
| 1046 | Ga0207693_10082805 | |||
| 1047 | Ga0207693_10132947 | |||
| 1048 | Ga0207663_10000311 | |||
| 1049 | Ga0207663_10015652 | |||
| 1050 | Ga0207663_10025730 | |||
| 1051 | Ga0207663_10036009 | |||
| 1052 | Ga0207663_10490806 | |||
| 1053 | Ga0207662_10000226 | |||
| 1054 | Ga0207662_10034428 | |||
| 1055 | Ga0207662_10300462 | |||
| 1056 | Ga0207657_10119684 | |||
| 1057 | Ga0207649_10000716 | |||
| 1058 | Ga0207649_10013978 | |||
| 1059 | Ga0207649_10249616 | |||
| 1060 | Ga0207646_10005760 | |||
| 1061 | Ga0207646_10013358 | |||
| 1062 | Ga0207646_10030576 | |||
| 1063 | Ga0207646_10056564 | |||
| 1064 | Ga0207646_10093028 | |||
| 1065 | Ga0207681_10018045 | |||
| 1066 | Ga0207681_10084732 | |||
| 1067 | Ga0207681_10299848 | |||
| 1068 | Ga0207694_10007009 | |||
| 1069 | Ga0207694_10017549 | |||
| 1070 | Ga0207650_10029039 | |||
| 1071 | Ga0207650_10084107 | |||
| 1072 | Ga0207650_10168317 | |||
| 1073 | Ga0207650_10260920 | |||
| 1074 | Ga0207659_10009476 | |||
| 1075 | Ga0207659_10031596 | |||
| 1076 | Ga0207659_10086875 | |||
| 1077 | Ga0207659_10101180 | |||
| 1078 | Ga0207659_10227298 | |||
| 1079 | Ga0207687_10033830 | |||
| 1080 | Ga0207700_10045183 | |||
| 1081 | Ga0207664_10081457 | |||
| 1082 | Ga0207664_10099006 | |||
| 1083 | Ga0207664_10118958 | |||
| 1084 | Ga0207664_10255707 | |||
| 1085 | Ga0207644_10034307 | |||
| 1086 | Ga0207644_10077245 | |||
| 1087 | Ga0207644_10338342 | |||
| 1088 | Ga0207690_10062553 | |||
| 1089 | Ga0207690_10101568 | |||
| 1090 | Ga0207706_10001556 | |||
| 1091 | Ga0207706_10094025 | |||
| 1092 | Ga0207706_10101830 | |||
| 1093 | Ga0207706_10136412 | |||
| 1094 | Ga0207686_10231704 | |||
| 1095 | Ga0207709_10000407 | |||
| 1096 | Ga0207709_10001248 | |||
| 1097 | Ga0207670_10002689 | |||
| 1098 | Ga0207670_10079402 | |||
| 1099 | Ga0207670_10082033 | |||
| 1100 | Ga0207670_10196254 | |||
| 1101 | Ga0207670_10321437 | |||
| 1102 | Ga0207669_10058476 | |||
| 1103 | Ga0207669_10262931 | |||
| 1104 | Ga0207665_10065606 | |||
| 1105 | Ga0207665_10068290 | |||
| 1106 | Ga0207665_10296442 | |||
| 1107 | Ga0207691_10069706 | |||
| 1108 | Ga0207661_10116184 | |||
| 1109 | Ga0207661_10170762 | |||
| 1110 | Ga0207679_10006349 | |||
| 1111 | Ga0207667_10004393 | |||
| 1112 | Ga0207667_10068169 | |||
| 1113 | Ga0207667_10255515 | |||
| 1114 | Ga0207667_10544182 | |||
| 1115 | Ga0207651_10076720 | |||
| 1116 | Ga0207651_10078568 | |||
| 1117 | Ga0207651_10188530 | |||
| 1118 | Ga0207651_10343605 | |||
| 1119 | Ga0207651_10371105 | |||
| 1120 | Ga0207712_10008366 | |||
| 1121 | Ga0207668_10029176 | |||
| 1122 | Ga0207668_10035542 | |||
| 1123 | Ga0207668_10238998 | |||
| 1124 | Ga0207658_10015864 | |||
| 1125 | Ga0207658_10114244 | |||
| 1126 | Ga0207658_10126617 | |||
| 1127 | Ga0207658_10194568 | |||
| 1128 | Ga0207658_10199903 | |||
| 1129 | Ga0207677_10049537 | |||
| 1130 | Ga0207677_10049775 | |||
| 1131 | Ga0207677_10351136 | |||
| 1132 | Ga0207703_10034768 | |||
| 1133 | Ga0207703_10049662 | |||
| 1134 | Ga0207703_10261692 | |||
| 1135 | Ga0207639_10000012 | |||
| 1136 | Ga0207678_10004819 | |||
| 1137 | Ga0207708_10070349 | |||
| 1138 | Ga0207702_10007889 | |||
| 1139 | Ga0207702_10030806 | |||
| 1140 | Ga0207702_10158448 | |||
| 1141 | Ga0207702_10220214 | |||
| 1142 | Ga0207702_10227830 | |||
| 1143 | Ga0207641_10029953 | |||
| 1144 | Ga0207641_10195468 | |||
| 1145 | Ga0207641_10243465 | |||
| 1146 | Ga0207648_10007911 | |||
| 1147 | Ga0207648_10065936 | |||
| 1148 | Ga0207648_10402825 | |||
| 1149 | Ga0207674_10070922 | |||
| 1150 | Ga0207683_10003154 | |||
| 1151 | Ga0207683_10039078 | |||
| 1152 | Ga0207683_10048248 | |||
| 1153 | Ga0207683_10289318 | |||
| 1154 | Ga0268266_10017501 | |||
| 1155 | Ga0268266_10188719 | |||
| 1156 | Ga0268266_10347235 | |||
| 1157 | Ga0268264_10000490 | |||
| 1158 | Ga0268264_10012947 | |||
| 1159 | Ga0268264_10122236 | |||
| 1160 | Ga0268264_10409847 | |||
| 1161 | Ga0265337_1000557 | |||
| 1162 | Ga0265337_1006696 | |||
| 1163 | Ga0265319_1000179 | |||
| 1164 | Ga0265319_1015602 | |||
| 1165 | Ga0265334_10036442 | |||
| 1166 | Ga0265318_10077917 | |||
| 1167 | Ga0265323_10009094 | |||
| 1168 | Ga0265323_10065356 | |||
| 1169 | Ga0265322_10002988 | |||
| 1170 | Ga0265336_10000520 | |||
| 1171 | Ga0265336_10035461 | |||
| 1172 | Ga0265338_10000008 | |||
| 1173 | Ga0265338_10000210 | |||
| 1174 | Ga0265338_10000248 | |||
| 1175 | Ga0265338_10000269 | |||
| 1176 | Ga0265338_10000652 | |||
| 1177 | Ga0265338_10000774 | |||
| 1178 | Ga0265338_10001504 | |||
| 1179 | Ga0265338_10005506 | |||
| 1180 | Ga0265338_10014273 | |||
| 1181 | Ga0265338_10015897 | |||
| 1182 | Ga0265338_10018803 | |||
| 1183 | Ga0265338_10024645 | |||
| 1184 | Ga0265338_10060900 | |||
| 1185 | Ga0265324_10000319 | |||
| 1186 | Ga0265324_10000975 | |||
| 1187 | Ga0265328_10006569 | |||
| 1188 | Ga0265320_10000501 | |||
| 1189 | Ga0265320_10000683 | |||
| 1190 | Ga0265320_10045857 | |||
| 1191 | Ga0265320_10058820 | |||
| 1192 | Ga0265320_10097340 | |||
| 1193 | Ga0265325_10008471 | |||
| 1194 | Ga0265325_10022606 | |||
| 1195 | Ga0265329_10000449 | |||
| 1196 | Ga0265340_10006049 | |||
| 1197 | Ga0265339_10025191 | |||
| 1198 | Ga0265339_10031631 | |||
| 1199 | Ga0265331_10017179 | |||
| 1200 | Ga0265327_10002552 | |||
| 1201 | Ga0265327_10007710 | |||
| 1202 | Ga0265316_10001824 | |||
| 1203 | Ga0265316_10020997 | |||
| 1204 | Ga0265316_10047577 | |||
| 1205 | Ga0265316_10055099 | |||
| 1206 | Ga0265316_10116025 | |||
| 1207 | Ga0265316_10413330 | |||
| 1208 | Ga0307408_100000070 | |||
| 1209 | Ga0307408_100015236 | |||
| 1210 | Ga0265314_10000031 | |||
| 1211 | Ga0265314_10053577 | |||
| 1212 | Ga0265314_10093476 | |||
| 1213 | Ga0265314_10105115 | |||
| 1214 | Ga0265314_10153364 | |||
| 1215 | Ga0265342_10035866 | |||
| 1216 | Ga0307406_10000169 | |||
| 1217 | Ga0307406_10091012 | |||
| 1218 | Ga0307407_10000121 | |||
| 1219 | Ga0307412_10000396 | |||
| 1220 | Ga0307409_100001052 | |||
| 1221 | Ga0307416_100072833 | |||
| 1222 | Ga0307414_10000029 | |||
| 1223 | Ga0373930_0002600 | |||
| 1224 | Ga0373950_0006569 | |||
| 1225 | Ga0373928_0000050 | |||
| 1226 | Ga0373929_0001691 | |||
| 1227 | Ga0373944_0002853 | |||
| 1228 | Ga0373944_0012950 | |||
| 1229 | Ga0373949_0001510 | |||
| 1230 | Ga0373932_0000003 | |||
| 1231 | Ga0373936_0112393 | |||
| 1232 | Ga0373939_0004412 | |||
| 1233 | Ga0373954_0001465 | |||
| 1234 | Ga0373954_0038415 | |||
| 1235 | Ga0373943_0034222 | |||
| 1236 | Ga0373943_0168429 | |||
| 1237 | Ga0373955_0155462 | |||
| 1238 | Ga0373961_0087683 | |||
| 1239 | Ga0373962_0000141 | |||
| 1240 | Ga0316574_0031651 | |||
| 1241 | Ga0373931_0000017 | |||
| 1242 | Ga0373931_0129245 | |||
| 1243 | Ga0373935_0011676 | |||
| 1244 | Ga0373935_0022090 | |||
| 1245 | Ga0373935_0103677 | |||
| 1246 | Ga0373927_0008040 | |||
| 1247 | Ga0373927_0120107 | |||
| 1248 | Ga0373933_0289067 | |||
| 1249 | Ga0373947_0110016 | |||
| 1250 | Ga0373947_0132159 | |||
| 1251 | Ga0373937_0006245 | |||
| 1252 | Ga0373925_0001786 | |||
| 1253 | Ga0373925_0286580 | |||
| 1254 | Ga0395899_0041168 | |||
| 1255 | Ga0395898_0000539 | |||
| 1256 | Ga0395898_0010108 | |||
| 1257 | Ga0395898_0445740 | |||
| 1258 | Ga0395905_0144190 | |||
| 1259 | Ga0436364_1116390 | |||
| 1260 | Ga0395901_0127841 | |||
| 1261 | Ga0436365_1021998 | |||
| 1262 | Ga0436365_1508062 | |||
| 1263 | Ga0436365_1788700 | |||
| 1264 | Ga0436360_0313800 | |||
| 1265 | Ga0436360_0663054 | |||
| 1266 | Ga0436360_1111282 | |||
| 1267 | Ga0436361_0024322 | |||
| 1268 | Ga0436361_0346675 | |||
| 1269 | Ga0436361_0420319 | |||
| 1270 | Ga0436361_0558325 | |||
| 1271 | Ga0436361_0690497 | |||
| 1272 | Ga0436362_0945614 | |||
| 1273 | Ga0436362_1173039 | |||
| 1274 | Ga0436362_1264546 | |||
| 1275 | Ga0439453_0000706 | |||
| 1276 | Ga0439437_009729 | |||
| 1277 | Ga0450890_000002 | |||
| 1278 | Ga0450892_000048 | |||
| 1279 | Ga0439458_0007525 | |||
| 1280 | Ga0439464_0049091 | |||
| 1281 | Ga0451577_0001681 | |||
| 1282 | Ga0451577_0356961 | |||
| 1283 | Ga0451577_0401649 | |||
| 1284 | Ga0466965_0007362 | |||
| 1285 | Ga0466964_0010000 | |||
| 1286 | Ga0453684_0063537 | |||
| 1287 | Ga0466971_0000072 | |||
| 1288 | Ga0466957_0017711 | |||
| 1289 | Ga0451576_0039206 | |||
| 1290 | Ga0451576_0116774 | |||
| 1291 | Ga0451576_0176973 | |||
| 1292 | Ga0451576_0201488 | |||
| 1293 | Ga0451576_0340533 | |||
| 1294 | Ga0495592_0000054 | |||
| 1295 | Ga0495592_0133511 | |||
| 1296 | Ga0495651_0024862 | |||
| 1297 | Ga0495662_0010383 | |||
| 1298 | Ga0495664_0114271 | |||
| 1299 | Ga0495618_0002303 | |||
| 1300 | Ga0495618_0004029 | |||
| 1301 | Ga0495628_0015266 | |||
| 1302 | Ga0495628_0069233 | |||
| 1303 | Ga0495628_0098302 | |||
| 1304 | Ga0495630_0057296 | |||
| 1305 | Ga0495630_0070115 | |||
| 1306 | Ga0495643_0000169 | |||
| 1307 | Ga0495666_0048120 | |||
| 1308 | Ga0495666_0103299 | |||
| 1309 | Ga0495642_0029357 | |||
| 1310 | Ga0495652_0065364 | |||
| 1311 | Ga0495652_0360964 | |||
| 1312 | Ga0495640_0128849 | |||
| 1313 | Ga0495586_0000670 | |||
| 1314 | Ga0495586_0002170 | |||
| 1315 | Ga0495587_0069297 | |||
| 1316 | Ga0495645_0001139 | |||
| 1317 | Ga0495645_0098224 | |||
| 1318 | Ga0495645_0146131 | |||
| 1319 | Ga0495634_0001299 | |||
| 1320 | Ga0495635_0163031 | |||
| 1321 | Ga0495599_0007170 | |||
| 1322 | Ga0495599_0061081 | |||
| 1323 | Ga0495599_0070646 | |||
| 1324 | Ga0495647_0123497 | |||
| 1325 | Ga0495613_0003308 | |||
| 1326 | Ga0495604_0172423 | |||
| 1327 | Ga0495674_0028557 | |||
| 1328 | Ga0495674_0102272 | |||
| 1329 | Ga0495674_0445213 | |||
| 1330 | Ga0495676_0097600 | |||
| 1331 | Ga0495675_0130960 | |||
| 1332 | Ga0495684_0066245 | |||
| 1333 | Ga0495684_0155579 | |||
| 1334 | Ga0496100_0089341 | |||
| 1335 | Ga0496102_0034391 | |||
| 1336 | Ga0496104_0118755 | |||
| 1337 | Ga0496104_0531716 | |||
| 1338 | Ga0496106_0018251 | |||
| 1339 | Ga0496106_0189648 | |||
| 1340 | Ga0496106_0326334 | |||
| 1341 | Ga0496107_0012270 | |||
| 1342 | Ga0496107_0093490 | |||
| 1343 | Ga0496108_0019559 | |||
| 1344 | Ga0496108_0102834 | |||
| 1345 | Ga0496109_0012074 | |||
| 1346 | Ga0496110_0099903 | |||
| 1347 | Ga0496111_0191926 | |||
| 1348 | Ga0496111_0255672 | |||
| 1349 | Ga0496112_0087601 | |||
| 1350 | Ga0496112_0153029 | |||
| 1351 | Ga0496112_0180885 | |||
| 1352 | Ga0496112_0308850 | |||
| 1353 | Ga0496112_0429651 | |||
| 1354 | Ga0496112_0680933 | |||
| 1355 | Ga0496113_0132375 | |||
| 1356 | Ga0496113_0165434 | |||
| 1357 | Ga0496115_0007891 | |||
| 1358 | Ga0496115_0059318 | |||
| 1359 | Ga0496115_0281956 | |||
| 1360 | Ga0496121_0080873 | |||
| 1361 | Ga0496125_0000102 | |||
| 1362 | Ga0501031_0000012 | |||
| 1363 | Ga0501031_0168897 | |||
| 1364 | Ga0501032_0000441 | |||
| 1365 | Ga0501032_0007268 | |||
| 1366 | Ga0501033_0000018 | |||
| 1367 | Ga0501033_0002389 | |||
| 1368 | Ga0501033_0027773 | |||
| 1369 | Ga0501037_0144755 | |||
| 1370 | Ga0501038_0001861 | |||
| 1371 | Ga0501038_0006224 | |||
| 1372 | Ga0501039_0006972 | |||
| 1373 | Ga0501043_0042069 | |||
| 1374 | Ga0501043_0174909 | |||
| 1375 | Ga0501046_0165224 | |||
| 1376 | Ga0501047_0001289 | |||
| 1377 | Ga0501070_0018105 | |||
| 1378 | Ga0501070_0156970 | |||
| 1379 | Ga0501070_0185720 | |||
| 1380 | Ga0501257_019234 | |||
| 1381 | Ga0501080_0021554 | |||
| 1382 | Ga0501080_0059118 | |||
| 1383 | Ga0501035_0000002 | |||
| 1384 | Ga0501035_0001290 | |||
| 1385 | Ga0501035_0002720 | |||
| 1386 | Ga0501044_0000024 | |||
| 1387 | Ga0501044_0001541 | |||
| 1388 | nmdc:mga03683_141_c1 | |||
| 1389 | nmdc:mga03n38_163466_c1 | |||
| 1390 | nmdc:mga0k408_11319_c1 | |||
| 1391 | nmdc:mga0k408_636_c1 | |||
| 1392 | nmdc:mga06r32_20384_c1 | |||
| 1393 | nmdc:mga08y16_184179_c1 | |||
| 1394 | nmdc:mga08y16_291175_c1 | |||
| 1395 | nmdc:mga0n895_289904_c1 | |||
| 1396 | nmdc:mga08x19_20679_c1 | |||
| 1397 | Ga0500555_000044 | |||
| 1398 | Ga0500556_0000010 | |||
| 1399 | Ga0500556_0010796 | |||
| 1400 | Ga0500642_0039191 | |||
| 1401 | Ga0500559_0001396 | |||
| 1402 | Ga0500568_0026447 | |||
| 1403 | Ga0500616_0005714 | |||
| 1404 | Ga0466962_0000139 | |||
| 1405 | 2718716359 | |||
| 1406 | 2787507649 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5exk-assembly6.cif.gz_K | crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate | 0.9698 | 14 | 292 |
| 4u0p-assembly1.cif.gz_B | the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine | 0.9515 | 14 | 291 |
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.9439 | 16 | 291 |
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.9371 | 16 | 291 |
| 5exi-assembly1.cif.gz_A | crystal structure of m. tuberculosis lipoyl synthase at 2.28 a resolution | 0.9323 | 26 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WK91_74_280_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9786 | 65 | 275 | 3.20.20.70 |
| af_P9WK91_74_280_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9694 | 65 | 275 | 3.20.20.70 |
| af_P60716_82_298_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9681 | 60 | 277 | 3.20.20.70 |
| af_P60716_82_298_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9593 | 60 | 277 | 3.20.20.70 |
| af_Q2FZX4_3_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9573 | 1 | 270 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5LSW9-F1-model_v4 | lipoyl synthase (EC 2.8.1.8) | 0.9911 | 1 | 263 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A6N7M039-F1-model_v4 | lipoyl synthase (EC 2.8.1.8) | 0.991 | 46 | 248 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A3D3CMG9-F1-model_v4 | lipoyl synthase (EC 2.8.1.8) | 0.9902 | 65 | 256 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A382S3P7-F1-model_v4 | lipoyl synthase (EC 2.8.1.8) | 0.9885 | 66 | 298 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A1U7GNH4-F1-model_v4 | Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) | 0.988 | 14 | 292 |
GO:0005737
GO:0016992 GO:0046872 GO:0051539 |