F476261

General Info

Members Datasets Scaffolds Average Seq Length
703 311 1406 300

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100003479|Ga0070664_10000347911
Length 358
Sequence VAAGRGGFLPFSRGWGGTSVPADMSACGPKMNMDPALHREQKPSWIKVRLPNNPVFWSTKSMVQDLKLVTVCEEAQCPNRWECWGQGTATFMIAGDKCTRACGFCAVKTARPDALEADEPERVATATQRMGLKHVVITAVARDDLKDGGAEHFQQTIEAVREMNPSTIIEVLVPDFNDRDWALQMVMDARPHIFNHNLETVERLTPLVRSRAKYQRSLTVLKKAKAMVNGRVATKSGIMLGLGERREEVLRAFDDLLAHDVTVLTLGQYLRPTPKHLPVVEYIEPSVFDEYKAIALEKGFKHVASGPLVRSSYHAADFRPELDILEAVESDVRAKKGLELGPEHLGLPEAKAELVKNL

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
177 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
231 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
311 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.14
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 3.7
Rhizosphere 91.61
Stem 0
Stem Tuber 0
Unclassified 15.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100003479 3300005564 Bacteria 12710
2 CNXas_1000010 3300000545 Bacteria 39918
3 JGI24746J21847_1002232 3300001977 Bacteria 3095
4 JGI24737J22298_10049526 3300001990 Bacteria 1278
5 JGI24743J22301_10000180 3300001991 Bacteria 6545
6 JGI24033J26618_1000267 3300002155 Bacteria 5726
7 JGI24742J22300_10001701 3300002244 Bacteria 3503
8 rootH2_10016017 3300003320 Bacteria 24516
9 rootH2_10064210 3300003320 Bacteria 4717
10 rootH2_10284222 3300003320 Bacteria 1785
11 rootH1_10003502 3300003323 Bacteria 55174
12 JGI25405J52794_10000432 3300003911 Bacteria 5906
13 Ga0065704_10009461 3300005289 Bacteria 3987
14 Ga0065704_10011242 3300005289 Bacteria 2523
15 Ga0065704_10098924 3300005289 Bacteria 2333
16 Ga0065712_10080155 3300005290 Bacteria 3138
17 Ga0065712_10084596 3300005290 Bacteria 2752
18 Ga0065712_10124906 3300005290 Bacteria 1620
19 Ga0065715_10137461 3300005293 Bacteria 1905
20 Ga0065715_10179505 3300005293 Bacteria 1485
21 Ga0065707_10004617 3300005295 Bacteria 5653
22 Ga0065707_10010686 3300005295 Unclassified 1860
23 Ga0065707_10203773 3300005295 Bacteria 1298
24 Ga0065707_10210827 3300005295 Bacteria 1266
25 Ga0070676_10001595 3300005328 Bacteria 11544
26 Ga0070676_10036141 3300005328 Bacteria 2844
27 Ga0070676_10104584 3300005328 Unclassified 1754
28 Ga0070683_100032539 3300005329 Unclassified 4748
29 Ga0070683_100152477 3300005329 Bacteria 2191
30 Ga0070690_100004714 3300005330 Bacteria 7601
31 Ga0070690_100044685 3300005330 Bacteria 2812
32 Ga0070690_100156137 3300005330 Unclassified 1560
33 Ga0070670_100002866 3300005331 Bacteria 14271
34 Ga0070670_100035915 3300005331 Unclassified 4267
35 Ga0070670_100392042 3300005331 Bacteria 1225
36 Ga0070666_10064858 3300005335 Unclassified 2478
37 Ga0068868_100013546 3300005338 Bacteria 5983
38 Ga0068868_100124611 3300005338 Unclassified 2104
39 Ga0068868_100168499 3300005338 Bacteria 1812
40 Ga0070660_100049744 3300005339 Bacteria 3223
41 Ga0070660_100141896 3300005339 Bacteria 1928
42 Ga0070689_100032997 3300005340 Bacteria 3942
43 Ga0070689_100038101 3300005340 Bacteria 3677
44 Ga0070689_100081492 3300005340 Unclassified 2541
45 Ga0070689_100238321 3300005340 Unclassified 1498
46 Ga0070689_100384011 3300005340 Unclassified 1184
47 Ga0070691_10012273 3300005341 Bacteria 3921
48 Ga0070687_100021823 3300005343 Bacteria 3018
49 Ga0070687_100023175 3300005343 Bacteria 2948
50 Ga0070661_100000512 3300005344 Bacteria 29765
51 Ga0070668_100042021 3300005347 Unclassified 3503
52 Ga0070668_100050534 3300005347 Bacteria 3201
53 Ga0070668_100141923 3300005347 Bacteria 1936
54 Ga0070668_100172130 3300005347 Unclassified 1763
55 Ga0070668_100224397 3300005347 Bacteria 1551
56 Ga0070668_100453316 3300005347 Bacteria 1103
57 Ga0070669_100001514 3300005353 Bacteria 16793
58 Ga0070669_100008387 3300005353 Bacteria 7373
59 Ga0070669_100072636 3300005353 Bacteria 2547
60 Ga0070675_100001376 3300005354 Bacteria 17837
61 Ga0070675_100004395 3300005354 Bacteria 10754
62 Ga0070675_100090333 3300005354 Bacteria 2565
63 Ga0070675_100092576 3300005354 Bacteria 2534
64 Ga0070675_100132816 3300005354 Unclassified 2122
65 Ga0070675_100170940 3300005354 Bacteria 1874
66 Ga0070675_100414813 3300005354 Bacteria 1203
67 Ga0070671_100019012 3300005355 Bacteria 5588
68 Ga0070671_100224947 3300005355 Unclassified 1592
69 Ga0070671_100274268 3300005355 Bacteria 1434
70 Ga0070671_100366439 3300005355 Bacteria 1230
71 Ga0070671_100415123 3300005355 Unclassified 1152
72 Ga0070674_100088541 3300005356 Unclassified 2228
73 Ga0070674_100236682 3300005356 Bacteria 1427
74 Ga0070674_100246615 3300005356 Bacteria 1401
75 Ga0070674_100310633 3300005356 Bacteria 1260
76 Ga0070673_100119263 3300005364 Bacteria 2198
77 Ga0070673_100192715 3300005364 Unclassified 1751
78 Ga0070673_100213348 3300005364 Unclassified 1668
79 Ga0070688_100025475 3300005365 Bacteria 3502
80 Ga0070688_100043444 3300005365 Bacteria 2769
81 Ga0070659_100041310 3300005366 Bacteria 3605
82 Ga0070659_100070468 3300005366 Bacteria 2777
83 Ga0070667_100066880 3300005367 Bacteria 3054
84 Ga0070667_100076832 3300005367 Bacteria 2851
85 Ga0070667_100100989 3300005367 Unclassified 2491
86 Ga0070667_100280219 3300005367 Bacteria 1497
87 Ga0070709_10010292 3300005434 Bacteria 5171
88 Ga0070709_10295105 3300005434 Bacteria 1182
89 Ga0070714_100022507 3300005435 Bacteria 5168
90 Ga0070714_100080275 3300005435 Unclassified 2838
91 Ga0070714_100105244 3300005435 Unclassified 2491
92 Ga0070713_100044943 3300005436 Bacteria 3617
93 Ga0070713_100056786 3300005436 Bacteria 3256
94 Ga0070710_10016962 3300005437 Bacteria 3718
95 Ga0070701_10007999 3300005438 Bacteria 4548
96 Ga0070711_100000735 3300005439 Bacteria 17087
97 Ga0070711_100001885 3300005439 Bacteria 11710
98 Ga0070705_100076845 3300005440 Bacteria 2037
99 Ga0070708_100029133 3300005445 Bacteria 4759
100 Ga0070708_100029720 3300005445 Unclassified 4716
101 Ga0070708_100278920 3300005445 Bacteria 1573
102 Ga0070708_100310458 3300005445 Bacteria 1485
103 Ga0070663_100035045 3300005455 Bacteria 3479
104 Ga0070678_100011508 3300005456 Bacteria 5464
105 Ga0070678_100097756 3300005456 Bacteria 2268
106 Ga0070662_100011759 3300005457 Bacteria 5781
107 Ga0070662_100034437 3300005457 Bacteria 3571
108 Ga0070662_100178212 3300005457 Bacteria 1674
109 Ga0070681_10019854 3300005458 Bacteria 6732
110 Ga0068867_100000121 3300005459 Bacteria 49744
111 Ga0068867_100156939 3300005459 Unclassified 1792
112 Ga0070685_10075523 3300005466 Bacteria 2008
113 Ga0070706_100000339 3300005467 Bacteria 56563
114 Ga0070706_100001168 3300005467 Bacteria 28210
115 Ga0070706_100003751 3300005467 Bacteria 14840
116 Ga0070706_100079329 3300005467 Bacteria 3038
117 Ga0070707_100001522 3300005468 Bacteria 22582
118 Ga0070707_100010843 3300005468 Bacteria 8488
119 Ga0070707_100056296 3300005468 Bacteria 3771
120 Ga0070707_100080316 3300005468 Bacteria 3147
121 Ga0070707_100106426 3300005468 Bacteria 2720
122 Ga0070707_100175217 3300005468 Bacteria 2090
123 Ga0070707_100175503 3300005468 Unclassified 2089
124 Ga0070707_100525064 3300005468 Unclassified 1146
125 Ga0070698_100001525 3300005471 Bacteria 25703
126 Ga0070698_100004367 3300005471 Bacteria 15541
127 Ga0070698_100018823 3300005471 Bacteria 7265
128 Ga0070698_100030526 3300005471 Bacteria 5587
129 Ga0070698_100234988 3300005471 Bacteria 1766
130 Ga0070699_100042974 3300005518 Unclassified 3912
131 Ga0070699_100078433 3300005518 Bacteria 2877
132 Ga0070699_100090764 3300005518 Unclassified 2671
133 Ga0070699_100155645 3300005518 Bacteria 2023
134 Ga0070684_100259022 3300005535 Bacteria 1591
135 Ga0070684_100262337 3300005535 Bacteria 1580
136 Ga0070697_100019502 3300005536 Bacteria 5357
137 Ga0070697_100076188 3300005536 Bacteria 2759
138 Ga0070697_100194928 3300005536 Bacteria 1720
139 Ga0068853_100000075 3300005539 Bacteria 68972
140 Ga0068853_100147409 3300005539 Bacteria 2116
141 Ga0070672_100008263 3300005543 Bacteria 7114
142 Ga0070672_100080856 3300005543 Unclassified 2604
143 Ga0070686_100004345 3300005544 Bacteria 7809
144 Ga0070686_100253831 3300005544 Bacteria 1286
145 Ga0070686_100309861 3300005544 Bacteria 1174
146 Ga0070695_100124592 3300005545 Bacteria 1768
147 Ga0070665_100006037 3300005548 Bacteria 12378
148 Ga0070665_100080903 3300005548 Bacteria 3254
149 Ga0070665_100119558 3300005548 Bacteria 2637
150 Ga0070665_100249192 3300005548 Unclassified 1777
151 Ga0070665_100321591 3300005548 Unclassified 1551
152 Ga0070704_100055642 3300005549 Unclassified 2806
153 Ga0070704_100125279 3300005549 Unclassified 1981
154 Ga0068855_100007043 3300005563 Bacteria 13636
155 Ga0068855_100084103 3300005563 Bacteria 3685
156 Ga0068855_100238085 3300005563 Bacteria 2035
157 Ga0068855_100701618 3300005563 Unclassified 1083
158 Ga0070664_100069368 3300005564 Unclassified 3016
159 Ga0070664_100171104 3300005564 Bacteria 1927
160 Ga0068857_100126083 3300005577 Bacteria 2307
161 Ga0068854_100070375 3300005578 Bacteria 2557
162 Ga0068856_100001437 3300005614 Bacteria 24994
163 Ga0068856_100003901 3300005614 Bacteria 14959
164 Ga0068856_100054103 3300005614 Bacteria 3958
165 Ga0068856_100289515 3300005614 Bacteria 1655
166 Ga0068856_100441415 3300005614 Bacteria 1322
167 Ga0068859_100330914 3300005617 Bacteria 1617
168 Ga0068864_100031005 3300005618 Bacteria 4534
169 Ga0068864_100346657 3300005618 Bacteria 1400
170 Ga0068863_100031706 3300005841 Bacteria 5043
171 Ga0068863_100119083 3300005841 Bacteria 2517
172 Ga0068863_100282565 3300005841 Bacteria 1608
173 Ga0068863_100373542 3300005841 Bacteria 1392
174 Ga0068858_100011167 3300005842 Bacteria 8490
175 Ga0068858_100066720 3300005842 Bacteria 3332
176 Ga0068860_100000335 3300005843 Bacteria 63785
177 Ga0068860_100017681 3300005843 Bacteria 6946
178 Ga0068860_100129699 3300005843 Bacteria 2419
179 Ga0068860_100279531 3300005843 Bacteria 1631
180 Ga0068860_100454202 3300005843 Unclassified 1274
181 Ga0068862_100011766 3300005844 Bacteria 7222
182 Ga0081455_10000171 3300005937 Bacteria 80763
183 Ga0081455_10003966 3300005937 Bacteria 16797
184 Ga0081455_10009921 3300005937 Bacteria 9742
185 Ga0081455_10042131 3300005937 Unclassified 4008
186 Ga0081455_10109413 3300005937 Bacteria 2199
187 Ga0081455_10152931 3300005937 Unclassified 1777
188 Ga0081538_10060910 3300005981 Bacteria 2165
189 Ga0081540_1000225 3300005983 Bacteria 59402
190 Ga0081540_1010358 3300005983 Bacteria 6323
191 Ga0081540_1012037 3300005983 Bacteria 5726
192 Ga0081539_10000098 3300005985 Bacteria 202400
193 Ga0081539_10004649 3300005985 Bacteria 14944
194 Ga0081539_10058818 3300005985 Bacteria 2119
195 Ga0081539_10076733 3300005985 Bacteria 1770
196 Ga0070717_10011824 3300006028 Bacteria 6640
197 Ga0070717_10024005 3300006028 Bacteria 4838
198 Ga0070717_10086925 3300006028 Unclassified 2632
199 Ga0070717_10090738 3300006028 Bacteria 2579
200 Ga0070717_10107223 3300006028 Bacteria 2379
201 Ga0070717_10402752 3300006028 Bacteria 1229
202 Ga0075363_100043952 3300006048 Bacteria 2365
203 Ga0070716_100101978 3300006173 Bacteria 1761
204 Ga0070716_100252840 3300006173 Bacteria 1201
205 Ga0070716_100418380 3300006173 Bacteria 968
206 Ga0075362_10000544 3300006177 Bacteria 10962
207 Ga0097621_100009753 3300006237 Bacteria 6989
208 Ga0097621_100023334 3300006237 Bacteria 4816
209 Ga0075370_10039868 3300006353 Bacteria 2648
210 Ga0068871_100127430 3300006358 Bacteria 2156
211 Ga0068871_100286693 3300006358 Bacteria 1442
212 Ga0068871_100433924 3300006358 Bacteria 1175
213 Ga0075431_100032699 3300006847 Bacteria 5361
214 Ga0075433_10228023 3300006852 Bacteria 1654
215 Ga0075433_10313266 3300006852 Unclassified 1389
216 Ga0075434_100167470 3300006871 Bacteria 2217
217 Ga0075434_100214968 3300006871 Bacteria 1942
218 Ga0075436_100114222 3300006914 Bacteria 1885
219 Ga0097620_100330908 3300006931 Bacteria 1617
220 Ga0075435_100043321 3300007076 Bacteria 3603
221 Ga0075435_100236514 3300007076 Bacteria 1553
222 Ga0075435_100444977 3300007076 Unclassified 1117
223 Ga0105240_10000124 3300009093 Bacteria 160617
224 Ga0105240_10006802 3300009093 Bacteria 16723
225 Ga0105240_10058709 3300009093 Bacteria 4803
226 Ga0105240_10232549 3300009093 Bacteria 2141
227 Ga0105240_10610075 3300009093 Bacteria 1200
228 Ga0111539_10092340 3300009094 Bacteria 3557
229 Ga0111539_10317399 3300009094 Unclassified 1813
230 Ga0111539_10727935 3300009094 Bacteria 1155
231 Ga0105245_10049473 3300009098 Bacteria 3764
232 Ga0105245_10124418 3300009098 Unclassified 2412
233 Ga0105247_10250955 3300009101 Bacteria 1209
234 Ga0114129_10236217 3300009147 Bacteria 2459
235 Ga0114129_10342862 3300009147 Bacteria 1981
236 Ga0105243_10000065 3300009148 Bacteria 124947
237 Ga0105237_10107962 3300009545 Bacteria 2775
238 Ga0105237_10285130 3300009545 Bacteria 1654
239 Ga0105237_10331894 3300009545 Bacteria 1525
240 Ga0105238_10000930 3300009551 Bacteria 30002
241 Ga0105238_10058537 3300009551 Unclassified 3862
242 Ga0105249_10001742 3300009553 Bacteria 18977
243 Ga0105249_10250191 3300009553 Bacteria 1757
244 Ga0099796_10105924 3300010159 Bacteria 1064
245 Ga0105239_10821047 3300010375 Bacteria 1065
246 Ga0157373_10001329 3300013100 Bacteria 18935
247 Ga0157370_10000098 3300013104 Bacteria 98792
248 Ga0157370_10073442 3300013104 Unclassified 3227
249 Ga0157374_10000036 3300013296 Bacteria 176499
250 Ga0157374_10024872 3300013296 Bacteria 5372
251 Ga0157374_10042694 3300013296 Unclassified 4184
252 Ga0157374_10044656 3300013296 Bacteria 4096
253 Ga0157374_10107462 3300013296 Bacteria 2682
254 Ga0157374_10109941 3300013296 Bacteria 2650
255 Ga0157374_10171382 3300013296 Bacteria 2117
256 Ga0157374_10210420 3300013296 Unclassified 1907
257 Ga0157374_10263517 3300013296 Bacteria 1698
258 Ga0157378_10006286 3300013297 Bacteria 10403
259 Ga0157378_10015155 3300013297 Bacteria 6749
260 Ga0157378_10028454 3300013297 Bacteria 4931
261 Ga0157378_10111580 3300013297 Bacteria 2507
262 Ga0157378_10140765 3300013297 Bacteria 2240
263 Ga0157378_10186626 3300013297 Unclassified 1953
264 Ga0157378_10302614 3300013297 Bacteria 1548
265 Ga0157378_10392043 3300013297 Unclassified 1366
266 Ga0163162_10044897 3300013306 Bacteria 4427
267 Ga0163162_10110346 3300013306 Bacteria 2848
268 Ga0163162_10111645 3300013306 Bacteria 2832
269 Ga0163162_10328229 3300013306 Unclassified 1662
270 Ga0163162_10338124 3300013306 Bacteria 1638
271 Ga0157372_10369506 3300013307 Unclassified 1671
272 Ga0157372_10503565 3300013307 Bacteria 1412
273 Ga0157375_10000006 3300013308 Bacteria 384086
274 Ga0157375_10000985 3300013308 Bacteria 24652
275 Ga0157375_10041020 3300013308 Unclassified 4467
276 Ga0157375_10058020 3300013308 Unclassified 3828
277 Ga0157375_10110333 3300013308 Bacteria 2848
278 Ga0157375_10113083 3300013308 Unclassified 2816
279 Ga0157375_10263678 3300013308 Bacteria 1884
280 Ga0157375_10303217 3300013308 Bacteria 1761
281 Ga0157375_10533466 3300013308 Unclassified 1336
282 Ga0157375_10805395 3300013308 Bacteria 1088
283 Ga0163163_10007622 3300014325 Bacteria 9563
284 Ga0163163_10142870 3300014325 Bacteria 2436
285 Ga0163163_10521036 3300014325 Unclassified 1251
286 Ga0157380_10439827 3300014326 Bacteria 1249
287 Ga0182008_10025254 3300014497 Unclassified 3018
288 Ga0157377_10016770 3300014745 Bacteria 3774
289 Ga0157377_10020618 3300014745 Bacteria 3456
290 Ga0157377_10030242 3300014745 Unclassified 2932
291 Ga0157379_10009934 3300014968 Bacteria 8287
292 Ga0157376_10000155 3300014969 Bacteria 47176
293 Ga0157376_10057828 3300014969 Bacteria 3246
294 Ga0157376_10078986 3300014969 Bacteria 2819
295 Ga0157376_10094693 3300014969 Bacteria 2596
296 Ga0157376_10103244 3300014969 Unclassified 2496
297 Ga0163161_10012723 3300017792 Bacteria 5845
298 Ga0206355_1514168 3300020076 Bacteria 3174
299 Ga0213872_10002640 3300021361 Bacteria 10410
300 Ga0213872_10105637 3300021361 Bacteria 1253
301 Ga0213874_10039256 3300021377 Bacteria 1409
302 Ga0213876_10000253 3300021384 Bacteria 50444
303 Ga0213876_10001151 3300021384 Bacteria 16743
304 Ga0213876_10051746 3300021384 Bacteria 2170
305 Ga0213876_10099670 3300021384 Bacteria 1540
306 Ga0213876_10135284 3300021384 Bacteria 1311
307 Ga0213871_10020654 3300021441 Bacteria 1634
308 Ga0207666_1001759 3300025271 Bacteria 2571
309 Ga0209050_1000225 3300025298 Bacteria 125323
310 Ga0207697_10000588 3300025315 Bacteria 20726
311 Ga0207697_10000971 3300025315 Bacteria 16130
312 Ga0207697_10001126 3300025315 Bacteria 14728
313 Ga0207697_10001224 3300025315 Bacteria 14047
314 Ga0207697_10008755 3300025315 Bacteria 4407
315 Ga0207697_10013216 3300025315 Unclassified 3447
316 Ga0207697_10031985 3300025315 Unclassified 2153
317 Ga0207697_10055272 3300025315 Bacteria 1646
318 Ga0207697_10139432 3300025315 Unclassified 1051
319 Ga0207692_10058203 3300025898 Unclassified 1990
320 Ga0207688_10010606 3300025901 Bacteria 5010
321 Ga0207688_10040111 3300025901 Bacteria 2601
322 Ga0207680_10197230 3300025903 Unclassified 1370
323 Ga0207680_10323681 3300025903 Bacteria 1078
324 Ga0207647_10019970 3300025904 Unclassified 4497
325 Ga0207699_10013907 3300025906 Bacteria 4133
326 Ga0207645_10000976 3300025907 Bacteria 23650
327 Ga0207645_10002368 3300025907 Bacteria 14863
328 Ga0207645_10074563 3300025907 Unclassified 2172
329 Ga0207645_10245037 3300025907 Bacteria 1185
330 Ga0207705_10007697 3300025909 Bacteria 7919
331 Ga0207705_10183046 3300025909 Bacteria 1582
332 Ga0207684_10000276 3300025910 Bacteria 75551
333 Ga0207684_10001121 3300025910 Bacteria 29929
334 Ga0207684_10003729 3300025910 Bacteria 14756
335 Ga0207684_10027814 3300025910 Bacteria 4816
336 Ga0207684_10340539 3300025910 Unclassified 1291
337 Ga0207707_10022088 3300025912 Bacteria 5562
338 Ga0207695_10000022 3300025913 Bacteria 659090
339 Ga0207695_10022986 3300025913 Bacteria 7060
340 Ga0207695_10154457 3300025913 Bacteria 2231
341 Ga0207695_10254702 3300025913 Bacteria 1654
342 Ga0207693_10002197 3300025915 Bacteria 17005
343 Ga0207693_10082805 3300025915 Bacteria 2513
344 Ga0207693_10132947 3300025915 Bacteria 1956
345 Ga0207663_10000311 3300025916 Bacteria 21215
346 Ga0207663_10015652 3300025916 Unclassified 4189
347 Ga0207663_10025730 3300025916 Bacteria 3407
348 Ga0207663_10036009 3300025916 Bacteria 2974
349 Ga0207663_10490806 3300025916 Unclassified 953
350 Ga0207662_10000226 3300025918 Bacteria 26114
351 Ga0207662_10034428 3300025918 Bacteria 2956
352 Ga0207662_10300462 3300025918 Bacteria 1067
353 Ga0207657_10119684 3300025919 Bacteria 2167
354 Ga0207649_10000716 3300025920 Bacteria 21824
355 Ga0207649_10013978 3300025920 Bacteria 4491
356 Ga0207649_10249616 3300025920 Bacteria 1277
357 Ga0207646_10005760 3300025922 Bacteria 12982
358 Ga0207646_10013358 3300025922 Bacteria 7857
359 Ga0207646_10030576 3300025922 Bacteria 4879
360 Ga0207646_10056564 3300025922 Bacteria 3505
361 Ga0207646_10093028 3300025922 Bacteria 2699
362 Ga0207681_10018045 3300025923 Bacteria 4439
363 Ga0207681_10084732 3300025923 Bacteria 2248
364 Ga0207681_10299848 3300025923 Bacteria 1271
365 Ga0207694_10007009 3300025924 Bacteria 8557
366 Ga0207694_10017549 3300025924 Bacteria 5411
367 Ga0207650_10029039 3300025925 Bacteria 3971
368 Ga0207650_10084107 3300025925 Unclassified 2418
369 Ga0207650_10168317 3300025925 Unclassified 1740
370 Ga0207650_10260920 3300025925 Bacteria 1405
371 Ga0207659_10009476 3300025926 Bacteria 6088
372 Ga0207659_10031596 3300025926 Unclassified 3626
373 Ga0207659_10086875 3300025926 Unclassified 2327
374 Ga0207659_10101180 3300025926 Bacteria 2173
375 Ga0207659_10227298 3300025926 Bacteria 1503
376 Ga0207687_10033830 3300025927 Unclassified 3468
377 Ga0207700_10045183 3300025928 Bacteria 3248
378 Ga0207664_10081457 3300025929 Bacteria 2634
379 Ga0207664_10099006 3300025929 Unclassified 2405
380 Ga0207664_10118958 3300025929 Bacteria 2208
381 Ga0207664_10255707 3300025929 Bacteria 1530
382 Ga0207644_10034307 3300025931 Unclassified 3550
383 Ga0207644_10077245 3300025931 Bacteria 2452
384 Ga0207644_10338342 3300025931 Unclassified 1220
385 Ga0207690_10062553 3300025932 Bacteria 2534
386 Ga0207690_10101568 3300025932 Bacteria 2055
387 Ga0207706_10001556 3300025933 Bacteria 22738
388 Ga0207706_10094025 3300025933 Bacteria 2637
389 Ga0207706_10101830 3300025933 Bacteria 2527
390 Ga0207706_10136412 3300025933 Bacteria 2158
391 Ga0207686_10231704 3300025934 Bacteria 1339
392 Ga0207709_10000407 3300025935 Bacteria 42024
393 Ga0207709_10001248 3300025935 Bacteria 18270
394 Ga0207670_10002689 3300025936 Bacteria 9347
395 Ga0207670_10079402 3300025936 Unclassified 2291
396 Ga0207670_10082033 3300025936 Bacteria 2259
397 Ga0207670_10196254 3300025936 Bacteria 1530
398 Ga0207670_10321437 3300025936 Bacteria 1218
399 Ga0207669_10058476 3300025937 Bacteria 2352
400 Ga0207669_10262931 3300025937 Unclassified 1291
401 Ga0207665_10065606 3300025939 Unclassified 2469
402 Ga0207665_10068290 3300025939 Bacteria 2422
403 Ga0207665_10296442 3300025939 Bacteria 1207
404 Ga0207691_10069706 3300025940 Unclassified 3176
405 Ga0207661_10116184 3300025944 Bacteria 2271
406 Ga0207661_10170762 3300025944 Bacteria 1893
407 Ga0207679_10006349 3300025945 Bacteria 7470
408 Ga0207667_10004393 3300025949 Bacteria 17267
409 Ga0207667_10068169 3300025949 Bacteria 3705
410 Ga0207667_10255515 3300025949 Bacteria 1792
411 Ga0207667_10544182 3300025949 Bacteria 1175
412 Ga0207651_10076720 3300025960 Unclassified 2390
413 Ga0207651_10078568 3300025960 Bacteria 2367
414 Ga0207651_10188530 3300025960 Unclassified 1643
415 Ga0207651_10343605 3300025960 Bacteria 1254
416 Ga0207651_10371105 3300025960 Unclassified 1210
417 Ga0207712_10008366 3300025961 Bacteria 6538
418 Ga0207668_10029176 3300025972 Bacteria 3614
419 Ga0207668_10035542 3300025972 Bacteria 3318
420 Ga0207668_10238998 3300025972 Bacteria 1468
421 Ga0207658_10015864 3300025986 Bacteria 5172
422 Ga0207658_10114244 3300025986 Bacteria 2140
423 Ga0207658_10126617 3300025986 Bacteria 2045
424 Ga0207658_10194568 3300025986 Unclassified 1688
425 Ga0207658_10199903 3300025986 Bacteria 1668
426 Ga0207677_10049537 3300026023 Bacteria 2835
427 Ga0207677_10049775 3300026023 Unclassified 2830
428 Ga0207677_10351136 3300026023 Unclassified 1236
429 Ga0207703_10034768 3300026035 Bacteria 4001
430 Ga0207703_10049662 3300026035 Bacteria 3392
431 Ga0207703_10261692 3300026035 Bacteria 1564
432 Ga0207639_10000012 3300026041 Bacteria 344067
433 Ga0207678_10004819 3300026067 Bacteria 12116
434 Ga0207708_10070349 3300026075 Bacteria 2679
435 Ga0207702_10007889 3300026078 Bacteria 9026
436 Ga0207702_10030806 3300026078 Unclassified 4469
437 Ga0207702_10158448 3300026078 Unclassified 2065
438 Ga0207702_10220214 3300026078 Bacteria 1768
439 Ga0207702_10227830 3300026078 Bacteria 1740
440 Ga0207641_10029953 3300026088 Bacteria 4503
441 Ga0207641_10195468 3300026088 Bacteria 1862
442 Ga0207641_10243465 3300026088 Bacteria 1677
443 Ga0207648_10007911 3300026089 Bacteria 10365
444 Ga0207648_10065936 3300026089 Bacteria 3157
445 Ga0207648_10402825 3300026089 Bacteria 1240
446 Ga0207674_10070922 3300026116 Bacteria 3503
447 Ga0207683_10003154 3300026121 Bacteria 14397
448 Ga0207683_10039078 3300026121 Bacteria 4139
449 Ga0207683_10048248 3300026121 Bacteria 3729
450 Ga0207683_10289318 3300026121 Bacteria 1498
451 Ga0268266_10017501 3300028379 Bacteria 6113
452 Ga0268266_10188719 3300028379 Bacteria 1881
453 Ga0268266_10347235 3300028379 Bacteria 1394
454 Ga0268264_10000490 3300028381 Bacteria 52433
455 Ga0268264_10012947 3300028381 Bacteria 6859
456 Ga0268264_10122236 3300028381 Bacteria 2296
457 Ga0268264_10409847 3300028381 Unclassified 1305
458 Ga0265337_1000557 3300028556 Bacteria 19622
459 Ga0265337_1006696 3300028556 Bacteria 4399
460 Ga0265319_1000179 3300028563 Bacteria 48318
461 Ga0265319_1015602 3300028563 Bacteria 2940
462 Ga0265334_10036442 3300028573 Bacteria 1942
463 Ga0265318_10077917 3300028577 Unclassified 1225
464 Ga0265323_10009094 3300028653 Bacteria 4075
465 Ga0265323_10065356 3300028653 Bacteria 1255
466 Ga0265322_10002988 3300028654 Bacteria 5146
467 Ga0265336_10000520 3300028666 Bacteria 22239
468 Ga0265336_10035461 3300028666 Bacteria 1538
469 Ga0265338_10000008 3300028800 Bacteria 481542
470 Ga0265338_10000210 3300028800 Bacteria 107885
471 Ga0265338_10000248 3300028800 Bacteria 98976
472 Ga0265338_10000269 3300028800 Bacteria 95081
473 Ga0265338_10000652 3300028800 Bacteria 59926
474 Ga0265338_10000774 3300028800 Bacteria 54489
475 Ga0265338_10001504 3300028800 Bacteria 37705
476 Ga0265338_10005506 3300028800 Bacteria 16502
477 Ga0265338_10014273 3300028800 Bacteria 8854
478 Ga0265338_10015897 3300028800 Bacteria 8234
479 Ga0265338_10018803 3300028800 Bacteria 7371
480 Ga0265338_10024645 3300028800 Bacteria 6139
481 Ga0265338_10060900 3300028800 Bacteria 3311
482 Ga0265324_10000319 3300029957 Bacteria 35387
483 Ga0265324_10000975 3300029957 Bacteria 17727
484 Ga0265328_10006569 3300031239 Bacteria 4902
485 Ga0265320_10000501 3300031240 Bacteria 30510
486 Ga0265320_10000683 3300031240 Bacteria 25874
487 Ga0265320_10045857 3300031240 Bacteria 2145
488 Ga0265320_10058820 3300031240 Bacteria 1839
489 Ga0265320_10097340 3300031240 Bacteria 1357
490 Ga0265325_10008471 3300031241 Bacteria 6067
491 Ga0265325_10022606 3300031241 Bacteria 3442
492 Ga0265329_10000449 3300031242 Bacteria 21635
493 Ga0265340_10006049 3300031247 Bacteria 6672
494 Ga0265339_10025191 3300031249 Bacteria 3418
495 Ga0265339_10031631 3300031249 Bacteria 2989
496 Ga0265331_10017179 3300031250 Bacteria 3780
497 Ga0265327_10002552 3300031251 Bacteria 18929
498 Ga0265327_10007710 3300031251 Bacteria 8234
499 Ga0265316_10001824 3300031344 Bacteria 22401
500 Ga0265316_10020997 3300031344 Bacteria 5542
501 Ga0265316_10047577 3300031344 Bacteria 3392
502 Ga0265316_10055099 3300031344 Bacteria 3112
503 Ga0265316_10116025 3300031344 Bacteria 2024
504 Ga0265316_10413330 3300031344 Bacteria 970
505 Ga0307408_100000070 3300031548 Bacteria 119377
506 Ga0307408_100015236 3300031548 Bacteria 5118
507 Ga0265314_10000031 3300031711 Bacteria 265924
508 Ga0265314_10053577 3300031711 Bacteria 2797
509 Ga0265314_10093476 3300031711 Bacteria 1952
510 Ga0265314_10105115 3300031711 Bacteria 1806
511 Ga0265314_10153364 3300031711 Bacteria 1410
512 Ga0265342_10035866 3300031712 Bacteria 3032
513 Ga0307406_10000169 3300031901 Bacteria 39159
514 Ga0307406_10091012 3300031901 Bacteria 2054
515 Ga0307407_10000121 3300031903 Bacteria 25084
516 Ga0307412_10000396 3300031911 Bacteria 26833
517 Ga0307409_100001052 3300031995 Bacteria 12935
518 Ga0307416_100072833 3300032002 Bacteria 2861
519 Ga0307414_10000029 3300032004 Bacteria 191305
520 Ga0373930_0002600 3300034816 Bacteria 2805
521 Ga0373950_0006569 3300034818 Bacteria 1778
522 Ga0373928_0000050 3300035084 Bacteria 20631
523 Ga0373929_0001691 3300035085 Bacteria 4152
524 Ga0373944_0002853 3300035089 Bacteria 4423
525 Ga0373944_0012950 3300035089 Bacteria 2307
526 Ga0373949_0001510 3300035090 Bacteria 6603
527 Ga0373932_0000003 3300035112 Bacteria 459351
528 Ga0373936_0112393 3300035113 Bacteria 1158
529 Ga0373939_0004412 3300035114 Bacteria 3325
530 Ga0373954_0001465 3300035118 Bacteria 9598
531 Ga0373954_0038415 3300035118 Bacteria 2227
532 Ga0373943_0034222 3300035170 Bacteria 2423
533 Ga0373943_0168429 3300035170 Unclassified 1197
534 Ga0373955_0155462 3300035172 Bacteria 1347
535 Ga0373961_0087683 3300035241 Bacteria 989
536 Ga0373962_0000141 3300035242 Bacteria 14956
537 Ga0316574_0031651 3300035398 Bacteria 3210
538 Ga0373931_0000017 3300035691 Bacteria 207733
539 Ga0373931_0129245 3300035691 Bacteria 1452
540 Ga0373935_0011676 3300035692 Bacteria 5275
541 Ga0373935_0022090 3300035692 Bacteria 3898
542 Ga0373935_0103677 3300035692 Bacteria 1879
543 Ga0373927_0008040 3300035695 Bacteria 7122
544 Ga0373927_0120107 3300035695 Bacteria 1715
545 Ga0373933_0289067 3300035724 Bacteria 1060
546 Ga0373947_0110016 3300035725 Bacteria 1740
547 Ga0373947_0132159 3300035725 Bacteria 1594
548 Ga0373937_0006245 3300036401 Bacteria 10276
549 Ga0373925_0001786 3300037068 Bacteria 17953
550 Ga0373925_0286580 3300037068 Bacteria 1327
551 Ga0395899_0041168 3300037312 Unclassified 3453
552 Ga0395898_0000539 3300037466 Bacteria 71975
553 Ga0395898_0010108 3300037466 Bacteria 9876
554 Ga0395898_0445740 3300037466 Bacteria 1233
555 Ga0395905_0144190 3300037471 Unclassified 2241
556 Ga0436364_1116390 3300037853 Bacteria 4334
557 Ga0395901_0127841 3300038443 Unclassified 2671
558 Ga0436365_1021998 3300039437 Bacteria 1814
559 Ga0436365_1508062 3300039437 Bacteria 22768
560 Ga0436365_1788700 3300039437 Bacteria 67528
561 Ga0436360_0313800 3300039438 Bacteria 2357
562 Ga0436360_0663054 3300039438 Unclassified 2163
563 Ga0436360_1111282 3300039438 Unclassified 1828
564 Ga0436361_0024322 3300039447 Bacteria 1421
565 Ga0436361_0346675 3300039447 Bacteria 3754
566 Ga0436361_0420319 3300039447 Bacteria 4686
567 Ga0436361_0558325 3300039447 Bacteria 4898
568 Ga0436361_0690497 3300039447 Bacteria 1226
569 Ga0436362_0945614 3300039453 Bacteria 1751
570 Ga0436362_1173039 3300039453 Bacteria 1970
571 Ga0436362_1264546 3300039453 Bacteria 1277
572 Ga0439453_0000706 3300041408 Bacteria 3846
573 Ga0439437_009729 3300042000 Bacteria 1091
574 Ga0450890_000002 3300042127 Bacteria 117614
575 Ga0450892_000048 3300042130 Bacteria 12911
576 Ga0439458_0007525 3300042157 Bacteria 2425
577 Ga0439464_0049091 3300042439 Unclassified 1217
578 Ga0451577_0001681 3300042876 Bacteria 28578
579 Ga0451577_0356961 3300042876 Bacteria 1326
580 Ga0451577_0401649 3300042876 Bacteria 1244
581 Ga0466965_0007362 3300044683 Bacteria 5050
582 Ga0466964_0010000 3300044706 Bacteria 3575
583 Ga0453684_0063537 3300044712 Bacteria 4722
584 Ga0466971_0000072 3300044719 Bacteria 37014
585 Ga0466957_0017711 3300044842 Bacteria 4177
586 Ga0451576_0039206 3300045051 Bacteria 5014
587 Ga0451576_0116774 3300045051 Bacteria 2778
588 Ga0451576_0176973 3300045051 Unclassified 2227
589 Ga0451576_0201488 3300045051 Bacteria 2079
590 Ga0451576_0340533 3300045051 Bacteria 1570
591 Ga0495592_0000054 3300046454 Bacteria 107373
592 Ga0495592_0133511 3300046454 Bacteria 1734
593 Ga0495651_0024862 3300046462 Bacteria 4660
594 Ga0495662_0010383 3300046476 Bacteria 4561
595 Ga0495664_0114271 3300046477 Bacteria 1631
596 Ga0495618_0002303 3300046514 Bacteria 12371
597 Ga0495618_0004029 3300046514 Bacteria 9057
598 Ga0495628_0015266 3300046516 Bacteria 6416
599 Ga0495628_0069233 3300046516 Bacteria 2752
600 Ga0495628_0098302 3300046516 Bacteria 2261
601 Ga0495630_0057296 3300046517 Bacteria 2920
602 Ga0495630_0070115 3300046517 Bacteria 2637
603 Ga0495643_0000169 3300046522 Bacteria 103635
604 Ga0495666_0048120 3300046526 Unclassified 2054
605 Ga0495666_0103299 3300046526 Bacteria 1342
606 Ga0495642_0029357 3300046528 Bacteria 2195
607 Ga0495652_0065364 3300046529 Bacteria 3057
608 Ga0495652_0360964 3300046529 Bacteria 1038
609 Ga0495640_0128849 3300046533 Bacteria 1639
610 Ga0495586_0000670 3300046535 Bacteria 19540
611 Ga0495586_0002170 3300046535 Bacteria 10672
612 Ga0495587_0069297 3300046536 Bacteria 2054
613 Ga0495645_0001139 3300046543 Bacteria 18013
614 Ga0495645_0098224 3300046543 Bacteria 2084
615 Ga0495645_0146131 3300046543 Bacteria 1647
616 Ga0495634_0001299 3300046642 Bacteria 22825
617 Ga0495635_0163031 3300046663 Unclassified 1517
618 Ga0495599_0007170 3300046678 Bacteria 6750
619 Ga0495599_0061081 3300046678 Bacteria 2355
620 Ga0495599_0070646 3300046678 Bacteria 2179
621 Ga0495647_0123497 3300046681 Unclassified 1091
622 Ga0495613_0003308 3300046689 Bacteria 12067
623 Ga0495604_0172423 3300047317 Bacteria 1520
624 Ga0495674_0028557 3300047319 Bacteria 5084
625 Ga0495674_0102272 3300047319 Bacteria 2437
626 Ga0495674_0445213 3300047319 Bacteria 1041
627 Ga0495676_0097600 3300047321 Unclassified 2182
628 Ga0495675_0130960 3300047444 Bacteria 1559
629 Ga0495684_0066245 3300047471 Bacteria 2746
630 Ga0495684_0155579 3300047471 Bacteria 1708
631 Ga0496100_0089341 3300048903 Bacteria 2099
632 Ga0496102_0034391 3300048905 Bacteria 4557
633 Ga0496104_0118755 3300048907 Bacteria 2539
634 Ga0496104_0531716 3300048907 Unclassified 1087
635 Ga0496106_0018251 3300048909 Bacteria 5187
636 Ga0496106_0189648 3300048909 Bacteria 1634
637 Ga0496106_0326334 3300048909 Bacteria 1232
638 Ga0496107_0012270 3300048910 Bacteria 5980
639 Ga0496107_0093490 3300048910 Bacteria 2199
640 Ga0496108_0019559 3300048911 Bacteria 5562
641 Ga0496108_0102834 3300048911 Unclassified 2438
642 Ga0496109_0012074 3300048912 Bacteria 7443
643 Ga0496110_0099903 3300048913 Bacteria 2601
644 Ga0496111_0191926 3300048914 Bacteria 1519
645 Ga0496111_0255672 3300048914 Bacteria 1300
646 Ga0496112_0087601 3300048915 Unclassified 3081
647 Ga0496112_0153029 3300048915 Bacteria 2274
648 Ga0496112_0180885 3300048915 Bacteria 2072
649 Ga0496112_0308850 3300048915 Bacteria 1527
650 Ga0496112_0429651 3300048915 Unclassified 1259
651 Ga0496112_0680933 3300048915 Bacteria 957
652 Ga0496113_0132375 3300048916 Bacteria 1958
653 Ga0496113_0165434 3300048916 Unclassified 1750
654 Ga0496115_0007891 3300048918 Bacteria 7852
655 Ga0496115_0059318 3300048918 Unclassified 3081
656 Ga0496115_0281956 3300048918 Bacteria 1364
657 Ga0496121_0080873 3300048924 Bacteria 2574
658 Ga0496125_0000102 3300048928 Bacteria 201692
659 Ga0501031_0000012 3300049568 Bacteria 137943
660 Ga0501031_0168897 3300049568 Unclassified 1429
661 Ga0501032_0000441 3300049569 Bacteria 34085
662 Ga0501032_0007268 3300049569 Bacteria 8101
663 Ga0501033_0000018 3300049570 Bacteria 205482
664 Ga0501033_0002389 3300049570 Bacteria 15988
665 Ga0501033_0027773 3300049570 Bacteria 4254
666 Ga0501037_0144755 3300049573 Bacteria 1700
667 Ga0501038_0001861 3300049574 Bacteria 19481
668 Ga0501038_0006224 3300049574 Bacteria 11034
669 Ga0501039_0006972 3300049575 Bacteria 8606
670 Ga0501043_0042069 3300049579 Bacteria 3589
671 Ga0501043_0174909 3300049579 Unclassified 1674
672 Ga0501046_0165224 3300049580 Bacteria 1663
673 Ga0501047_0001289 3300049581 Bacteria 24753
674 Ga0501070_0018105 3300049586 Bacteria 5909
675 Ga0501070_0156970 3300049586 Bacteria 1876
676 Ga0501070_0185720 3300049586 Bacteria 1710
677 Ga0501257_019234 3300049686 Bacteria 1597
678 Ga0501080_0021554 3300049742 Bacteria 5964
679 Ga0501080_0059118 3300049742 Bacteria 3568
680 Ga0501035_0000002 3300049822 Bacteria 585447
681 Ga0501035_0001290 3300049822 Bacteria 25869
682 Ga0501035_0002720 3300049822 Bacteria 17169
683 Ga0501044_0000024 3300049823 Bacteria 194302
684 Ga0501044_0001541 3300049823 Bacteria 27035
685 nmdc:mga03683_141_c1 3300050489 Bacteria 24374
686 nmdc:mga03n38_163466_c1 3300050490 Viruses 1129
687 nmdc:mga0k408_11319_c1 3300050493 Bacteria 4855
688 nmdc:mga0k408_636_c1 3300050493 Bacteria 19345
689 nmdc:mga06r32_20384_c1 3300050510 Bacteria 6104
690 nmdc:mga08y16_184179_c1 3300050511 Unclassified 2167
691 nmdc:mga08y16_291175_c1 3300050511 Unclassified 1683
692 nmdc:mga0n895_289904_c1 3300050512 Bacteria 1659
693 nmdc:mga08x19_20679_c1 3300050514 Bacteria 4054
694 Ga0500555_000044 3300053103 Bacteria 64435
695 Ga0500556_0000010 3300053104 Bacteria 258288
696 Ga0500556_0010796 3300053104 Bacteria 2688
697 Ga0500642_0039191 3300053130 Bacteria 2036
698 Ga0500559_0001396 3300053136 Bacteria 13742
699 Ga0500568_0026447 3300053139 Bacteria 2435
700 Ga0500616_0005714 3300053153 Bacteria 8373
701 Ga0466962_0000139 3300061719 Bacteria 29705
702 2718716359 2718217752 Bacteria 915884
703 2787507649 2786546548 Bacteria 4745694
704 Ga0070664_100003479
705 CNXas_1000010
706 JGI24746J21847_1002232
707 JGI24737J22298_10049526
708 JGI24743J22301_10000180
709 JGI24033J26618_1000267
710 JGI24742J22300_10001701
711 rootH2_10016017
712 rootH2_10064210
713 rootH2_10284222
714 rootH1_10003502
715 JGI25405J52794_10000432
716 Ga0065704_10009461
717 Ga0065704_10011242
718 Ga0065704_10098924
719 Ga0065712_10080155
720 Ga0065712_10084596
721 Ga0065712_10124906
722 Ga0065715_10137461
723 Ga0065715_10179505
724 Ga0065707_10004617
725 Ga0065707_10010686
726 Ga0065707_10203773
727 Ga0065707_10210827
728 Ga0070676_10001595
729 Ga0070676_10036141
730 Ga0070676_10104584
731 Ga0070683_100032539
732 Ga0070683_100152477
733 Ga0070690_100004714
734 Ga0070690_100044685
735 Ga0070690_100156137
736 Ga0070670_100002866
737 Ga0070670_100035915
738 Ga0070670_100392042
739 Ga0070666_10064858
740 Ga0068868_100013546
741 Ga0068868_100124611
742 Ga0068868_100168499
743 Ga0070660_100049744
744 Ga0070660_100141896
745 Ga0070689_100032997
746 Ga0070689_100038101
747 Ga0070689_100081492
748 Ga0070689_100238321
749 Ga0070689_100384011
750 Ga0070691_10012273
751 Ga0070687_100021823
752 Ga0070687_100023175
753 Ga0070661_100000512
754 Ga0070668_100042021
755 Ga0070668_100050534
756 Ga0070668_100141923
757 Ga0070668_100172130
758 Ga0070668_100224397
759 Ga0070668_100453316
760 Ga0070669_100001514
761 Ga0070669_100008387
762 Ga0070669_100072636
763 Ga0070675_100001376
764 Ga0070675_100004395
765 Ga0070675_100090333
766 Ga0070675_100092576
767 Ga0070675_100132816
768 Ga0070675_100170940
769 Ga0070675_100414813
770 Ga0070671_100019012
771 Ga0070671_100224947
772 Ga0070671_100274268
773 Ga0070671_100366439
774 Ga0070671_100415123
775 Ga0070674_100088541
776 Ga0070674_100236682
777 Ga0070674_100246615
778 Ga0070674_100310633
779 Ga0070673_100119263
780 Ga0070673_100192715
781 Ga0070673_100213348
782 Ga0070688_100025475
783 Ga0070688_100043444
784 Ga0070659_100041310
785 Ga0070659_100070468
786 Ga0070667_100066880
787 Ga0070667_100076832
788 Ga0070667_100100989
789 Ga0070667_100280219
790 Ga0070709_10010292
791 Ga0070709_10295105
792 Ga0070714_100022507
793 Ga0070714_100080275
794 Ga0070714_100105244
795 Ga0070713_100044943
796 Ga0070713_100056786
797 Ga0070710_10016962
798 Ga0070701_10007999
799 Ga0070711_100000735
800 Ga0070711_100001885
801 Ga0070705_100076845
802 Ga0070708_100029133
803 Ga0070708_100029720
804 Ga0070708_100278920
805 Ga0070708_100310458
806 Ga0070663_100035045
807 Ga0070678_100011508
808 Ga0070678_100097756
809 Ga0070662_100011759
810 Ga0070662_100034437
811 Ga0070662_100178212
812 Ga0070681_10019854
813 Ga0068867_100000121
814 Ga0068867_100156939
815 Ga0070685_10075523
816 Ga0070706_100000339
817 Ga0070706_100001168
818 Ga0070706_100003751
819 Ga0070706_100079329
820 Ga0070707_100001522
821 Ga0070707_100010843
822 Ga0070707_100056296
823 Ga0070707_100080316
824 Ga0070707_100106426
825 Ga0070707_100175217
826 Ga0070707_100175503
827 Ga0070707_100525064
828 Ga0070698_100001525
829 Ga0070698_100004367
830 Ga0070698_100018823
831 Ga0070698_100030526
832 Ga0070698_100234988
833 Ga0070699_100042974
834 Ga0070699_100078433
835 Ga0070699_100090764
836 Ga0070699_100155645
837 Ga0070684_100259022
838 Ga0070684_100262337
839 Ga0070697_100019502
840 Ga0070697_100076188
841 Ga0070697_100194928
842 Ga0068853_100000075
843 Ga0068853_100147409
844 Ga0070672_100008263
845 Ga0070672_100080856
846 Ga0070686_100004345
847 Ga0070686_100253831
848 Ga0070686_100309861
849 Ga0070695_100124592
850 Ga0070665_100006037
851 Ga0070665_100080903
852 Ga0070665_100119558
853 Ga0070665_100249192
854 Ga0070665_100321591
855 Ga0070704_100055642
856 Ga0070704_100125279
857 Ga0068855_100007043
858 Ga0068855_100084103
859 Ga0068855_100238085
860 Ga0068855_100701618
861 Ga0070664_100069368
862 Ga0070664_100171104
863 Ga0068857_100126083
864 Ga0068854_100070375
865 Ga0068856_100001437
866 Ga0068856_100003901
867 Ga0068856_100054103
868 Ga0068856_100289515
869 Ga0068856_100441415
870 Ga0068859_100330914
871 Ga0068864_100031005
872 Ga0068864_100346657
873 Ga0068863_100031706
874 Ga0068863_100119083
875 Ga0068863_100282565
876 Ga0068863_100373542
877 Ga0068858_100011167
878 Ga0068858_100066720
879 Ga0068860_100000335
880 Ga0068860_100017681
881 Ga0068860_100129699
882 Ga0068860_100279531
883 Ga0068860_100454202
884 Ga0068862_100011766
885 Ga0081455_10000171
886 Ga0081455_10003966
887 Ga0081455_10009921
888 Ga0081455_10042131
889 Ga0081455_10109413
890 Ga0081455_10152931
891 Ga0081538_10060910
892 Ga0081540_1000225
893 Ga0081540_1010358
894 Ga0081540_1012037
895 Ga0081539_10000098
896 Ga0081539_10004649
897 Ga0081539_10058818
898 Ga0081539_10076733
899 Ga0070717_10011824
900 Ga0070717_10024005
901 Ga0070717_10086925
902 Ga0070717_10090738
903 Ga0070717_10107223
904 Ga0070717_10402752
905 Ga0075363_100043952
906 Ga0070716_100101978
907 Ga0070716_100252840
908 Ga0070716_100418380
909 Ga0075362_10000544
910 Ga0097621_100009753
911 Ga0097621_100023334
912 Ga0075370_10039868
913 Ga0068871_100127430
914 Ga0068871_100286693
915 Ga0068871_100433924
916 Ga0075431_100032699
917 Ga0075433_10228023
918 Ga0075433_10313266
919 Ga0075434_100167470
920 Ga0075434_100214968
921 Ga0075436_100114222
922 Ga0097620_100330908
923 Ga0075435_100043321
924 Ga0075435_100236514
925 Ga0075435_100444977
926 Ga0105240_10000124
927 Ga0105240_10006802
928 Ga0105240_10058709
929 Ga0105240_10232549
930 Ga0105240_10610075
931 Ga0111539_10092340
932 Ga0111539_10317399
933 Ga0111539_10727935
934 Ga0105245_10049473
935 Ga0105245_10124418
936 Ga0105247_10250955
937 Ga0114129_10236217
938 Ga0114129_10342862
939 Ga0105243_10000065
940 Ga0105237_10107962
941 Ga0105237_10285130
942 Ga0105237_10331894
943 Ga0105238_10000930
944 Ga0105238_10058537
945 Ga0105249_10001742
946 Ga0105249_10250191
947 Ga0099796_10105924
948 Ga0105239_10821047
949 Ga0157373_10001329
950 Ga0157370_10000098
951 Ga0157370_10073442
952 Ga0157374_10000036
953 Ga0157374_10024872
954 Ga0157374_10042694
955 Ga0157374_10044656
956 Ga0157374_10107462
957 Ga0157374_10109941
958 Ga0157374_10171382
959 Ga0157374_10210420
960 Ga0157374_10263517
961 Ga0157378_10006286
962 Ga0157378_10015155
963 Ga0157378_10028454
964 Ga0157378_10111580
965 Ga0157378_10140765
966 Ga0157378_10186626
967 Ga0157378_10302614
968 Ga0157378_10392043
969 Ga0163162_10044897
970 Ga0163162_10110346
971 Ga0163162_10111645
972 Ga0163162_10328229
973 Ga0163162_10338124
974 Ga0157372_10369506
975 Ga0157372_10503565
976 Ga0157375_10000006
977 Ga0157375_10000985
978 Ga0157375_10041020
979 Ga0157375_10058020
980 Ga0157375_10110333
981 Ga0157375_10113083
982 Ga0157375_10263678
983 Ga0157375_10303217
984 Ga0157375_10533466
985 Ga0157375_10805395
986 Ga0163163_10007622
987 Ga0163163_10142870
988 Ga0163163_10521036
989 Ga0157380_10439827
990 Ga0182008_10025254
991 Ga0157377_10016770
992 Ga0157377_10020618
993 Ga0157377_10030242
994 Ga0157379_10009934
995 Ga0157376_10000155
996 Ga0157376_10057828
997 Ga0157376_10078986
998 Ga0157376_10094693
999 Ga0157376_10103244
1000 Ga0163161_10012723
1001 Ga0206355_1514168
1002 Ga0213872_10002640
1003 Ga0213872_10105637
1004 Ga0213874_10039256
1005 Ga0213876_10000253
1006 Ga0213876_10001151
1007 Ga0213876_10051746
1008 Ga0213876_10099670
1009 Ga0213876_10135284
1010 Ga0213871_10020654
1011 Ga0207666_1001759
1012 Ga0209050_1000225
1013 Ga0207697_10000588
1014 Ga0207697_10000971
1015 Ga0207697_10001126
1016 Ga0207697_10001224
1017 Ga0207697_10008755
1018 Ga0207697_10013216
1019 Ga0207697_10031985
1020 Ga0207697_10055272
1021 Ga0207697_10139432
1022 Ga0207692_10058203
1023 Ga0207688_10010606
1024 Ga0207688_10040111
1025 Ga0207680_10197230
1026 Ga0207680_10323681
1027 Ga0207647_10019970
1028 Ga0207699_10013907
1029 Ga0207645_10000976
1030 Ga0207645_10002368
1031 Ga0207645_10074563
1032 Ga0207645_10245037
1033 Ga0207705_10007697
1034 Ga0207705_10183046
1035 Ga0207684_10000276
1036 Ga0207684_10001121
1037 Ga0207684_10003729
1038 Ga0207684_10027814
1039 Ga0207684_10340539
1040 Ga0207707_10022088
1041 Ga0207695_10000022
1042 Ga0207695_10022986
1043 Ga0207695_10154457
1044 Ga0207695_10254702
1045 Ga0207693_10002197
1046 Ga0207693_10082805
1047 Ga0207693_10132947
1048 Ga0207663_10000311
1049 Ga0207663_10015652
1050 Ga0207663_10025730
1051 Ga0207663_10036009
1052 Ga0207663_10490806
1053 Ga0207662_10000226
1054 Ga0207662_10034428
1055 Ga0207662_10300462
1056 Ga0207657_10119684
1057 Ga0207649_10000716
1058 Ga0207649_10013978
1059 Ga0207649_10249616
1060 Ga0207646_10005760
1061 Ga0207646_10013358
1062 Ga0207646_10030576
1063 Ga0207646_10056564
1064 Ga0207646_10093028
1065 Ga0207681_10018045
1066 Ga0207681_10084732
1067 Ga0207681_10299848
1068 Ga0207694_10007009
1069 Ga0207694_10017549
1070 Ga0207650_10029039
1071 Ga0207650_10084107
1072 Ga0207650_10168317
1073 Ga0207650_10260920
1074 Ga0207659_10009476
1075 Ga0207659_10031596
1076 Ga0207659_10086875
1077 Ga0207659_10101180
1078 Ga0207659_10227298
1079 Ga0207687_10033830
1080 Ga0207700_10045183
1081 Ga0207664_10081457
1082 Ga0207664_10099006
1083 Ga0207664_10118958
1084 Ga0207664_10255707
1085 Ga0207644_10034307
1086 Ga0207644_10077245
1087 Ga0207644_10338342
1088 Ga0207690_10062553
1089 Ga0207690_10101568
1090 Ga0207706_10001556
1091 Ga0207706_10094025
1092 Ga0207706_10101830
1093 Ga0207706_10136412
1094 Ga0207686_10231704
1095 Ga0207709_10000407
1096 Ga0207709_10001248
1097 Ga0207670_10002689
1098 Ga0207670_10079402
1099 Ga0207670_10082033
1100 Ga0207670_10196254
1101 Ga0207670_10321437
1102 Ga0207669_10058476
1103 Ga0207669_10262931
1104 Ga0207665_10065606
1105 Ga0207665_10068290
1106 Ga0207665_10296442
1107 Ga0207691_10069706
1108 Ga0207661_10116184
1109 Ga0207661_10170762
1110 Ga0207679_10006349
1111 Ga0207667_10004393
1112 Ga0207667_10068169
1113 Ga0207667_10255515
1114 Ga0207667_10544182
1115 Ga0207651_10076720
1116 Ga0207651_10078568
1117 Ga0207651_10188530
1118 Ga0207651_10343605
1119 Ga0207651_10371105
1120 Ga0207712_10008366
1121 Ga0207668_10029176
1122 Ga0207668_10035542
1123 Ga0207668_10238998
1124 Ga0207658_10015864
1125 Ga0207658_10114244
1126 Ga0207658_10126617
1127 Ga0207658_10194568
1128 Ga0207658_10199903
1129 Ga0207677_10049537
1130 Ga0207677_10049775
1131 Ga0207677_10351136
1132 Ga0207703_10034768
1133 Ga0207703_10049662
1134 Ga0207703_10261692
1135 Ga0207639_10000012
1136 Ga0207678_10004819
1137 Ga0207708_10070349
1138 Ga0207702_10007889
1139 Ga0207702_10030806
1140 Ga0207702_10158448
1141 Ga0207702_10220214
1142 Ga0207702_10227830
1143 Ga0207641_10029953
1144 Ga0207641_10195468
1145 Ga0207641_10243465
1146 Ga0207648_10007911
1147 Ga0207648_10065936
1148 Ga0207648_10402825
1149 Ga0207674_10070922
1150 Ga0207683_10003154
1151 Ga0207683_10039078
1152 Ga0207683_10048248
1153 Ga0207683_10289318
1154 Ga0268266_10017501
1155 Ga0268266_10188719
1156 Ga0268266_10347235
1157 Ga0268264_10000490
1158 Ga0268264_10012947
1159 Ga0268264_10122236
1160 Ga0268264_10409847
1161 Ga0265337_1000557
1162 Ga0265337_1006696
1163 Ga0265319_1000179
1164 Ga0265319_1015602
1165 Ga0265334_10036442
1166 Ga0265318_10077917
1167 Ga0265323_10009094
1168 Ga0265323_10065356
1169 Ga0265322_10002988
1170 Ga0265336_10000520
1171 Ga0265336_10035461
1172 Ga0265338_10000008
1173 Ga0265338_10000210
1174 Ga0265338_10000248
1175 Ga0265338_10000269
1176 Ga0265338_10000652
1177 Ga0265338_10000774
1178 Ga0265338_10001504
1179 Ga0265338_10005506
1180 Ga0265338_10014273
1181 Ga0265338_10015897
1182 Ga0265338_10018803
1183 Ga0265338_10024645
1184 Ga0265338_10060900
1185 Ga0265324_10000319
1186 Ga0265324_10000975
1187 Ga0265328_10006569
1188 Ga0265320_10000501
1189 Ga0265320_10000683
1190 Ga0265320_10045857
1191 Ga0265320_10058820
1192 Ga0265320_10097340
1193 Ga0265325_10008471
1194 Ga0265325_10022606
1195 Ga0265329_10000449
1196 Ga0265340_10006049
1197 Ga0265339_10025191
1198 Ga0265339_10031631
1199 Ga0265331_10017179
1200 Ga0265327_10002552
1201 Ga0265327_10007710
1202 Ga0265316_10001824
1203 Ga0265316_10020997
1204 Ga0265316_10047577
1205 Ga0265316_10055099
1206 Ga0265316_10116025
1207 Ga0265316_10413330
1208 Ga0307408_100000070
1209 Ga0307408_100015236
1210 Ga0265314_10000031
1211 Ga0265314_10053577
1212 Ga0265314_10093476
1213 Ga0265314_10105115
1214 Ga0265314_10153364
1215 Ga0265342_10035866
1216 Ga0307406_10000169
1217 Ga0307406_10091012
1218 Ga0307407_10000121
1219 Ga0307412_10000396
1220 Ga0307409_100001052
1221 Ga0307416_100072833
1222 Ga0307414_10000029
1223 Ga0373930_0002600
1224 Ga0373950_0006569
1225 Ga0373928_0000050
1226 Ga0373929_0001691
1227 Ga0373944_0002853
1228 Ga0373944_0012950
1229 Ga0373949_0001510
1230 Ga0373932_0000003
1231 Ga0373936_0112393
1232 Ga0373939_0004412
1233 Ga0373954_0001465
1234 Ga0373954_0038415
1235 Ga0373943_0034222
1236 Ga0373943_0168429
1237 Ga0373955_0155462
1238 Ga0373961_0087683
1239 Ga0373962_0000141
1240 Ga0316574_0031651
1241 Ga0373931_0000017
1242 Ga0373931_0129245
1243 Ga0373935_0011676
1244 Ga0373935_0022090
1245 Ga0373935_0103677
1246 Ga0373927_0008040
1247 Ga0373927_0120107
1248 Ga0373933_0289067
1249 Ga0373947_0110016
1250 Ga0373947_0132159
1251 Ga0373937_0006245
1252 Ga0373925_0001786
1253 Ga0373925_0286580
1254 Ga0395899_0041168
1255 Ga0395898_0000539
1256 Ga0395898_0010108
1257 Ga0395898_0445740
1258 Ga0395905_0144190
1259 Ga0436364_1116390
1260 Ga0395901_0127841
1261 Ga0436365_1021998
1262 Ga0436365_1508062
1263 Ga0436365_1788700
1264 Ga0436360_0313800
1265 Ga0436360_0663054
1266 Ga0436360_1111282
1267 Ga0436361_0024322
1268 Ga0436361_0346675
1269 Ga0436361_0420319
1270 Ga0436361_0558325
1271 Ga0436361_0690497
1272 Ga0436362_0945614
1273 Ga0436362_1173039
1274 Ga0436362_1264546
1275 Ga0439453_0000706
1276 Ga0439437_009729
1277 Ga0450890_000002
1278 Ga0450892_000048
1279 Ga0439458_0007525
1280 Ga0439464_0049091
1281 Ga0451577_0001681
1282 Ga0451577_0356961
1283 Ga0451577_0401649
1284 Ga0466965_0007362
1285 Ga0466964_0010000
1286 Ga0453684_0063537
1287 Ga0466971_0000072
1288 Ga0466957_0017711
1289 Ga0451576_0039206
1290 Ga0451576_0116774
1291 Ga0451576_0176973
1292 Ga0451576_0201488
1293 Ga0451576_0340533
1294 Ga0495592_0000054
1295 Ga0495592_0133511
1296 Ga0495651_0024862
1297 Ga0495662_0010383
1298 Ga0495664_0114271
1299 Ga0495618_0002303
1300 Ga0495618_0004029
1301 Ga0495628_0015266
1302 Ga0495628_0069233
1303 Ga0495628_0098302
1304 Ga0495630_0057296
1305 Ga0495630_0070115
1306 Ga0495643_0000169
1307 Ga0495666_0048120
1308 Ga0495666_0103299
1309 Ga0495642_0029357
1310 Ga0495652_0065364
1311 Ga0495652_0360964
1312 Ga0495640_0128849
1313 Ga0495586_0000670
1314 Ga0495586_0002170
1315 Ga0495587_0069297
1316 Ga0495645_0001139
1317 Ga0495645_0098224
1318 Ga0495645_0146131
1319 Ga0495634_0001299
1320 Ga0495635_0163031
1321 Ga0495599_0007170
1322 Ga0495599_0061081
1323 Ga0495599_0070646
1324 Ga0495647_0123497
1325 Ga0495613_0003308
1326 Ga0495604_0172423
1327 Ga0495674_0028557
1328 Ga0495674_0102272
1329 Ga0495674_0445213
1330 Ga0495676_0097600
1331 Ga0495675_0130960
1332 Ga0495684_0066245
1333 Ga0495684_0155579
1334 Ga0496100_0089341
1335 Ga0496102_0034391
1336 Ga0496104_0118755
1337 Ga0496104_0531716
1338 Ga0496106_0018251
1339 Ga0496106_0189648
1340 Ga0496106_0326334
1341 Ga0496107_0012270
1342 Ga0496107_0093490
1343 Ga0496108_0019559
1344 Ga0496108_0102834
1345 Ga0496109_0012074
1346 Ga0496110_0099903
1347 Ga0496111_0191926
1348 Ga0496111_0255672
1349 Ga0496112_0087601
1350 Ga0496112_0153029
1351 Ga0496112_0180885
1352 Ga0496112_0308850
1353 Ga0496112_0429651
1354 Ga0496112_0680933
1355 Ga0496113_0132375
1356 Ga0496113_0165434
1357 Ga0496115_0007891
1358 Ga0496115_0059318
1359 Ga0496115_0281956
1360 Ga0496121_0080873
1361 Ga0496125_0000102
1362 Ga0501031_0000012
1363 Ga0501031_0168897
1364 Ga0501032_0000441
1365 Ga0501032_0007268
1366 Ga0501033_0000018
1367 Ga0501033_0002389
1368 Ga0501033_0027773
1369 Ga0501037_0144755
1370 Ga0501038_0001861
1371 Ga0501038_0006224
1372 Ga0501039_0006972
1373 Ga0501043_0042069
1374 Ga0501043_0174909
1375 Ga0501046_0165224
1376 Ga0501047_0001289
1377 Ga0501070_0018105
1378 Ga0501070_0156970
1379 Ga0501070_0185720
1380 Ga0501257_019234
1381 Ga0501080_0021554
1382 Ga0501080_0059118
1383 Ga0501035_0000002
1384 Ga0501035_0001290
1385 Ga0501035_0002720
1386 Ga0501044_0000024
1387 Ga0501044_0001541
1388 nmdc:mga03683_141_c1
1389 nmdc:mga03n38_163466_c1
1390 nmdc:mga0k408_11319_c1
1391 nmdc:mga0k408_636_c1
1392 nmdc:mga06r32_20384_c1
1393 nmdc:mga08y16_184179_c1
1394 nmdc:mga08y16_291175_c1
1395 nmdc:mga0n895_289904_c1
1396 nmdc:mga08x19_20679_c1
1397 Ga0500555_000044
1398 Ga0500556_0000010
1399 Ga0500556_0010796
1400 Ga0500642_0039191
1401 Ga0500559_0001396
1402 Ga0500568_0026447
1403 Ga0500616_0005714
1404 Ga0466962_0000139
1405 2718716359
1406 2787507649

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

92

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9698 14 292
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9515 14 291
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9439 16 291
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9371 16 291
5exi-assembly1.cif.gz_A crystal structure of m. tuberculosis lipoyl synthase at 2.28 a resolution 0.9323 26 292
ID Description Score Start End Superfamily
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9786 65 275 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9694 65 275 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9681 60 277 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9593 60 277 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9573 1 270 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V5LSW9-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9911 1 263 GO:0016992
GO:0046872
GO:0051539
AF-A0A6N7M039-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.991 46 248 GO:0016992
GO:0046872
GO:0051539
AF-A0A3D3CMG9-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9902 65 256 GO:0016992
GO:0046872
GO:0051539
AF-A0A382S3P7-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9885 66 298 GO:0016992
GO:0046872
GO:0051539
AF-A0A1U7GNH4-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) 0.988 14 292 GO:0005737
GO:0016992
GO:0046872
GO:0051539

Map