F476295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 703 | 391 | 684 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100289780|Ga0307416_1002897803 |
| Length | 147 |
| Sequence | VAGTSTADAELAFEASTDLALRSSEDVVRLRGAVRERAIAAGLGLVDQTKIITAASELGRNTVQYGGGGTATVAIVTGKGGRRGVRLQFVDRGPGIADIDLALKDGYTTGGGLGLGLSGARRLSDEFELRSRPGEGTRVTILRWKPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 2 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 3 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 4 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 5 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 6 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 7 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 8 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 9 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 10 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 11 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 12 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 13 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 14 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 15 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 16 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 17 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 18 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 19 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 245 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 246 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 357 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.3 |
| Metatranscriptomes | 0 |
| Isolates | 2.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.84 |
| Nodule | 0.43 |
| Rhizoplane | 1.85 |
| Rhizosphere | 89.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10139171 | 3300003316 | Bacteria | 1824 |
| 2 | rootH2_10183960 | 3300003320 | Bacteria | 1637 |
| 3 | rootL2_10030680 | 3300003322 | Bacteria | 8099 |
| 4 | rootL2_10039180 | 3300003322 | Bacteria | 2138 |
| 5 | rootL2_10061762 | 3300003322 | Bacteria | 1674 |
| 6 | rootH1_10050409 | 3300003323 | Bacteria | 56358 |
| 7 | Ga0055524_1000053 | 3300003775 | Bacteria | 144892 |
| 8 | JGI25405J52794_10006918 | 3300003911 | Bacteria | 2080 |
| 9 | Ga0065165_1116071 | 3300005262 | Bacteria | 654 |
| 10 | Ga0070658_10001128 | 3300005327 | Bacteria | 22780 |
| 11 | Ga0070658_10104538 | 3300005327 | Bacteria | 2343 |
| 12 | Ga0070658_10229931 | 3300005327 | Bacteria | 1570 |
| 13 | Ga0070658_10230195 | 3300005327 | Bacteria | 1569 |
| 14 | Ga0070658_10979007 | 3300005327 | Bacteria | 736 |
| 15 | Ga0070676_10813073 | 3300005328 | Bacteria | 690 |
| 16 | Ga0070683_100945281 | 3300005329 | Bacteria | 827 |
| 17 | Ga0070690_100014098 | 3300005330 | Bacteria | 4738 |
| 18 | Ga0070670_100067240 | 3300005331 | Bacteria | 3075 |
| 19 | Ga0070670_101342121 | 3300005331 | Bacteria | 655 |
| 20 | Ga0068869_100172038 | 3300005334 | Bacteria | 1692 |
| 21 | Ga0068869_100570631 | 3300005334 | Bacteria | 953 |
| 22 | Ga0070666_10154080 | 3300005335 | Bacteria | 1604 |
| 23 | Ga0070680_100003184 | 3300005336 | Bacteria | 12192 |
| 24 | Ga0070680_100120036 | 3300005336 | Bacteria | 2194 |
| 25 | Ga0070680_100275800 | 3300005336 | Bacteria | 1424 |
| 26 | Ga0070680_100413854 | 3300005336 | Bacteria | 1150 |
| 27 | Ga0070682_100269085 | 3300005337 | Bacteria | 1237 |
| 28 | Ga0068868_100434416 | 3300005338 | Bacteria | 1139 |
| 29 | Ga0070660_100003463 | 3300005339 | Bacteria | 10864 |
| 30 | Ga0070660_100166220 | 3300005339 | Bacteria | 1780 |
| 31 | Ga0070689_100006738 | 3300005340 | Bacteria | 7984 |
| 32 | Ga0070689_100169672 | 3300005340 | Bacteria | 1767 |
| 33 | Ga0070687_100857239 | 3300005343 | Bacteria | 648 |
| 34 | Ga0070661_100361850 | 3300005344 | Bacteria | 1140 |
| 35 | Ga0070692_10046431 | 3300005345 | Bacteria | 2245 |
| 36 | Ga0070668_100833351 | 3300005347 | Bacteria | 821 |
| 37 | Ga0070669_100596968 | 3300005353 | Bacteria | 925 |
| 38 | Ga0070675_100811582 | 3300005354 | Unclassified | 855 |
| 39 | Ga0070674_100364042 | 3300005356 | Bacteria | 1172 |
| 40 | Ga0070673_100025140 | 3300005364 | Bacteria | 4378 |
| 41 | Ga0070673_100218708 | 3300005364 | Bacteria | 1648 |
| 42 | Ga0070673_101147492 | 3300005364 | Bacteria | 727 |
| 43 | Ga0070688_100141103 | 3300005365 | Bacteria | 1637 |
| 44 | Ga0070659_100125288 | 3300005366 | Bacteria | 2084 |
| 45 | Ga0070659_101353396 | 3300005366 | Bacteria | 632 |
| 46 | Ga0070714_100099223 | 3300005435 | Bacteria | 2563 |
| 47 | Ga0070713_100260801 | 3300005436 | Bacteria | 1584 |
| 48 | Ga0070701_10111036 | 3300005438 | Bacteria | 1532 |
| 49 | Ga0070701_10760553 | 3300005438 | Bacteria | 657 |
| 50 | Ga0070711_100945710 | 3300005439 | Bacteria | 737 |
| 51 | Ga0070705_100150530 | 3300005440 | Bacteria | 1543 |
| 52 | Ga0070700_100002626 | 3300005441 | Bacteria | 9192 |
| 53 | Ga0070700_100016842 | 3300005441 | Bacteria | 4168 |
| 54 | Ga0070700_101075440 | 3300005441 | Bacteria | 665 |
| 55 | Ga0070694_100540157 | 3300005444 | Bacteria | 932 |
| 56 | Ga0070663_101087340 | 3300005455 | Unclassified | 699 |
| 57 | Ga0070678_100028309 | 3300005456 | Bacteria | 3820 |
| 58 | Ga0070678_100197526 | 3300005456 | Bacteria | 1658 |
| 59 | Ga0070681_10116648 | 3300005458 | Bacteria | 2607 |
| 60 | Ga0070681_10270923 | 3300005458 | Bacteria | 1609 |
| 61 | Ga0070681_10702081 | 3300005458 | Bacteria | 927 |
| 62 | Ga0068867_100028822 | 3300005459 | Bacteria | 3997 |
| 63 | Ga0068867_101173629 | 3300005459 | Unclassified | 704 |
| 64 | Ga0070685_10016541 | 3300005466 | Bacteria | 3932 |
| 65 | Ga0070685_10017590 | 3300005466 | Bacteria | 3828 |
| 66 | Ga0070685_10237829 | 3300005466 | Bacteria | 1201 |
| 67 | Ga0070685_10543773 | 3300005466 | Bacteria | 828 |
| 68 | Ga0070698_100251978 | 3300005471 | Bacteria | 1698 |
| 69 | Ga0070679_100026857 | 3300005530 | Bacteria | 5662 |
| 70 | Ga0070679_100029361 | 3300005530 | Bacteria | 5426 |
| 71 | Ga0070679_100038082 | 3300005530 | Bacteria | 4780 |
| 72 | Ga0070679_100041268 | 3300005530 | Bacteria | 4592 |
| 73 | Ga0070679_100345386 | 3300005530 | Bacteria | 1436 |
| 74 | Ga0070679_100825197 | 3300005530 | Bacteria | 870 |
| 75 | Ga0070679_101217493 | 3300005530 | Bacteria | 698 |
| 76 | Ga0070684_100004937 | 3300005535 | Bacteria | 10179 |
| 77 | Ga0070684_101278260 | 3300005535 | Bacteria | 690 |
| 78 | Ga0070672_100015776 | 3300005543 | Bacteria | 5394 |
| 79 | Ga0070672_101504176 | 3300005543 | Bacteria | 603 |
| 80 | Ga0070686_100012542 | 3300005544 | Bacteria | 4829 |
| 81 | Ga0070686_100351496 | 3300005544 | Bacteria | 1108 |
| 82 | Ga0070695_100110679 | 3300005545 | Bacteria | 1863 |
| 83 | Ga0070696_100204993 | 3300005546 | Bacteria | 1474 |
| 84 | Ga0070696_101132939 | 3300005546 | Bacteria | 659 |
| 85 | Ga0070693_100161055 | 3300005547 | Bacteria | 1429 |
| 86 | Ga0070693_100197798 | 3300005547 | Bacteria | 1303 |
| 87 | Ga0070665_100002550 | 3300005548 | Bacteria | 20005 |
| 88 | Ga0070665_100113985 | 3300005548 | Bacteria | 2706 |
| 89 | Ga0070665_100916454 | 3300005548 | Bacteria | 889 |
| 90 | Ga0070665_102070826 | 3300005548 | Bacteria | 574 |
| 91 | Ga0070704_100657034 | 3300005549 | Bacteria | 926 |
| 92 | Ga0068855_100001103 | 3300005563 | Bacteria | 33569 |
| 93 | Ga0068855_100008079 | 3300005563 | Bacteria | 12714 |
| 94 | Ga0068855_100019512 | 3300005563 | Bacteria | 8147 |
| 95 | Ga0068855_100033873 | 3300005563 | Bacteria | 6093 |
| 96 | Ga0070664_100432787 | 3300005564 | Bacteria | 1206 |
| 97 | Ga0068857_100044553 | 3300005577 | Bacteria | 3936 |
| 98 | Ga0068857_100552029 | 3300005577 | Bacteria | 1085 |
| 99 | Ga0068857_100599601 | 3300005577 | Bacteria | 1041 |
| 100 | Ga0068857_101643573 | 3300005577 | Unclassified | 627 |
| 101 | Ga0068854_100014453 | 3300005578 | Bacteria | 5205 |
| 102 | Ga0068854_101551260 | 3300005578 | Unclassified | 602 |
| 103 | Ga0068856_100155196 | 3300005614 | Bacteria | 2299 |
| 104 | Ga0068856_100463843 | 3300005614 | Bacteria | 1287 |
| 105 | Ga0070702_100001989 | 3300005615 | Bacteria | 8611 |
| 106 | Ga0068852_100264107 | 3300005616 | Bacteria | 1654 |
| 107 | Ga0068852_100689139 | 3300005616 | Bacteria | 1031 |
| 108 | Ga0068859_100160678 | 3300005617 | Bacteria | 2326 |
| 109 | Ga0068859_100309242 | 3300005617 | Bacteria | 1674 |
| 110 | Ga0068859_100544978 | 3300005617 | Bacteria | 1255 |
| 111 | Ga0068859_101658899 | 3300005617 | Bacteria | 706 |
| 112 | Ga0068864_101197904 | 3300005618 | Bacteria | 758 |
| 113 | Ga0068866_10007387 | 3300005718 | Bacteria | 4598 |
| 114 | Ga0068861_100007885 | 3300005719 | Bacteria | 7327 |
| 115 | Ga0068861_101979189 | 3300005719 | Bacteria | 581 |
| 116 | Ga0068870_10139494 | 3300005840 | Bacteria | 1417 |
| 117 | Ga0068863_100333837 | 3300005841 | Bacteria | 1474 |
| 118 | Ga0068858_100152274 | 3300005842 | Bacteria | 2175 |
| 119 | Ga0068858_100199727 | 3300005842 | Bacteria | 1890 |
| 120 | Ga0068860_100179414 | 3300005843 | Bacteria | 2047 |
| 121 | Ga0068860_100306046 | 3300005843 | Bacteria | 1558 |
| 122 | Ga0068860_101469181 | 3300005843 | Bacteria | 703 |
| 123 | Ga0068862_100140171 | 3300005844 | Bacteria | 2145 |
| 124 | Ga0068862_100510650 | 3300005844 | Bacteria | 1142 |
| 125 | Ga0068862_101047838 | 3300005844 | Unclassified | 809 |
| 126 | Ga0068862_102006346 | 3300005844 | Unclassified | 589 |
| 127 | Ga0081455_10000014 | 3300005937 | Bacteria | 193884 |
| 128 | Ga0070717_10000036 | 3300006028 | Bacteria | 125184 |
| 129 | Ga0070717_10184259 | 3300006028 | Bacteria | 1821 |
| 130 | Ga0070717_10766210 | 3300006028 | Bacteria | 877 |
| 131 | Ga0075365_10423370 | 3300006038 | Bacteria | 940 |
| 132 | Ga0075368_10329072 | 3300006042 | Bacteria | 663 |
| 133 | Ga0075364_10535509 | 3300006051 | Bacteria | 801 |
| 134 | Ga0070715_10036392 | 3300006163 | Bacteria | 2030 |
| 135 | Ga0070712_100943231 | 3300006175 | Unclassified | 745 |
| 136 | Ga0075367_10232121 | 3300006178 | Bacteria | 1155 |
| 137 | Ga0075366_10043620 | 3300006195 | Bacteria | 2657 |
| 138 | Ga0097621_100022166 | 3300006237 | Bacteria | 4927 |
| 139 | Ga0075370_10308232 | 3300006353 | Bacteria | 942 |
| 140 | Ga0068871_100037404 | 3300006358 | Bacteria | 3870 |
| 141 | Ga0068871_100367646 | 3300006358 | Bacteria | 1275 |
| 142 | Ga0068871_100915719 | 3300006358 | Bacteria | 813 |
| 143 | Ga0068871_101679453 | 3300006358 | Bacteria | 602 |
| 144 | Ga0075428_100000226 | 3300006844 | Bacteria | 54970 |
| 145 | Ga0075428_100037690 | 3300006844 | Bacteria | 5321 |
| 146 | Ga0075428_100602726 | 3300006844 | Bacteria | 1173 |
| 147 | Ga0075431_100006379 | 3300006847 | Bacteria | 11705 |
| 148 | Ga0075431_100262936 | 3300006847 | Bacteria | 1751 |
| 149 | Ga0075431_101705587 | 3300006847 | Bacteria | 587 |
| 150 | Ga0075433_10351286 | 3300006852 | Bacteria | 1303 |
| 151 | Ga0075433_11047875 | 3300006852 | Unclassified | 710 |
| 152 | Ga0075434_101035319 | 3300006871 | Bacteria | 835 |
| 153 | Ga0075434_102064395 | 3300006871 | Bacteria | 575 |
| 154 | Ga0075434_102507014 | 3300006871 | Unclassified | 517 |
| 155 | Ga0075429_100009079 | 3300006880 | Bacteria | 8634 |
| 156 | Ga0075429_100168158 | 3300006880 | Unclassified | 1921 |
| 157 | Ga0075429_100228242 | 3300006880 | Bacteria | 1631 |
| 158 | Ga0068865_100173611 | 3300006881 | Bacteria | 1654 |
| 159 | Ga0075436_100002922 | 3300006914 | Bacteria | 11715 |
| 160 | Ga0075436_100007186 | 3300006914 | Bacteria | 7615 |
| 161 | Ga0075436_100321208 | 3300006914 | Bacteria | 1112 |
| 162 | Ga0097620_100160684 | 3300006931 | Bacteria | 2326 |
| 163 | Ga0097620_100309240 | 3300006931 | Bacteria | 1674 |
| 164 | Ga0097620_100544981 | 3300006931 | Bacteria | 1255 |
| 165 | Ga0097620_101658379 | 3300006931 | Bacteria | 706 |
| 166 | Ga0099826_10000006 | 3300006948 | Bacteria | 432260 |
| 167 | Ga0075435_102007094 | 3300007076 | Unclassified | 508 |
| 168 | Ga0105240_10551680 | 3300009093 | Bacteria | 1275 |
| 169 | Ga0111539_10000016 | 3300009094 | Bacteria | 276730 |
| 170 | Ga0111539_10002174 | 3300009094 | Bacteria | 26216 |
| 171 | Ga0111539_10007326 | 3300009094 | Bacteria | 14127 |
| 172 | Ga0111539_10843652 | 3300009094 | Bacteria | 1066 |
| 173 | Ga0111539_11160050 | 3300009094 | Unclassified | 898 |
| 174 | Ga0105245_10007823 | 3300009098 | Bacteria | 9362 |
| 175 | Ga0105247_10159095 | 3300009101 | Bacteria | 1494 |
| 176 | Ga0114129_10021544 | 3300009147 | Bacteria | 9150 |
| 177 | Ga0114129_10047439 | 3300009147 | Bacteria | 6035 |
| 178 | Ga0114129_10465416 | 3300009147 | Bacteria | 1656 |
| 179 | Ga0105243_10003699 | 3300009148 | Bacteria | 12290 |
| 180 | Ga0105242_10140337 | 3300009176 | Bacteria | 2096 |
| 181 | Ga0105248_10089155 | 3300009177 | Bacteria | 3472 |
| 182 | Ga0105248_10140343 | 3300009177 | Bacteria | 2726 |
| 183 | Ga0105248_10472666 | 3300009177 | Bacteria | 1413 |
| 184 | Ga0105237_10000012 | 3300009545 | Bacteria | 298377 |
| 185 | Ga0105237_10014196 | 3300009545 | Bacteria | 8341 |
| 186 | Ga0105237_10462738 | 3300009545 | Bacteria | 1274 |
| 187 | Ga0105238_10001720 | 3300009551 | Bacteria | 22065 |
| 188 | Ga0105249_10027997 | 3300009553 | Bacteria | 5087 |
| 189 | Ga0105249_10299259 | 3300009553 | Bacteria | 1613 |
| 190 | Ga0105249_11148901 | 3300009553 | Unclassified | 847 |
| 191 | Ga0105249_11684691 | 3300009553 | Bacteria | 707 |
| 192 | Ga0105239_10358868 | 3300010375 | Bacteria | 1646 |
| 193 | Ga0105239_10756816 | 3300010375 | Bacteria | 1112 |
| 194 | Ga0105246_10073253 | 3300011119 | Bacteria | 2418 |
| 195 | Ga0105246_10399892 | 3300011119 | Bacteria | 1140 |
| 196 | Ga0157373_10648608 | 3300013100 | Bacteria | 771 |
| 197 | Ga0157371_10582264 | 3300013102 | Bacteria | 831 |
| 198 | Ga0157371_10681822 | 3300013102 | Unclassified | 768 |
| 199 | Ga0157370_10002059 | 3300013104 | Bacteria | 24637 |
| 200 | Ga0157370_10002509 | 3300013104 | Bacteria | 22106 |
| 201 | Ga0157369_10003075 | 3300013105 | Bacteria | 19928 |
| 202 | Ga0157369_10004385 | 3300013105 | Bacteria | 16661 |
| 203 | Ga0157378_10043324 | 3300013297 | Bacteria | 3996 |
| 204 | Ga0157378_11152953 | 3300013297 | Bacteria | 813 |
| 205 | Ga0163162_10181697 | 3300013306 | Bacteria | 2229 |
| 206 | Ga0163162_11722967 | 3300013306 | Bacteria | 716 |
| 207 | Ga0157372_10009024 | 3300013307 | Bacteria | 10598 |
| 208 | Ga0157372_10476810 | 3300013307 | Bacteria | 1454 |
| 209 | Ga0157372_11679355 | 3300013307 | Bacteria | 731 |
| 210 | Ga0157375_13625221 | 3300013308 | Unclassified | 514 |
| 211 | Ga0163163_10137363 | 3300014325 | Unclassified | 2486 |
| 212 | Ga0157380_10081622 | 3300014326 | Bacteria | 2646 |
| 213 | Ga0157380_10104985 | 3300014326 | Bacteria | 2361 |
| 214 | Ga0157380_10384922 | 3300014326 | Bacteria | 1325 |
| 215 | Ga0157380_10488406 | 3300014326 | Bacteria | 1193 |
| 216 | Ga0157380_10553702 | 3300014326 | Bacteria | 1129 |
| 217 | Ga0157380_11998069 | 3300014326 | Unclassified | 642 |
| 218 | Ga0157380_12298480 | 3300014326 | Unclassified | 604 |
| 219 | Ga0157380_12340171 | 3300014326 | Bacteria | 599 |
| 220 | Ga0182008_10016812 | 3300014497 | Bacteria | 3795 |
| 221 | Ga0182008_10565645 | 3300014497 | Bacteria | 634 |
| 222 | Ga0157379_10089527 | 3300014968 | Bacteria | 2761 |
| 223 | Ga0157376_10839678 | 3300014969 | Bacteria | 933 |
| 224 | Ga0182006_1000042 | 3300015261 | Bacteria | 202969 |
| 225 | Ga0182007_10066084 | 3300015262 | Bacteria | 1184 |
| 226 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 227 | Ga0182005_1008283 | 3300015265 | Bacteria | 3071 |
| 228 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 229 | Ga0213872_10005586 | 3300021361 | Bacteria | 6425 |
| 230 | Ga0213872_10015310 | 3300021361 | Bacteria | 3568 |
| 231 | Ga0213872_10056966 | 3300021361 | Bacteria | 1770 |
| 232 | Ga0209565_1016569 | 3300025263 | Bacteria | 1636 |
| 233 | Ga0209564_1017872 | 3300025295 | Bacteria | 2736 |
| 234 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 235 | Ga0207642_10041913 | 3300025899 | Bacteria | 2008 |
| 236 | Ga0207680_10380949 | 3300025903 | Bacteria | 994 |
| 237 | Ga0207647_10003933 | 3300025904 | Bacteria | 11094 |
| 238 | Ga0207647_10504886 | 3300025904 | Bacteria | 674 |
| 239 | Ga0207685_10280035 | 3300025905 | Bacteria | 818 |
| 240 | Ga0207643_10142358 | 3300025908 | Bacteria | 1433 |
| 241 | Ga0207705_10057917 | 3300025909 | Bacteria | 2795 |
| 242 | Ga0207705_10065434 | 3300025909 | Unclassified | 2628 |
| 243 | Ga0207705_10635643 | 3300025909 | Unclassified | 830 |
| 244 | Ga0207705_10889176 | 3300025909 | Bacteria | 690 |
| 245 | Ga0207654_10618575 | 3300025911 | Bacteria | 774 |
| 246 | Ga0207707_10016645 | 3300025912 | Bacteria | 6409 |
| 247 | Ga0207707_10258464 | 3300025912 | Bacteria | 1511 |
| 248 | Ga0207707_10279185 | 3300025912 | Bacteria | 1447 |
| 249 | Ga0207707_10391968 | 3300025912 | Bacteria | 1193 |
| 250 | Ga0207707_10806817 | 3300025912 | Bacteria | 782 |
| 251 | Ga0207707_11065482 | 3300025912 | Bacteria | 660 |
| 252 | Ga0207695_10298660 | 3300025913 | Bacteria | 1502 |
| 253 | Ga0207671_10000029 | 3300025914 | Bacteria | 254968 |
| 254 | Ga0207671_10007997 | 3300025914 | Bacteria | 9056 |
| 255 | Ga0207671_10678524 | 3300025914 | Unclassified | 820 |
| 256 | Ga0207693_10375686 | 3300025915 | Bacteria | 1112 |
| 257 | Ga0207693_10624526 | 3300025915 | Bacteria | 838 |
| 258 | Ga0207663_11491445 | 3300025916 | Bacteria | 544 |
| 259 | Ga0207660_10000785 | 3300025917 | Bacteria | 21106 |
| 260 | Ga0207660_10038108 | 3300025917 | Bacteria | 3355 |
| 261 | Ga0207660_10174318 | 3300025917 | Bacteria | 1667 |
| 262 | Ga0207660_10198600 | 3300025917 | Bacteria | 1566 |
| 263 | Ga0207660_10367620 | 3300025917 | Bacteria | 1155 |
| 264 | Ga0207662_10042815 | 3300025918 | Bacteria | 2670 |
| 265 | Ga0207662_10444356 | 3300025918 | Bacteria | 886 |
| 266 | Ga0207657_10005066 | 3300025919 | Bacteria | 13822 |
| 267 | Ga0207657_10228271 | 3300025919 | Bacteria | 1490 |
| 268 | Ga0207657_10265115 | 3300025919 | Bacteria | 1366 |
| 269 | Ga0207649_10310279 | 3300025920 | Bacteria | 1156 |
| 270 | Ga0207652_10061822 | 3300025921 | Bacteria | 3235 |
| 271 | Ga0207652_10199441 | 3300025921 | Bacteria | 1801 |
| 272 | Ga0207652_10227272 | 3300025921 | Bacteria | 1682 |
| 273 | Ga0207652_10410038 | 3300025921 | Bacteria | 1222 |
| 274 | Ga0207652_10630206 | 3300025921 | Bacteria | 960 |
| 275 | Ga0207652_11350306 | 3300025921 | Bacteria | 616 |
| 276 | Ga0207681_10839870 | 3300025923 | Bacteria | 768 |
| 277 | Ga0207694_10013044 | 3300025924 | Bacteria | 6255 |
| 278 | Ga0207650_10366683 | 3300025925 | Bacteria | 1187 |
| 279 | Ga0207687_10288662 | 3300025927 | Bacteria | 1318 |
| 280 | Ga0207700_10051893 | 3300025928 | Bacteria | 3063 |
| 281 | Ga0207700_10532336 | 3300025928 | Bacteria | 1042 |
| 282 | Ga0207664_10051484 | 3300025929 | Bacteria | 3252 |
| 283 | Ga0207664_10525446 | 3300025929 | Bacteria | 1061 |
| 284 | Ga0207690_10578793 | 3300025932 | Bacteria | 915 |
| 285 | Ga0207686_10039024 | 3300025934 | Bacteria | 2878 |
| 286 | Ga0207709_10010267 | 3300025935 | Bacteria | 5158 |
| 287 | Ga0207670_10042394 | 3300025936 | Bacteria | 2998 |
| 288 | Ga0207670_10268969 | 3300025936 | Bacteria | 1324 |
| 289 | Ga0207669_10088581 | 3300025937 | Bacteria | 2008 |
| 290 | Ga0207704_10021968 | 3300025938 | Bacteria | 3410 |
| 291 | Ga0207665_10090988 | 3300025939 | Bacteria | 2115 |
| 292 | Ga0207691_10016851 | 3300025940 | Bacteria | 6933 |
| 293 | Ga0207711_10410744 | 3300025941 | Bacteria | 1258 |
| 294 | Ga0207711_10623261 | 3300025941 | Bacteria | 1006 |
| 295 | Ga0207689_10003010 | 3300025942 | Bacteria | 15541 |
| 296 | Ga0207689_10587932 | 3300025942 | Bacteria | 936 |
| 297 | Ga0207661_10010866 | 3300025944 | Bacteria | 6570 |
| 298 | Ga0207661_10478239 | 3300025944 | Bacteria | 1137 |
| 299 | Ga0207661_10912634 | 3300025944 | Bacteria | 809 |
| 300 | Ga0207679_10018197 | 3300025945 | Bacteria | 4703 |
| 301 | Ga0207667_10005066 | 3300025949 | Bacteria | 16095 |
| 302 | Ga0207667_10005792 | 3300025949 | Bacteria | 15075 |
| 303 | Ga0207667_10008709 | 3300025949 | Bacteria | 12025 |
| 304 | Ga0207667_10106081 | 3300025949 | Bacteria | 2898 |
| 305 | Ga0207667_11012733 | 3300025949 | Bacteria | 817 |
| 306 | Ga0207712_10069421 | 3300025961 | Bacteria | 2528 |
| 307 | Ga0207712_10139576 | 3300025961 | Bacteria | 1858 |
| 308 | Ga0207712_11549907 | 3300025961 | Bacteria | 594 |
| 309 | Ga0207640_11097968 | 3300025981 | Bacteria | 704 |
| 310 | Ga0207658_11599948 | 3300025986 | Bacteria | 596 |
| 311 | Ga0207658_11633505 | 3300025986 | Bacteria | 589 |
| 312 | Ga0207677_10363820 | 3300026023 | Bacteria | 1216 |
| 313 | Ga0207703_10051062 | 3300026035 | Bacteria | 3349 |
| 314 | Ga0207703_10175707 | 3300026035 | Bacteria | 1887 |
| 315 | Ga0207639_10000009 | 3300026041 | Bacteria | 432727 |
| 316 | Ga0207639_12153296 | 3300026041 | Bacteria | 519 |
| 317 | Ga0207678_11654541 | 3300026067 | Bacteria | 563 |
| 318 | Ga0207708_10001951 | 3300026075 | Bacteria | 15210 |
| 319 | Ga0207708_11471769 | 3300026075 | Unclassified | 598 |
| 320 | Ga0207702_10065885 | 3300026078 | Bacteria | 3103 |
| 321 | Ga0207702_10218293 | 3300026078 | Bacteria | 1776 |
| 322 | Ga0207641_11610818 | 3300026088 | Unclassified | 651 |
| 323 | Ga0207648_10005501 | 3300026089 | Bacteria | 12768 |
| 324 | Ga0207648_12133391 | 3300026089 | Unclassified | 521 |
| 325 | Ga0207674_10061068 | 3300026116 | Bacteria | 3809 |
| 326 | Ga0207675_100001542 | 3300026118 | Bacteria | 23075 |
| 327 | Ga0207683_10042530 | 3300026121 | Bacteria | 3969 |
| 328 | Ga0207698_10050668 | 3300026142 | Bacteria | 3169 |
| 329 | Ga0207698_10113392 | 3300026142 | Bacteria | 2277 |
| 330 | Ga0209281_1003273 | 3300027111 | Bacteria | 5485 |
| 331 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 332 | Ga0207428_10000020 | 3300027907 | Bacteria | 276713 |
| 333 | Ga0207428_10005589 | 3300027907 | Bacteria | 11692 |
| 334 | Ga0207428_10023676 | 3300027907 | Bacteria | 5160 |
| 335 | Ga0207428_10028142 | 3300027907 | Bacteria | 4672 |
| 336 | Ga0268266_10220152 | 3300028379 | Bacteria | 1744 |
| 337 | Ga0268266_10459017 | 3300028379 | Bacteria | 1212 |
| 338 | Ga0268266_10528348 | 3300028379 | Bacteria | 1129 |
| 339 | Ga0268265_10028174 | 3300028380 | Bacteria | 4019 |
| 340 | Ga0268265_10212748 | 3300028380 | Bacteria | 1686 |
| 341 | Ga0268265_10309817 | 3300028380 | Bacteria | 1425 |
| 342 | Ga0268265_10425999 | 3300028380 | Bacteria | 1233 |
| 343 | Ga0268265_10529325 | 3300028380 | Bacteria | 1115 |
| 344 | Ga0268265_10607820 | 3300028380 | Bacteria | 1046 |
| 345 | Ga0268264_10106910 | 3300028381 | Bacteria | 2443 |
| 346 | Ga0268264_10268383 | 3300028381 | Bacteria | 1593 |
| 347 | Ga0268264_11103148 | 3300028381 | Bacteria | 802 |
| 348 | Ga0307515_10131650 | 3300028794 | Bacteria | 2750 |
| 349 | Ga0265338_10028566 | 3300028800 | Bacteria | 5558 |
| 350 | Ga0307509_10081840 | 3300031507 | Bacteria | 3333 |
| 351 | Ga0307408_100003066 | 3300031548 | Bacteria | 11529 |
| 352 | Ga0307408_100298101 | 3300031548 | Bacteria | 1349 |
| 353 | Ga0265313_10220561 | 3300031595 | Bacteria | 782 |
| 354 | Ga0307514_10277457 | 3300031649 | Bacteria | 963 |
| 355 | Ga0307405_10002451 | 3300031731 | Bacteria | 8178 |
| 356 | Ga0307405_10054159 | 3300031731 | Bacteria | 2503 |
| 357 | Ga0307405_10353393 | 3300031731 | Bacteria | 1134 |
| 358 | Ga0307405_10870958 | 3300031731 | Bacteria | 760 |
| 359 | Ga0307405_10875321 | 3300031731 | Bacteria | 758 |
| 360 | Ga0307405_11624257 | 3300031731 | Bacteria | 571 |
| 361 | Ga0307413_10000693 | 3300031824 | Bacteria | 11527 |
| 362 | Ga0307413_10040495 | 3300031824 | Bacteria | 2719 |
| 363 | Ga0307413_10195166 | 3300031824 | Bacteria | 1457 |
| 364 | Ga0307413_10380658 | 3300031824 | Bacteria | 1099 |
| 365 | Ga0307413_10577946 | 3300031824 | Bacteria | 916 |
| 366 | Ga0307413_10776131 | 3300031824 | Bacteria | 803 |
| 367 | Ga0307518_10177492 | 3300031838 | Bacteria | 1444 |
| 368 | Ga0307410_10000242 | 3300031852 | Bacteria | 20597 |
| 369 | Ga0307410_10091729 | 3300031852 | Bacteria | 2158 |
| 370 | Ga0307410_10653981 | 3300031852 | Bacteria | 882 |
| 371 | Ga0307406_10000861 | 3300031901 | Bacteria | 17085 |
| 372 | Ga0307406_10134260 | 3300031901 | Bacteria | 1742 |
| 373 | Ga0307406_10151560 | 3300031901 | Bacteria | 1655 |
| 374 | Ga0307407_10000863 | 3300031903 | Bacteria | 10167 |
| 375 | Ga0307407_10042714 | 3300031903 | Bacteria | 2544 |
| 376 | Ga0307407_10053308 | 3300031903 | Bacteria | 2327 |
| 377 | Ga0307412_10004727 | 3300031911 | Bacteria | 7600 |
| 378 | Ga0307412_10516573 | 3300031911 | Bacteria | 997 |
| 379 | Ga0307412_11016421 | 3300031911 | Unclassified | 733 |
| 380 | Ga0307412_11061513 | 3300031911 | Bacteria | 719 |
| 381 | Ga0307409_100000279 | 3300031995 | Bacteria | 20674 |
| 382 | Ga0307409_100022928 | 3300031995 | Bacteria | 4313 |
| 383 | Ga0307409_100160957 | 3300031995 | Bacteria | 1963 |
| 384 | Ga0307409_100453468 | 3300031995 | Bacteria | 1238 |
| 385 | Ga0307416_100000333 | 3300032002 | Bacteria | 24386 |
| 386 | Ga0307416_100033131 | 3300032002 | Bacteria | 3913 |
| 387 | Ga0307416_100207453 | 3300032002 | Bacteria | 1865 |
| 388 | Ga0307416_100289780 | 3300032002 | Bacteria | 1620 |
| 389 | Ga0307416_101356067 | 3300032002 | Bacteria | 817 |
| 390 | Ga0307416_101366091 | 3300032002 | Bacteria | 814 |
| 391 | Ga0307416_101635456 | 3300032002 | Bacteria | 749 |
| 392 | Ga0307416_102414286 | 3300032002 | Bacteria | 625 |
| 393 | Ga0307416_102622839 | 3300032002 | Bacteria | 601 |
| 394 | Ga0307414_10032339 | 3300032004 | Bacteria | 3443 |
| 395 | Ga0307414_10063787 | 3300032004 | Bacteria | 2620 |
| 396 | Ga0307414_10346838 | 3300032004 | Bacteria | 1273 |
| 397 | Ga0307414_10736238 | 3300032004 | Bacteria | 895 |
| 398 | Ga0307414_11692986 | 3300032004 | Unclassified | 590 |
| 399 | Ga0307411_10000636 | 3300032005 | Bacteria | 12721 |
| 400 | Ga0307411_10032059 | 3300032005 | Bacteria | 3243 |
| 401 | Ga0307411_10111683 | 3300032005 | Bacteria | 1957 |
| 402 | Ga0307411_10468984 | 3300032005 | Bacteria | 1057 |
| 403 | Ga0307411_10702929 | 3300032005 | Unclassified | 881 |
| 404 | Ga0307411_11278700 | 3300032005 | Bacteria | 668 |
| 405 | Ga0307415_100002195 | 3300032126 | Bacteria | 9661 |
| 406 | Ga0307415_100089144 | 3300032126 | Bacteria | 2227 |
| 407 | Ga0307415_100501589 | 3300032126 | Unclassified | 1061 |
| 408 | Ga0307415_100677348 | 3300032126 | Bacteria | 928 |
| 409 | Ga0307415_100760724 | 3300032126 | Bacteria | 880 |
| 410 | Ga0307415_101893297 | 3300032126 | Bacteria | 579 |
| 411 | Ga0373948_0082320 | 3300034817 | Bacteria | 736 |
| 412 | Ga0373934_0150904 | 3300035086 | Bacteria | 952 |
| 413 | Ga0373940_0076869 | 3300035088 | Bacteria | 981 |
| 414 | Ga0373949_0132512 | 3300035090 | Unclassified | 708 |
| 415 | Ga0373952_0006708 | 3300035092 | Bacteria | 2136 |
| 416 | Ga0373952_0171144 | 3300035092 | Bacteria | 621 |
| 417 | Ga0373923_0519553 | 3300035111 | Unclassified | 582 |
| 418 | Ga0373932_0000476 | 3300035112 | Bacteria | 12299 |
| 419 | Ga0373960_0062686 | 3300035121 | Bacteria | 1132 |
| 420 | Ga0373943_0852558 | 3300035170 | Bacteria | 543 |
| 421 | Ga0373946_0373535 | 3300035171 | Bacteria | 716 |
| 422 | Ga0373955_0044590 | 3300035172 | Bacteria | 2390 |
| 423 | Ga0373955_0130994 | 3300035172 | Bacteria | 1464 |
| 424 | Ga0373955_0334499 | 3300035172 | Bacteria | 916 |
| 425 | Ga0373942_0016086 | 3300035207 | Bacteria | 1831 |
| 426 | Ga0373961_0073445 | 3300035241 | Bacteria | 1062 |
| 427 | Ga0373935_0018247 | 3300035692 | Bacteria | 4266 |
| 428 | Ga0373935_0671051 | 3300035692 | Unclassified | 761 |
| 429 | Ga0373927_0244245 | 3300035695 | Bacteria | 1180 |
| 430 | Ga0373927_0318049 | 3300035695 | Bacteria | 1025 |
| 431 | Ga0373927_0480261 | 3300035695 | Bacteria | 821 |
| 432 | Ga0373933_0100729 | 3300035724 | Bacteria | 1792 |
| 433 | Ga0373933_0350557 | 3300035724 | Bacteria | 959 |
| 434 | Ga0373933_0662190 | 3300035724 | Bacteria | 686 |
| 435 | Ga0373937_0057662 | 3300036401 | Bacteria | 3568 |
| 436 | Ga0373937_0078823 | 3300036401 | Bacteria | 3045 |
| 437 | Ga0373937_0099742 | 3300036401 | Bacteria | 2694 |
| 438 | Ga0373937_1764998 | 3300036401 | Bacteria | 565 |
| 439 | Ga0373925_0053750 | 3300037068 | Bacteria | 3012 |
| 440 | Ga0373925_0126901 | 3300037068 | Bacteria | 1986 |
| 441 | Ga0395899_0012086 | 3300037312 | Bacteria | 6614 |
| 442 | Ga0395900_0013169 | 3300037418 | Bacteria | 8453 |
| 443 | Ga0395900_0341037 | 3300037418 | Bacteria | 1474 |
| 444 | Ga0395898_0005775 | 3300037466 | Bacteria | 13317 |
| 445 | Ga0395898_0307138 | 3300037466 | Unclassified | 1513 |
| 446 | Ga0395905_0115299 | 3300037471 | Bacteria | 2525 |
| 447 | Ga0395905_0644266 | 3300037471 | Bacteria | 961 |
| 448 | Ga0395905_1779310 | 3300037471 | Bacteria | 522 |
| 449 | Ga0395901_0035092 | 3300038443 | Bacteria | 5183 |
| 450 | Ga0395901_0038821 | 3300038443 | Bacteria | 4925 |
| 451 | Ga0436365_1454359 | 3300039437 | Bacteria | 631 |
| 452 | Ga0436365_1665182 | 3300039437 | Bacteria | 16581 |
| 453 | Ga0436361_0413757 | 3300039447 | Bacteria | 13774 |
| 454 | Ga0436361_0919867 | 3300039447 | Bacteria | 1324 |
| 455 | Ga0436361_0961791 | 3300039447 | Bacteria | 1354 |
| 456 | Ga0436361_0962333 | 3300039447 | Bacteria | 1731 |
| 457 | Ga0436362_0089214 | 3300039453 | Bacteria | 1822 |
| 458 | Ga0439436_0061058 | 3300041404 | Bacteria | 1055 |
| 459 | Ga0451835_1199059 | 3300041492 | Bacteria | 560 |
| 460 | Ga0450904_005021 | 3300042139 | Bacteria | 1355 |
| 461 | Ga0451577_0505903 | 3300042876 | Bacteria | 1097 |
| 462 | Ga0466972_0048350 | 3300044658 | Bacteria | 2055 |
| 463 | Ga0466982_0125914 | 3300044672 | Bacteria | 1579 |
| 464 | Ga0466965_0046091 | 3300044683 | Bacteria | 2157 |
| 465 | Ga0466965_0554776 | 3300044683 | Bacteria | 649 |
| 466 | Ga0466966_0143183 | 3300044684 | Bacteria | 1460 |
| 467 | Ga0466961_0208207 | 3300044693 | Bacteria | 1208 |
| 468 | Ga0466963_0584106 | 3300044694 | Bacteria | 789 |
| 469 | Ga0466964_0042039 | 3300044706 | Bacteria | 1851 |
| 470 | Ga0466968_0018413 | 3300044735 | Bacteria | 2801 |
| 471 | Ga0466968_0085819 | 3300044735 | Bacteria | 1389 |
| 472 | Ga0466970_0004357 | 3300044765 | Bacteria | 6972 |
| 473 | Ga0466970_0126580 | 3300044765 | Bacteria | 1401 |
| 474 | Ga0466957_0265881 | 3300044842 | Bacteria | 1144 |
| 475 | Ga0466957_1438368 | 3300044842 | Unclassified | 502 |
| 476 | Ga0466960_0089231 | 3300044901 | Bacteria | 1568 |
| 477 | Ga0466960_0351065 | 3300044901 | Bacteria | 841 |
| 478 | Ga0466960_0430497 | 3300044901 | Bacteria | 764 |
| 479 | Ga0466959_0009284 | 3300045049 | Bacteria | 6989 |
| 480 | Ga0451576_0561119 | 3300045051 | Bacteria | 1200 |
| 481 | Ga0466967_0561193 | 3300045976 | Bacteria | 1124 |
| 482 | Ga0466967_1262505 | 3300045976 | Bacteria | 736 |
| 483 | Ga0466967_2570491 | 3300045976 | Bacteria | 504 |
| 484 | Ga0495651_1011169 | 3300046462 | Bacteria | 504 |
| 485 | Ga0495650_0085656 | 3300046471 | Bacteria | 1207 |
| 486 | Ga0495580_0046966 | 3300046472 | Bacteria | 3062 |
| 487 | Ga0495580_0048809 | 3300046472 | Unclassified | 2995 |
| 488 | Ga0495582_0052425 | 3300046473 | Bacteria | 2250 |
| 489 | Ga0495639_0017984 | 3300046475 | Bacteria | 3073 |
| 490 | Ga0495639_0180740 | 3300046475 | Bacteria | 1027 |
| 491 | Ga0495662_0008247 | 3300046476 | Bacteria | 5132 |
| 492 | Ga0495584_0172400 | 3300046491 | Bacteria | 1099 |
| 493 | Ga0495585_0003702 | 3300046492 | Bacteria | 10216 |
| 494 | Ga0495585_0024732 | 3300046492 | Bacteria | 3442 |
| 495 | Ga0495594_0518035 | 3300046499 | Bacteria | 677 |
| 496 | Ga0495596_0033604 | 3300046500 | Bacteria | 2040 |
| 497 | Ga0495607_0131773 | 3300046501 | Bacteria | 1300 |
| 498 | Ga0495607_0275535 | 3300046501 | Bacteria | 800 |
| 499 | Ga0495583_0085190 | 3300046506 | Bacteria | 1368 |
| 500 | Ga0495606_0063614 | 3300046507 | Bacteria | 2351 |
| 501 | Ga0495606_0089158 | 3300046507 | Bacteria | 1900 |
| 502 | Ga0495606_0094953 | 3300046507 | Bacteria | 1827 |
| 503 | Ga0495616_0001048 | 3300046513 | Bacteria | 19722 |
| 504 | Ga0495616_0005059 | 3300046513 | Bacteria | 8203 |
| 505 | Ga0495620_0006267 | 3300046515 | Bacteria | 6548 |
| 506 | Ga0495628_0188683 | 3300046516 | Bacteria | 1557 |
| 507 | Ga0495630_0089205 | 3300046517 | Bacteria | 2329 |
| 508 | Ga0495630_0352729 | 3300046517 | Bacteria | 1126 |
| 509 | Ga0495631_0085548 | 3300046518 | Bacteria | 1358 |
| 510 | Ga0495631_0098152 | 3300046518 | Bacteria | 1261 |
| 511 | Ga0495637_0051051 | 3300046520 | Bacteria | 1733 |
| 512 | Ga0495643_0000003 | 3300046522 | Bacteria | 571962 |
| 513 | Ga0495643_0048489 | 3300046522 | Bacteria | 2295 |
| 514 | Ga0495643_0101005 | 3300046522 | Bacteria | 1478 |
| 515 | Ga0495642_0001678 | 3300046528 | Bacteria | 9592 |
| 516 | Ga0495642_0407943 | 3300046528 | Bacteria | 599 |
| 517 | Ga0495665_0040221 | 3300046531 | Bacteria | 2490 |
| 518 | Ga0495665_0040822 | 3300046531 | Unclassified | 2470 |
| 519 | Ga0495640_0218253 | 3300046533 | Bacteria | 1203 |
| 520 | Ga0495586_0114441 | 3300046535 | Bacteria | 1503 |
| 521 | Ga0495586_0205985 | 3300046535 | Bacteria | 1116 |
| 522 | Ga0495586_0349855 | 3300046535 | Bacteria | 849 |
| 523 | Ga0495609_0001447 | 3300046538 | Bacteria | 15768 |
| 524 | Ga0495609_0014519 | 3300046538 | Bacteria | 3700 |
| 525 | Ga0495609_0027667 | 3300046538 | Bacteria | 2590 |
| 526 | Ga0495609_0216022 | 3300046538 | Bacteria | 797 |
| 527 | Ga0495645_0085696 | 3300046543 | Bacteria | 2255 |
| 528 | Ga0495622_0025563 | 3300046557 | Bacteria | 2757 |
| 529 | Ga0495633_0144813 | 3300046558 | Bacteria | 1098 |
| 530 | Ga0495667_0202268 | 3300046559 | Bacteria | 1271 |
| 531 | Ga0495668_0045789 | 3300046616 | Bacteria | 2432 |
| 532 | Ga0495625_0072250 | 3300046660 | Bacteria | 2420 |
| 533 | Ga0495625_0210218 | 3300046660 | Bacteria | 1279 |
| 534 | Ga0495659_0368303 | 3300046664 | Bacteria | 616 |
| 535 | Ga0495661_0008237 | 3300046665 | Bacteria | 7221 |
| 536 | Ga0495588_0001439 | 3300046674 | Bacteria | 10183 |
| 537 | Ga0495623_0152070 | 3300046679 | Bacteria | 1367 |
| 538 | Ga0495647_0084956 | 3300046681 | Bacteria | 1289 |
| 539 | Ga0495669_0562547 | 3300046684 | Bacteria | 555 |
| 540 | Ga0495624_0078271 | 3300046690 | Bacteria | 2051 |
| 541 | Ga0495649_0008250 | 3300046694 | Bacteria | 6276 |
| 542 | Ga0495600_0237151 | 3300046809 | Unclassified | 1163 |
| 543 | Ga0495660_0000242 | 3300046810 | Bacteria | 53380 |
| 544 | Ga0495660_0033648 | 3300046810 | Bacteria | 2872 |
| 545 | Ga0495581_0005859 | 3300047315 | Bacteria | 7124 |
| 546 | Ga0495581_0379129 | 3300047315 | Bacteria | 825 |
| 547 | Ga0495636_0069911 | 3300047318 | Bacteria | 1497 |
| 548 | Ga0495672_0104581 | 3300047320 | Bacteria | 1529 |
| 549 | Ga0495676_0344903 | 3300047321 | Bacteria | 996 |
| 550 | Ga0495683_0011331 | 3300047323 | Bacteria | 4693 |
| 551 | Ga0495683_0117254 | 3300047323 | Bacteria | 1266 |
| 552 | Ga0495687_009802 | 3300047443 | Bacteria | 5320 |
| 553 | Ga0495677_0112296 | 3300047445 | Bacteria | 1036 |
| 554 | Ga0495677_0411927 | 3300047445 | Bacteria | 535 |
| 555 | Ga0495673_0028104 | 3300047469 | Bacteria | 2667 |
| 556 | Ga0495681_0022790 | 3300047470 | Bacteria | 3342 |
| 557 | Ga0495684_0866906 | 3300047471 | Bacteria | 584 |
| 558 | Ga0495686_0000248 | 3300047472 | Bacteria | 97017 |
| 559 | Ga0495686_0013673 | 3300047472 | Bacteria | 5625 |
| 560 | Ga0495686_0017927 | 3300047472 | Bacteria | 4761 |
| 561 | Ga0495593_0151598 | 3300047673 | Bacteria | 1172 |
| 562 | Ga0495626_0001949 | 3300048091 | Bacteria | 15326 |
| 563 | Ga0495626_0008173 | 3300048091 | Bacteria | 5764 |
| 564 | Ga0495626_0043126 | 3300048091 | Bacteria | 2117 |
| 565 | Ga0496103_0551870 | 3300048906 | Bacteria | 735 |
| 566 | Ga0496106_0119194 | 3300048909 | Bacteria | 2061 |
| 567 | Ga0496107_0059826 | 3300048910 | Bacteria | 2757 |
| 568 | Ga0496108_0326256 | 3300048911 | Bacteria | 1338 |
| 569 | Ga0496109_0615155 | 3300048912 | Bacteria | 1023 |
| 570 | Ga0496110_1659174 | 3300048913 | Bacteria | 549 |
| 571 | Ga0496111_0303297 | 3300048914 | Bacteria | 1184 |
| 572 | Ga0496112_0155062 | 3300048915 | Bacteria | 2257 |
| 573 | Ga0496112_0511336 | 3300048915 | Unclassified | 1136 |
| 574 | Ga0496112_1065537 | 3300048915 | Unclassified | 727 |
| 575 | Ga0496113_1335573 | 3300048916 | Bacteria | 557 |
| 576 | Ga0496115_0018283 | 3300048918 | Bacteria | 5378 |
| 577 | Ga0496115_0266424 | 3300048918 | Bacteria | 1408 |
| 578 | Ga0496121_0204466 | 3300048924 | Bacteria | 1404 |
| 579 | Ga0496121_0249130 | 3300048924 | Bacteria | 1233 |
| 580 | Ga0496124_0359823 | 3300048927 | Bacteria | 1026 |
| 581 | Ga0496126_0004368 | 3300048929 | Bacteria | 16944 |
| 582 | Ga0496126_0050763 | 3300048929 | Bacteria | 3779 |
| 583 | Ga0495682_0108932 | 3300049460 | Bacteria | 993 |
| 584 | Ga0501298_072821 | 3300049521 | Bacteria | 744 |
| 585 | Ga0501299_023212 | 3300049522 | Bacteria | 1149 |
| 586 | Ga0501031_0226213 | 3300049568 | Bacteria | 1218 |
| 587 | Ga0501033_0039232 | 3300049570 | Bacteria | 3538 |
| 588 | Ga0501034_0224227 | 3300049571 | Bacteria | 1831 |
| 589 | Ga0501036_1637746 | 3300049572 | Bacteria | 519 |
| 590 | Ga0501037_0364354 | 3300049573 | Bacteria | 995 |
| 591 | Ga0501037_0474592 | 3300049573 | Bacteria | 851 |
| 592 | Ga0501038_0229997 | 3300049574 | Bacteria | 1476 |
| 593 | Ga0501038_0233076 | 3300049574 | Bacteria | 1464 |
| 594 | Ga0501040_0128227 | 3300049576 | Bacteria | 1783 |
| 595 | Ga0501041_0054609 | 3300049577 | Bacteria | 2437 |
| 596 | Ga0501042_0549657 | 3300049578 | Bacteria | 839 |
| 597 | Ga0501042_1021540 | 3300049578 | Bacteria | 603 |
| 598 | Ga0501042_1420586 | 3300049578 | Unclassified | 506 |
| 599 | Ga0501043_0011457 | 3300049579 | Bacteria | 6943 |
| 600 | Ga0501046_0534663 | 3300049580 | Bacteria | 837 |
| 601 | Ga0501047_0011388 | 3300049581 | Bacteria | 8419 |
| 602 | Ga0501048_0361752 | 3300049582 | Bacteria | 1035 |
| 603 | Ga0501048_0518057 | 3300049582 | Bacteria | 855 |
| 604 | Ga0501048_1029393 | 3300049582 | Bacteria | 592 |
| 605 | Ga0501067_0016178 | 3300049583 | Bacteria | 4123 |
| 606 | Ga0501068_0033811 | 3300049584 | Bacteria | 3047 |
| 607 | Ga0501069_0010953 | 3300049585 | Bacteria | 4808 |
| 608 | Ga0501071_0038701 | 3300049587 | Bacteria | 3408 |
| 609 | Ga0501071_0274640 | 3300049587 | Bacteria | 1275 |
| 610 | Ga0501072_0014673 | 3300049588 | Bacteria | 6007 |
| 611 | Ga0501073_0493563 | 3300049589 | Bacteria | 847 |
| 612 | Ga0501074_0602050 | 3300049590 | Bacteria | 777 |
| 613 | Ga0501075_0282236 | 3300049591 | Bacteria | 1265 |
| 614 | Ga0501075_0511686 | 3300049591 | Bacteria | 916 |
| 615 | Ga0501075_0831753 | 3300049591 | Bacteria | 702 |
| 616 | Ga0501076_0011033 | 3300049592 | Bacteria | 6719 |
| 617 | Ga0501076_0600862 | 3300049592 | Bacteria | 908 |
| 618 | Ga0501077_0313826 | 3300049593 | Bacteria | 999 |
| 619 | Ga0501238_005001 | 3300049671 | Bacteria | 1670 |
| 620 | Ga0501238_059615 | 3300049671 | Bacteria | 581 |
| 621 | Ga0501243_104276 | 3300049675 | Bacteria | 575 |
| 622 | Ga0501225_0140280 | 3300049705 | Bacteria | 730 |
| 623 | Ga0501079_0101306 | 3300049741 | Bacteria | 2233 |
| 624 | Ga0501080_0060591 | 3300049742 | Bacteria | 3523 |
| 625 | Ga0501080_1296376 | 3300049742 | Bacteria | 624 |
| 626 | Ga0501081_0146581 | 3300049743 | Bacteria | 1694 |
| 627 | Ga0501081_0644794 | 3300049743 | Bacteria | 794 |
| 628 | Ga0501083_0441284 | 3300049744 | Bacteria | 847 |
| 629 | Ga0501274_010619 | 3300049771 | Bacteria | 851 |
| 630 | Ga0501035_0572788 | 3300049822 | Bacteria | 923 |
| 631 | Ga0501044_0007782 | 3300049823 | Bacteria | 11779 |
| 632 | Ga0501044_0082060 | 3300049823 | Bacteria | 3263 |
| 633 | Ga0501044_0084088 | 3300049823 | Bacteria | 3216 |
| 634 | Ga0501045_0018451 | 3300049824 | Bacteria | 4963 |
| 635 | nmdc:mga03n38_13122_c1 | 3300050490 | Bacteria | 3138 |
| 636 | nmdc:mga0k408_117871_c1 | 3300050493 | Bacteria | 1571 |
| 637 | nmdc:mga0k408_45001_c1 | 3300050493 | Bacteria | 2546 |
| 638 | nmdc:mga0k408_645346_c1 | 3300050493 | Bacteria | 623 |
| 639 | nmdc:mga06z11_17838_c1 | 3300050494 | Bacteria | 3231 |
| 640 | nmdc:mga07m45_164537_c1 | 3300050496 | Bacteria | 1288 |
| 641 | nmdc:mga05p37_227110_c1 | 3300050507 | Bacteria | 2250 |
| 642 | nmdc:mga05p37_7832_c1 | 3300050507 | Bacteria | 12609 |
| 643 | nmdc:mga09592_244908_c1 | 3300050508 | Bacteria | 1554 |
| 644 | nmdc:mga09592_35837_c1 | 3300050508 | Bacteria | 4154 |
| 645 | nmdc:mga09592_4810_c1 | 3300050508 | Bacteria | 10942 |
| 646 | nmdc:mga09592_552247_c1 | 3300050508 | Bacteria | 989 |
| 647 | nmdc:mga0qj67_24235_c1 | 3300050509 | Bacteria | 4676 |
| 648 | nmdc:mga0qj67_258942_c1 | 3300050509 | Bacteria | 1411 |
| 649 | nmdc:mga0qj67_549092_c1 | 3300050509 | Unclassified | 927 |
| 650 | nmdc:mga06r32_1045755_c1 | 3300050510 | Bacteria | 767 |
| 651 | nmdc:mga06r32_111503_c1 | 3300050510 | Bacteria | 2692 |
| 652 | nmdc:mga06r32_196731_c1 | 3300050510 | Bacteria | 2003 |
| 653 | nmdc:mga06r32_222353_c1 | 3300050510 | Bacteria | 1876 |
| 654 | nmdc:mga06r32_64417_c1 | 3300050510 | Bacteria | 3535 |
| 655 | nmdc:mga08y16_194887_c1 | 3300050511 | Bacteria | 2101 |
| 656 | nmdc:mga08y16_20_c1 | 3300050511 | Bacteria | 276739 |
| 657 | nmdc:mga08y16_43855_c1 | 3300050511 | Unclassified | 4687 |
| 658 | nmdc:mga08y16_5750_c1 | 3300050511 | Bacteria | 12989 |
| 659 | nmdc:mga08y16_90986_c1 | 3300050511 | Bacteria | 3180 |
| 660 | nmdc:mga0n895_1036639_c1 | 3300050512 | Bacteria | 800 |
| 661 | nmdc:mga0n895_1155057_c1 | 3300050512 | Bacteria | 750 |
| 662 | nmdc:mga0rr50_1129999_c1 | 3300050513 | Unclassified | 666 |
| 663 | nmdc:mga0rr50_633402_c1 | 3300050513 | Bacteria | 912 |
| 664 | nmdc:mga08x19_506259_c1 | 3300050514 | Unclassified | 853 |
| 665 | nmdc:mga08x19_506665_c1 | 3300050514 | Bacteria | 852 |
| 666 | nmdc:mga08x19_5223_c1 | 3300050514 | Bacteria | 7683 |
| 667 | nmdc:mga0a205_360817_c1 | 3300050515 | Bacteria | 1320 |
| 668 | Ga0495612_0248505 | 3300053078 | Bacteria | 791 |
| 669 | Ga0495619_0038766 | 3300053085 | Bacteria | 3109 |
| 670 | Ga0495619_0049522 | 3300053085 | Bacteria | 2771 |
| 671 | Ga0500618_001550 | 3300053125 | Bacteria | 10053 |
| 672 | Ga0500559_0207376 | 3300053136 | Bacteria | 924 |
| 673 | Ga0500559_0246455 | 3300053136 | Bacteria | 842 |
| 674 | Ga0500568_0019210 | 3300053139 | Bacteria | 2975 |
| 675 | Ga0500568_0030978 | 3300053139 | Bacteria | 2211 |
| 676 | Ga0500603_181108 | 3300053150 | Bacteria | 663 |
| 677 | Ga0500604_0035556 | 3300053151 | Bacteria | 1483 |
| 678 | Ga0500616_0030617 | 3300053153 | Bacteria | 2954 |
| 679 | Ga0500639_322944 | 3300053163 | Bacteria | 564 |
| 680 | Ga0500636_0079908 | 3300053177 | Bacteria | 1885 |
| 681 | Ga0501084_0267769 | 3300054114 | Bacteria | 1442 |
| 682 | Ga0501082_0119246 | 3300060353 | Bacteria | 2286 |
| 683 | Ga0501082_1701048 | 3300060353 | Bacteria | 550 |
| 684 | Ga0530510_0004920 | 3300061734 | Bacteria | 9230 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041404 | Ga0439436_0061058 | Ga0439436_0061058_279_641 | 113 |
| 2 | 3300005546 | Ga0070696_101132939 | Ga0070696_1011329391 | 115 |
| 3 | 3300006914 | Ga0075436_100321208 | Ga0075436_1003212082 | 115 |
| 4 | 3300025941 | Ga0207711_10623261 | Ga0207711_106232612 | 115 |
| 5 | 3300045051 | Ga0451576_0561119 | Ga0451576_0561119_154_501 | 115 |
| 6 | 3300005340 | Ga0070689_100169672 | Ga0070689_1001696722 | 117 |
| 7 | 3300005353 | Ga0070669_100596968 | Ga0070669_1005969682 | 117 |
| 8 | 3300005356 | Ga0070674_100364042 | Ga0070674_1003640422 | 117 |
| 9 | 3300005364 | Ga0070673_100218708 | Ga0070673_1002187083 | 117 |
| 10 | 3300005365 | Ga0070688_100141103 | Ga0070688_1001411032 | 117 |
| 11 | 3300005456 | Ga0070678_100197526 | Ga0070678_1001975262 | 117 |
| 12 | 3300005466 | Ga0070685_10017590 | Ga0070685_100175906 | 117 |
| 13 | 3300005543 | Ga0070672_100015776 | Ga0070672_1000157763 | 117 |
| 14 | 3300005548 | Ga0070665_100916454 | Ga0070665_1009164542 | 117 |
| 15 | 3300005577 | Ga0068857_100044553 | Ga0068857_1000445534 | 117 |
| 16 | 3300005617 | Ga0068859_100160678 | Ga0068859_1001606783 | 117 |
| 17 | 3300006931 | Ga0097620_100160684 | Ga0097620_1001606843 | 117 |
| 18 | 3300025923 | Ga0207681_10839870 | Ga0207681_108398701 | 117 |
| 19 | 3300025936 | Ga0207670_10268969 | Ga0207670_102689692 | 117 |
| 20 | 3300025937 | Ga0207669_10088581 | Ga0207669_100885813 | 117 |
| 21 | 3300025940 | Ga0207691_10016851 | Ga0207691_100168513 | 117 |
| 22 | 3300026116 | Ga0207674_10061068 | Ga0207674_100610685 | 117 |
| 23 | 3300028379 | Ga0268266_10528348 | Ga0268266_105283483 | 117 |
| 24 | 3300050493 | nmdc:mga0k408_645346_c1 | nmdc:mga0k408_645346_c1_228_590 | 117 |
| 25 | 3300005343 | Ga0070687_100857239 | Ga0070687_1008572391 | 118 |
| 26 | 3300037068 | Ga0373925_0053750 | Ga0373925_0053750_333_713 | 118 |
| 27 | 3300006847 | Ga0075431_101705587 | Ga0075431_1017055872 | 120 |
| 28 | 3300039447 | Ga0436361_0961791 | Ga0436361_0961791_631_1008 | 124 |
| 29 | 3300005547 | Ga0070693_100161055 | Ga0070693_1001610552 | 125 |
| 30 | 3300005843 | Ga0068860_101469181 | Ga0068860_1014691812 | 125 |
| 31 | 3300006358 | Ga0068871_100367646 | Ga0068871_1003676463 | 125 |
| 32 | 3300013102 | Ga0157371_10582264 | Ga0157371_105822642 | 125 |
| 33 | 3300028381 | Ga0268264_11103148 | Ga0268264_111031482 | 125 |
| 34 | 3300045976 | Ga0466967_1262505 | Ga0466967_1262505_206_613 | 125 |
| 35 | 3300005327 | Ga0070658_10104538 | Ga0070658_101045381 | 126 |
| 36 | 3300005339 | Ga0070660_100003463 | Ga0070660_1000034637 | 126 |
| 37 | 3300005347 | Ga0070668_100833351 | Ga0070668_1008333512 | 126 |
| 38 | 3300005530 | Ga0070679_100345386 | Ga0070679_1003453862 | 126 |
| 39 | 3300005543 | Ga0070672_101504176 | Ga0070672_1015041762 | 126 |
| 40 | 3300006844 | Ga0075428_100000226 | Ga0075428_10000022615 | 126 |
| 41 | 3300006847 | Ga0075431_100006379 | Ga0075431_10000637911 | 126 |
| 42 | 3300006880 | Ga0075429_100009079 | Ga0075429_1000090797 | 126 |
| 43 | 3300009094 | Ga0111539_10002174 | Ga0111539_100021748 | 126 |
| 44 | 3300009147 | Ga0114129_10021544 | Ga0114129_100215448 | 126 |
| 45 | 3300013104 | Ga0157370_10002509 | Ga0157370_100025096 | 126 |
| 46 | 3300013307 | Ga0157372_10476810 | Ga0157372_104768102 | 126 |
| 47 | 3300013308 | Ga0157375_13625221 | Ga0157375_136252212 | 126 |
| 48 | 3300021361 | Ga0213872_10056966 | Ga0213872_100569662 | 126 |
| 49 | 3300025912 | Ga0207707_10806817 | Ga0207707_108068172 | 126 |
| 50 | 3300025919 | Ga0207657_10005066 | Ga0207657_100050662 | 126 |
| 51 | 3300025921 | Ga0207652_10227272 | Ga0207652_102272723 | 126 |
| 52 | 3300025932 | Ga0207690_10578793 | Ga0207690_105787932 | 126 |
| 53 | 3300025986 | Ga0207658_11599948 | Ga0207658_115999481 | 126 |
| 54 | 3300027907 | Ga0207428_10023676 | Ga0207428_100236763 | 126 |
| 55 | 3300032002 | Ga0307416_102414286 | Ga0307416_1024142862 | 126 |
| 56 | 3300032004 | Ga0307414_11692986 | Ga0307414_116929862 | 126 |
| 57 | 3300039447 | Ga0436361_0919867 | Ga0436361_0919867_820_1218 | 126 |
| 58 | 3300039453 | Ga0436362_0089214 | Ga0436362_0089214_1016_1414 | 126 |
| 59 | 3300044842 | Ga0466957_0265881 | Ga0466957_0265881_77_508 | 126 |
| 60 | 3300050507 | nmdc:mga05p37_7832_c1 | nmdc:mga05p37_7832_c1_6823_7227 | 126 |
| 61 | 3300050508 | nmdc:mga09592_4810_c1 | nmdc:mga09592_4810_c1_5832_6236 | 126 |
| 62 | 3300050510 | nmdc:mga06r32_64417_c1 | nmdc:mga06r32_64417_c1_973_1377 | 126 |
| 63 | 3300050511 | nmdc:mga08y16_5750_c1 | nmdc:mga08y16_5750_c1_5496_5900 | 126 |
| 64 | 3300006914 | Ga0075436_100002922 | Ga0075436_1000029229 | 127 |
| 65 | 3300021361 | Ga0213872_10015310 | Ga0213872_100153103 | 127 |
| 66 | 3300032005 | Ga0307411_10702929 | Ga0307411_107029292 | 127 |
| 67 | 3300032126 | Ga0307415_100501589 | Ga0307415_1005015892 | 127 |
| 68 | 3300039447 | Ga0436361_0413757 | Ga0436361_0413757_11912_12316 | 127 |
| 69 | 3300050514 | nmdc:mga08x19_5223_c1 | nmdc:mga08x19_5223_c1_4115_4501 | 127 |
| 70 | iso_pu_bacteria | 2856741275 | 2856742999 | 127 |
| 71 | iso_pu_bacteria | 2891562705 | 2891563565 | 127 |
| 72 | 3300005328 | Ga0070676_10813073 | Ga0070676_108130732 | 128 |
| 73 | 3300005330 | Ga0070690_100014098 | Ga0070690_1000140986 | 128 |
| 74 | 3300005334 | Ga0068869_100172038 | Ga0068869_1001720382 | 128 |
| 75 | 3300005336 | Ga0070680_100413854 | Ga0070680_1004138542 | 128 |
| 76 | 3300005338 | Ga0068868_100434416 | Ga0068868_1004344162 | 128 |
| 77 | 3300005340 | Ga0070689_100006738 | Ga0070689_1000067386 | 128 |
| 78 | 3300005345 | Ga0070692_10046431 | Ga0070692_100464312 | 128 |
| 79 | 3300005438 | Ga0070701_10111036 | Ga0070701_101110362 | 128 |
| 80 | 3300005440 | Ga0070705_100150530 | Ga0070705_1001505303 | 128 |
| 81 | 3300005441 | Ga0070700_100002626 | Ga0070700_1000026266 | 128 |
| 82 | 3300005444 | Ga0070694_100540157 | Ga0070694_1005401572 | 128 |
| 83 | 3300005456 | Ga0070678_100028309 | Ga0070678_1000283093 | 128 |
| 84 | 3300005459 | Ga0068867_100028822 | Ga0068867_1000288223 | 128 |
| 85 | 3300005466 | Ga0070685_10237829 | Ga0070685_102378293 | 128 |
| 86 | 3300005544 | Ga0070686_100012542 | Ga0070686_1000125424 | 128 |
| 87 | 3300005545 | Ga0070695_100110679 | Ga0070695_1001106791 | 128 |
| 88 | 3300005546 | Ga0070696_100204993 | Ga0070696_1002049933 | 128 |
| 89 | 3300005547 | Ga0070693_100197798 | Ga0070693_1001977982 | 128 |
| 90 | 3300005549 | Ga0070704_100657034 | Ga0070704_1006570342 | 128 |
| 91 | 3300005615 | Ga0070702_100001989 | Ga0070702_1000019894 | 128 |
| 92 | 3300005718 | Ga0068866_10007387 | Ga0068866_100073878 | 128 |
| 93 | 3300005719 | Ga0068861_100007885 | Ga0068861_1000078854 | 128 |
| 94 | 3300005840 | Ga0068870_10139494 | Ga0068870_101394942 | 128 |
| 95 | 3300005842 | Ga0068858_100199727 | Ga0068858_1001997272 | 128 |
| 96 | 3300005843 | Ga0068860_100179414 | Ga0068860_1001794142 | 128 |
| 97 | 3300005844 | Ga0068862_100140171 | Ga0068862_1001401712 | 128 |
| 98 | 3300006237 | Ga0097621_100022166 | Ga0097621_1000221665 | 128 |
| 99 | 3300006358 | Ga0068871_100037404 | Ga0068871_1000374047 | 128 |
| 100 | 3300006881 | Ga0068865_100173611 | Ga0068865_1001736112 | 128 |
| 101 | 3300009098 | Ga0105245_10007823 | Ga0105245_100078235 | 128 |
| 102 | 3300009148 | Ga0105243_10003699 | Ga0105243_100036994 | 128 |
| 103 | 3300009176 | Ga0105242_10140337 | Ga0105242_101403372 | 128 |
| 104 | 3300009177 | Ga0105248_10089155 | Ga0105248_100891551 | 128 |
| 105 | 3300009553 | Ga0105249_10027997 | Ga0105249_100279974 | 128 |
| 106 | 3300011119 | Ga0105246_10399892 | Ga0105246_103998922 | 128 |
| 107 | 3300013297 | Ga0157378_10043324 | Ga0157378_100433244 | 128 |
| 108 | 3300013306 | Ga0163162_10181697 | Ga0163162_101816973 | 128 |
| 109 | 3300014326 | Ga0157380_10384922 | Ga0157380_103849222 | 128 |
| 110 | 3300014968 | Ga0157379_10089527 | Ga0157379_100895271 | 128 |
| 111 | 3300014969 | Ga0157376_10839678 | Ga0157376_108396781 | 128 |
| 112 | 3300025899 | Ga0207642_10041913 | Ga0207642_100419133 | 128 |
| 113 | 3300025908 | Ga0207643_10142358 | Ga0207643_101423582 | 128 |
| 114 | 3300025917 | Ga0207660_10038108 | Ga0207660_100381082 | 128 |
| 115 | 3300025918 | Ga0207662_10042815 | Ga0207662_100428152 | 128 |
| 116 | 3300025927 | Ga0207687_10288662 | Ga0207687_102886622 | 128 |
| 117 | 3300025934 | Ga0207686_10039024 | Ga0207686_100390245 | 128 |
| 118 | 3300025935 | Ga0207709_10010267 | Ga0207709_100102673 | 128 |
| 119 | 3300025936 | Ga0207670_10042394 | Ga0207670_100423941 | 128 |
| 120 | 3300025938 | Ga0207704_10021968 | Ga0207704_100219682 | 128 |
| 121 | 3300025942 | Ga0207689_10003010 | Ga0207689_1000301011 | 128 |
| 122 | 3300025961 | Ga0207712_10069421 | Ga0207712_100694211 | 128 |
| 123 | 3300026023 | Ga0207677_10363820 | Ga0207677_103638202 | 128 |
| 124 | 3300026035 | Ga0207703_10051062 | Ga0207703_100510622 | 128 |
| 125 | 3300026075 | Ga0207708_10001951 | Ga0207708_1000195111 | 128 |
| 126 | 3300026089 | Ga0207648_10005501 | Ga0207648_1000550110 | 128 |
| 127 | 3300026118 | Ga0207675_100001542 | Ga0207675_10000154214 | 128 |
| 128 | 3300026121 | Ga0207683_10042530 | Ga0207683_100425303 | 128 |
| 129 | 3300028380 | Ga0268265_10028174 | Ga0268265_100281747 | 128 |
| 130 | 3300028381 | Ga0268264_10106910 | Ga0268264_101069101 | 128 |
| 131 | 3300032126 | Ga0307415_101893297 | Ga0307415_1018932971 | 128 |
| 132 | 3300044842 | Ga0466957_1438368 | Ga0466957_1438368_40_447 | 128 |
| 133 | 3300046664 | Ga0495659_0368303 | Ga0495659_0368303_159_575 | 128 |
| 134 | iso_pu_bacteria | 2895427314 | 2895431686 | 128 |
| 135 | 3300003775 | Ga0055524_1000053 | Ga0055524_100005334 | 129 |
| 136 | 3300003911 | JGI25405J52794_10006918 | JGI25405J52794_100069183 | 129 |
| 137 | 3300005937 | Ga0081455_10000014 | Ga0081455_10000014137 | 129 |
| 138 | 3300025915 | Ga0207693_10375686 | Ga0207693_103756862 | 129 |
| 139 | 3300025917 | Ga0207660_10367620 | Ga0207660_103676201 | 129 |
| 140 | 3300044706 | Ga0466964_0042039 | Ga0466964_0042039_990_1430 | 129 |
| 141 | 3300048927 | Ga0496124_0359823 | Ga0496124_0359823_11_412 | 129 |
| 142 | iso_pu_bacteria | 2511231026 | 2511387479 | 129 |
| 143 | iso_pu_bacteria | 2818991449 | 2819617801 | 129 |
| 144 | iso_pu_bacteria | 2857558681 | 2857562859 | 129 |
| 145 | iso_pu_bacteria | 2919046199 | 2919050408 | 129 |
| 146 | 3300005577 | Ga0068857_101643573 | Ga0068857_1016435732 | 130 |
| 147 | 3300025921 | Ga0207652_11350306 | Ga0207652_113503062 | 130 |
| 148 | 3300038443 | Ga0395901_0035092 | Ga0395901_0035092_2032_2439 | 130 |
| 149 | 3300044693 | Ga0466961_0208207 | Ga0466961_0208207_258_662 | 130 |
| 150 | 3300048915 | Ga0496112_1065537 | Ga0496112_1065537_245_646 | 130 |
| 151 | iso_pu_bacteria | 2643221645 | 2644252805 | 130 |
| 152 | iso_pu_bacteria | 2643221664 | 2644355150 | 130 |
| 153 | iso_pu_bacteria | 2889306138 | 2889307467 | 130 |
| 154 | 3300003322 | rootL2_10030680 | rootL2_100306802 | 131 |
| 155 | 3300005327 | Ga0070658_10229931 | Ga0070658_102299312 | 131 |
| 156 | 3300014326 | Ga0157380_10553702 | Ga0157380_105537022 | 131 |
| 157 | 3300031731 | Ga0307405_11624257 | Ga0307405_116242572 | 131 |
| 158 | 3300031911 | Ga0307412_11061513 | Ga0307412_110615132 | 131 |
| 159 | 3300032002 | Ga0307416_101366091 | Ga0307416_1013660912 | 131 |
| 160 | 3300032002 | Ga0307416_101635456 | Ga0307416_1016354562 | 131 |
| 161 | 3300039437 | Ga0436365_1454359 | Ga0436365_1454359_33_428 | 131 |
| 162 | 3300046475 | Ga0495639_0180740 | Ga0495639_0180740_411_806 | 131 |
| 163 | 3300046476 | Ga0495662_0008247 | Ga0495662_0008247_3595_3990 | 131 |
| 164 | 3300046516 | Ga0495628_0188683 | Ga0495628_0188683_482_877 | 131 |
| 165 | 3300046517 | Ga0495630_0089205 | Ga0495630_0089205_1199_1594 | 131 |
| 166 | 3300046520 | Ga0495637_0051051 | Ga0495637_0051051_834_1292 | 131 |
| 167 | 3300046533 | Ga0495640_0218253 | Ga0495640_0218253_456_851 | 131 |
| 168 | 3300046535 | Ga0495586_0114441 | Ga0495586_0114441_389_784 | 131 |
| 169 | 3300046681 | Ga0495647_0084956 | Ga0495647_0084956_757_1152 | 131 |
| 170 | 3300046690 | Ga0495624_0078271 | Ga0495624_0078271_1478_1873 | 131 |
| 171 | 3300047315 | Ga0495581_0379129 | Ga0495581_0379129_376_771 | 131 |
| 172 | 3300047321 | Ga0495676_0344903 | Ga0495676_0344903_384_779 | 131 |
| 173 | 3300047471 | Ga0495684_0866906 | Ga0495684_0866906_61_456 | 131 |
| 174 | 3300047673 | Ga0495593_0151598 | Ga0495593_0151598_584_979 | 131 |
| 175 | 3300048091 | Ga0495626_0001949 | Ga0495626_0001949_8093_8551 | 131 |
| 176 | 3300053078 | Ga0495612_0248505 | Ga0495612_0248505_137_532 | 131 |
| 177 | iso_pu_bacteria | 2857553236 | 2857557455 | 131 |
| 178 | iso_pu_bacteria | 2857564685 | 2857567205 | 131 |
| 179 | iso_pu_bacteria | 2862281513 | 2862287655 | 131 |
| 180 | iso_pu_bacteria | 2877676314 | 2877683733 | 131 |
| 181 | iso_pu_bacteria | 2919468124 | 2919473779 | 131 |
| 182 | 3300005458 | Ga0070681_10702081 | Ga0070681_107020812 | 132 |
| 183 | 3300005530 | Ga0070679_101217493 | Ga0070679_1012174931 | 132 |
| 184 | 3300005535 | Ga0070684_100004937 | Ga0070684_10000493711 | 132 |
| 185 | 3300005563 | Ga0068855_100019512 | Ga0068855_1000195126 | 132 |
| 186 | 3300005578 | Ga0068854_100014453 | Ga0068854_1000144533 | 132 |
| 187 | 3300006844 | Ga0075428_100037690 | Ga0075428_1000376904 | 132 |
| 188 | 3300006914 | Ga0075436_100007186 | Ga0075436_1000071866 | 132 |
| 189 | 3300009545 | Ga0105237_10014196 | Ga0105237_100141966 | 132 |
| 190 | 3300014497 | Ga0182008_10565645 | Ga0182008_105656452 | 132 |
| 191 | 3300021361 | Ga0213872_10005586 | Ga0213872_100055863 | 132 |
| 192 | 3300025912 | Ga0207707_10279185 | Ga0207707_102791852 | 132 |
| 193 | 3300025914 | Ga0207671_10007997 | Ga0207671_100079975 | 132 |
| 194 | 3300025916 | Ga0207663_11491445 | Ga0207663_114914451 | 132 |
| 195 | 3300025944 | Ga0207661_10010866 | Ga0207661_100108666 | 132 |
| 196 | 3300025945 | Ga0207679_10018197 | Ga0207679_100181973 | 132 |
| 197 | 3300025949 | Ga0207667_10008709 | Ga0207667_100087096 | 132 |
| 198 | 3300028800 | Ga0265338_10028566 | Ga0265338_100285666 | 132 |
| 199 | 3300031507 | Ga0307509_10081840 | Ga0307509_100818404 | 132 |
| 200 | 3300031595 | Ga0265313_10220561 | Ga0265313_102205612 | 132 |
| 201 | 3300031731 | Ga0307405_10054159 | Ga0307405_100541594 | 132 |
| 202 | 3300031824 | Ga0307413_10776131 | Ga0307413_107761311 | 132 |
| 203 | 3300031852 | Ga0307410_10091729 | Ga0307410_100917291 | 132 |
| 204 | 3300031901 | Ga0307406_10134260 | Ga0307406_101342603 | 132 |
| 205 | 3300031903 | Ga0307407_10042714 | Ga0307407_100427143 | 132 |
| 206 | 3300032005 | Ga0307411_11278700 | Ga0307411_112787002 | 132 |
| 207 | 3300032126 | Ga0307415_100760724 | Ga0307415_1007607242 | 132 |
| 208 | 3300035086 | Ga0373934_0150904 | Ga0373934_0150904_133_555 | 132 |
| 209 | 3300035172 | Ga0373955_0130994 | Ga0373955_0130994_913_1311 | 132 |
| 210 | 3300035692 | Ga0373935_0018247 | Ga0373935_0018247_2475_2873 | 132 |
| 211 | 3300035695 | Ga0373927_0480261 | Ga0373927_0480261_135_533 | 132 |
| 212 | 3300035724 | Ga0373933_0350557 | Ga0373933_0350557_285_683 | 132 |
| 213 | 3300036401 | Ga0373937_0078823 | Ga0373937_0078823_1768_2166 | 132 |
| 214 | 3300037312 | Ga0395899_0012086 | Ga0395899_0012086_6047_6445 | 132 |
| 215 | 3300037418 | Ga0395900_0013169 | Ga0395900_0013169_2336_2734 | 132 |
| 216 | 3300037466 | Ga0395898_0005775 | Ga0395898_0005775_7422_7820 | 132 |
| 217 | 3300037471 | Ga0395905_1779310 | Ga0395905_1779310_53_460 | 132 |
| 218 | 3300038443 | Ga0395901_0038821 | Ga0395901_0038821_846_1244 | 132 |
| 219 | 3300039447 | Ga0436361_0962333 | Ga0436361_0962333_196_594 | 132 |
| 220 | 3300044765 | Ga0466970_0126580 | Ga0466970_0126580_267_677 | 132 |
| 221 | 3300045049 | Ga0466959_0009284 | Ga0466959_0009284_6307_6717 | 132 |
| 222 | 3300046543 | Ga0495645_0085696 | Ga0495645_0085696_1718_2125 | 132 |
| 223 | 3300048924 | Ga0496121_0249130 | Ga0496121_0249130_613_1023 | 132 |
| 224 | 3300049578 | Ga0501042_1021540 | Ga0501042_1021540_184_582 | 132 |
| 225 | 3300049742 | Ga0501080_1296376 | Ga0501080_1296376_106_504 | 132 |
| 226 | 3300049823 | Ga0501044_0082060 | Ga0501044_0082060_830_1240 | 132 |
| 227 | 3300050513 | nmdc:mga0rr50_1129999_c1 | nmdc:mga0rr50_1129999_c1_35_439 | 132 |
| 228 | 3300050514 | nmdc:mga08x19_506259_c1 | nmdc:mga08x19_506259_c1_93_497 | 132 |
| 229 | 3300053125 | Ga0500618_001550 | Ga0500618_001550_9536_9946 | 132 |
| 230 | 3300060353 | Ga0501082_0119246 | Ga0501082_0119246_1583_1981 | 132 |
| 231 | 3300061734 | Ga0530510_0004920 | Ga0530510_0004920_4416_4814 | 132 |
| 232 | iso_pu_bacteria | 2811994917 | 2812479038 | 132 |
| 233 | 3300005459 | Ga0068867_101173629 | Ga0068867_1011736291 | 133 |
| 234 | 3300005471 | Ga0070698_100251978 | Ga0070698_1002519782 | 133 |
| 235 | 3300005844 | Ga0068862_101047838 | Ga0068862_1010478381 | 133 |
| 236 | 3300006028 | Ga0070717_10184259 | Ga0070717_101842593 | 133 |
| 237 | 3300006852 | Ga0075433_11047875 | Ga0075433_110478751 | 133 |
| 238 | 3300006871 | Ga0075434_102507014 | Ga0075434_1025070141 | 133 |
| 239 | 3300006880 | Ga0075429_100168158 | Ga0075429_1001681583 | 133 |
| 240 | 3300007076 | Ga0075435_102007094 | Ga0075435_1020070941 | 133 |
| 241 | 3300009094 | Ga0111539_10000016 | Ga0111539_1000001634 | 133 |
| 242 | 3300009094 | Ga0111539_10843652 | Ga0111539_108436522 | 133 |
| 243 | 3300009094 | Ga0111539_11160050 | Ga0111539_111600502 | 133 |
| 244 | 3300009147 | Ga0114129_10465416 | Ga0114129_104654162 | 133 |
| 245 | 3300009553 | Ga0105249_11148901 | Ga0105249_111489011 | 133 |
| 246 | 3300014326 | Ga0157380_10488406 | Ga0157380_104884062 | 133 |
| 247 | 3300014326 | Ga0157380_11998069 | Ga0157380_119980692 | 133 |
| 248 | 3300025961 | Ga0207712_10139576 | Ga0207712_101395763 | 133 |
| 249 | 3300026075 | Ga0207708_11471769 | Ga0207708_114717692 | 133 |
| 250 | 3300026089 | Ga0207648_12133391 | Ga0207648_121333911 | 133 |
| 251 | 3300027907 | Ga0207428_10000020 | Ga0207428_1000002034 | 133 |
| 252 | 3300027907 | Ga0207428_10005589 | Ga0207428_100055898 | 133 |
| 253 | 3300028380 | Ga0268265_10425999 | Ga0268265_104259993 | 133 |
| 254 | 3300035112 | Ga0373932_0000476 | Ga0373932_0000476_754_1158 | 133 |
| 255 | 3300046538 | Ga0495609_0027667 | Ga0495609_0027667_963_1427 | 133 |
| 256 | 3300046660 | Ga0495625_0072250 | Ga0495625_0072250_767_1231 | 133 |
| 257 | 3300046674 | Ga0495588_0001439 | Ga0495588_0001439_5691_6155 | 133 |
| 258 | 3300047472 | Ga0495686_0000248 | Ga0495686_0000248_46470_46886 | 133 |
| 259 | 3300047472 | Ga0495686_0017927 | Ga0495686_0017927_1661_2062 | 133 |
| 260 | 3300048091 | Ga0495626_0008173 | Ga0495626_0008173_3773_4237 | 133 |
| 261 | 3300048913 | Ga0496110_1659174 | Ga0496110_1659174_123_530 | 133 |
| 262 | 3300050507 | nmdc:mga05p37_227110_c1 | nmdc:mga05p37_227110_c1_1836_2237 | 133 |
| 263 | 3300050508 | nmdc:mga09592_35837_c1 | nmdc:mga09592_35837_c1_3656_4057 | 133 |
| 264 | 3300050511 | nmdc:mga08y16_20_c1 | nmdc:mga08y16_20_c1_32037_32438 | 133 |
| 265 | 3300050511 | nmdc:mga08y16_43855_c1 | nmdc:mga08y16_43855_c1_4003_4404 | 133 |
| 266 | iso_pu_bacteria | 2883087390 | 2883087393 | 133 |
| 267 | 3300005262 | Ga0065165_1116071 | Ga0065165_11160712 | 134 |
| 268 | 3300005327 | Ga0070658_10230195 | Ga0070658_102301951 | 134 |
| 269 | 3300005329 | Ga0070683_100945281 | Ga0070683_1009452812 | 134 |
| 270 | 3300005331 | Ga0070670_101342121 | Ga0070670_1013421211 | 134 |
| 271 | 3300005334 | Ga0068869_100570631 | Ga0068869_1005706312 | 134 |
| 272 | 3300005336 | Ga0070680_100003184 | Ga0070680_1000031849 | 134 |
| 273 | 3300005336 | Ga0070680_100120036 | Ga0070680_1001200362 | 134 |
| 274 | 3300005336 | Ga0070680_100275800 | Ga0070680_1002758001 | 134 |
| 275 | 3300005337 | Ga0070682_100269085 | Ga0070682_1002690852 | 134 |
| 276 | 3300005339 | Ga0070660_100166220 | Ga0070660_1001662203 | 134 |
| 277 | 3300005344 | Ga0070661_100361850 | Ga0070661_1003618502 | 134 |
| 278 | 3300005354 | Ga0070675_100811582 | Ga0070675_1008115822 | 134 |
| 279 | 3300005364 | Ga0070673_100025140 | Ga0070673_1000251404 | 134 |
| 280 | 3300005364 | Ga0070673_101147492 | Ga0070673_1011474921 | 134 |
| 281 | 3300005366 | Ga0070659_100125288 | Ga0070659_1001252883 | 134 |
| 282 | 3300005366 | Ga0070659_101353396 | Ga0070659_1013533962 | 134 |
| 283 | 3300005435 | Ga0070714_100099223 | Ga0070714_1000992233 | 134 |
| 284 | 3300005436 | Ga0070713_100260801 | Ga0070713_1002608013 | 134 |
| 285 | 3300005438 | Ga0070701_10760553 | Ga0070701_107605532 | 134 |
| 286 | 3300005439 | Ga0070711_100945710 | Ga0070711_1009457102 | 134 |
| 287 | 3300005441 | Ga0070700_100016842 | Ga0070700_1000168423 | 134 |
| 288 | 3300005441 | Ga0070700_101075440 | Ga0070700_1010754402 | 134 |
| 289 | 3300005455 | Ga0070663_101087340 | Ga0070663_1010873401 | 134 |
| 290 | 3300005458 | Ga0070681_10116648 | Ga0070681_101166483 | 134 |
| 291 | 3300005458 | Ga0070681_10270923 | Ga0070681_102709232 | 134 |
| 292 | 3300005466 | Ga0070685_10016541 | Ga0070685_100165414 | 134 |
| 293 | 3300005466 | Ga0070685_10543773 | Ga0070685_105437731 | 134 |
| 294 | 3300005530 | Ga0070679_100026857 | Ga0070679_1000268573 | 134 |
| 295 | 3300005530 | Ga0070679_100029361 | Ga0070679_1000293615 | 134 |
| 296 | 3300005530 | Ga0070679_100038082 | Ga0070679_1000380825 | 134 |
| 297 | 3300005530 | Ga0070679_100041268 | Ga0070679_1000412686 | 134 |
| 298 | 3300005530 | Ga0070679_100825197 | Ga0070679_1008251972 | 134 |
| 299 | 3300005535 | Ga0070684_101278260 | Ga0070684_1012782602 | 134 |
| 300 | 3300005544 | Ga0070686_100351496 | Ga0070686_1003514962 | 134 |
| 301 | 3300005548 | Ga0070665_100002550 | Ga0070665_10000255010 | 134 |
| 302 | 3300005548 | Ga0070665_102070826 | Ga0070665_1020708261 | 134 |
| 303 | 3300005563 | Ga0068855_100001103 | Ga0068855_1000011039 | 134 |
| 304 | 3300005563 | Ga0068855_100008079 | Ga0068855_1000080799 | 134 |
| 305 | 3300005563 | Ga0068855_100033873 | Ga0068855_1000338734 | 134 |
| 306 | 3300005564 | Ga0070664_100432787 | Ga0070664_1004327872 | 134 |
| 307 | 3300005577 | Ga0068857_100552029 | Ga0068857_1005520292 | 134 |
| 308 | 3300005577 | Ga0068857_100599601 | Ga0068857_1005996011 | 134 |
| 309 | 3300005578 | Ga0068854_101551260 | Ga0068854_1015512601 | 134 |
| 310 | 3300005614 | Ga0068856_100155196 | Ga0068856_1001551963 | 134 |
| 311 | 3300005614 | Ga0068856_100463843 | Ga0068856_1004638432 | 134 |
| 312 | 3300005616 | Ga0068852_100264107 | Ga0068852_1002641073 | 134 |
| 313 | 3300005616 | Ga0068852_100689139 | Ga0068852_1006891392 | 134 |
| 314 | 3300005617 | Ga0068859_100309242 | Ga0068859_1003092422 | 134 |
| 315 | 3300005617 | Ga0068859_100544978 | Ga0068859_1005449782 | 134 |
| 316 | 3300005618 | Ga0068864_101197904 | Ga0068864_1011979042 | 134 |
| 317 | 3300005719 | Ga0068861_101979189 | Ga0068861_1019791892 | 134 |
| 318 | 3300005841 | Ga0068863_100333837 | Ga0068863_1003338372 | 134 |
| 319 | 3300005842 | Ga0068858_100152274 | Ga0068858_1001522742 | 134 |
| 320 | 3300005843 | Ga0068860_100306046 | Ga0068860_1003060462 | 134 |
| 321 | 3300005844 | Ga0068862_100510650 | Ga0068862_1005106502 | 134 |
| 322 | 3300005844 | Ga0068862_102006346 | Ga0068862_1020063462 | 134 |
| 323 | 3300006028 | Ga0070717_10000036 | Ga0070717_1000003687 | 134 |
| 324 | 3300006028 | Ga0070717_10766210 | Ga0070717_107662102 | 134 |
| 325 | 3300006038 | Ga0075365_10423370 | Ga0075365_104233702 | 134 |
| 326 | 3300006042 | Ga0075368_10329072 | Ga0075368_103290722 | 134 |
| 327 | 3300006051 | Ga0075364_10535509 | Ga0075364_105355092 | 134 |
| 328 | 3300006175 | Ga0070712_100943231 | Ga0070712_1009432312 | 134 |
| 329 | 3300006178 | Ga0075367_10232121 | Ga0075367_102321212 | 134 |
| 330 | 3300006195 | Ga0075366_10043620 | Ga0075366_100436202 | 134 |
| 331 | 3300006358 | Ga0068871_101679453 | Ga0068871_1016794532 | 134 |
| 332 | 3300006847 | Ga0075431_100262936 | Ga0075431_1002629362 | 134 |
| 333 | 3300006852 | Ga0075433_10351286 | Ga0075433_103512863 | 134 |
| 334 | 3300006871 | Ga0075434_101035319 | Ga0075434_1010353192 | 134 |
| 335 | 3300006880 | Ga0075429_100228242 | Ga0075429_1002282422 | 134 |
| 336 | 3300006931 | Ga0097620_100309240 | Ga0097620_1003092402 | 134 |
| 337 | 3300006931 | Ga0097620_100544981 | Ga0097620_1005449812 | 134 |
| 338 | 3300006948 | Ga0099826_10000006 | Ga0099826_1000000676 | 134 |
| 339 | 3300009093 | Ga0105240_10551680 | Ga0105240_105516802 | 134 |
| 340 | 3300009094 | Ga0111539_10007326 | Ga0111539_100073267 | 134 |
| 341 | 3300009101 | Ga0105247_10159095 | Ga0105247_101590952 | 134 |
| 342 | 3300009147 | Ga0114129_10047439 | Ga0114129_100474392 | 134 |
| 343 | 3300009177 | Ga0105248_10140343 | Ga0105248_101403435 | 134 |
| 344 | 3300009545 | Ga0105237_10000012 | Ga0105237_10000012100 | 134 |
| 345 | 3300009545 | Ga0105237_10462738 | Ga0105237_104627383 | 134 |
| 346 | 3300009551 | Ga0105238_10001720 | Ga0105238_1000172016 | 134 |
| 347 | 3300009553 | Ga0105249_10299259 | Ga0105249_102992592 | 134 |
| 348 | 3300009553 | Ga0105249_11684691 | Ga0105249_116846911 | 134 |
| 349 | 3300010375 | Ga0105239_10358868 | Ga0105239_103588682 | 134 |
| 350 | 3300011119 | Ga0105246_10073253 | Ga0105246_100732533 | 134 |
| 351 | 3300013100 | Ga0157373_10648608 | Ga0157373_106486081 | 134 |
| 352 | 3300013102 | Ga0157371_10681822 | Ga0157371_106818222 | 134 |
| 353 | 3300013104 | Ga0157370_10002059 | Ga0157370_1000205919 | 134 |
| 354 | 3300013105 | Ga0157369_10003075 | Ga0157369_100030754 | 134 |
| 355 | 3300013105 | Ga0157369_10004385 | Ga0157369_1000438511 | 134 |
| 356 | 3300013297 | Ga0157378_11152953 | Ga0157378_111529532 | 134 |
| 357 | 3300013306 | Ga0163162_11722967 | Ga0163162_117229671 | 134 |
| 358 | 3300013307 | Ga0157372_10009024 | Ga0157372_100090246 | 134 |
| 359 | 3300013307 | Ga0157372_11679355 | Ga0157372_116793551 | 134 |
| 360 | 3300014325 | Ga0163163_10137363 | Ga0163163_101373632 | 134 |
| 361 | 3300014326 | Ga0157380_10081622 | Ga0157380_100816222 | 134 |
| 362 | 3300014326 | Ga0157380_10104985 | Ga0157380_101049854 | 134 |
| 363 | 3300014497 | Ga0182008_10016812 | Ga0182008_100168123 | 134 |
| 364 | 3300015261 | Ga0182006_1000042 | Ga0182006_100004279 | 134 |
| 365 | 3300015262 | Ga0182007_10066084 | Ga0182007_100660842 | 134 |
| 366 | 3300015265 | Ga0182005_1000008 | Ga0182005_100000861 | 134 |
| 367 | 3300015265 | Ga0182005_1008283 | Ga0182005_10082833 | 134 |
| 368 | 3300025263 | Ga0209565_1016569 | Ga0209565_10165692 | 134 |
| 369 | 3300025295 | Ga0209564_1017872 | Ga0209564_10178724 | 134 |
| 370 | 3300025299 | Ga0209256_1000035 | Ga0209256_1000035332 | 134 |
| 371 | 3300025904 | Ga0207647_10504886 | Ga0207647_105048861 | 134 |
| 372 | 3300025909 | Ga0207705_10065434 | Ga0207705_100654344 | 134 |
| 373 | 3300025909 | Ga0207705_10635643 | Ga0207705_106356432 | 134 |
| 374 | 3300025909 | Ga0207705_10889176 | Ga0207705_108891762 | 134 |
| 375 | 3300025911 | Ga0207654_10618575 | Ga0207654_106185752 | 134 |
| 376 | 3300025912 | Ga0207707_10016645 | Ga0207707_100166455 | 134 |
| 377 | 3300025912 | Ga0207707_10258464 | Ga0207707_102584642 | 134 |
| 378 | 3300025912 | Ga0207707_10391968 | Ga0207707_103919681 | 134 |
| 379 | 3300025912 | Ga0207707_11065482 | Ga0207707_110654821 | 134 |
| 380 | 3300025913 | Ga0207695_10298660 | Ga0207695_102986603 | 134 |
| 381 | 3300025914 | Ga0207671_10000029 | Ga0207671_10000029172 | 134 |
| 382 | 3300025914 | Ga0207671_10678524 | Ga0207671_106785242 | 134 |
| 383 | 3300025915 | Ga0207693_10624526 | Ga0207693_106245262 | 134 |
| 384 | 3300025917 | Ga0207660_10000785 | Ga0207660_100007852 | 134 |
| 385 | 3300025917 | Ga0207660_10174318 | Ga0207660_101743182 | 134 |
| 386 | 3300025917 | Ga0207660_10198600 | Ga0207660_101986002 | 134 |
| 387 | 3300025919 | Ga0207657_10228271 | Ga0207657_102282712 | 134 |
| 388 | 3300025919 | Ga0207657_10265115 | Ga0207657_102651153 | 134 |
| 389 | 3300025920 | Ga0207649_10310279 | Ga0207649_103102792 | 134 |
| 390 | 3300025921 | Ga0207652_10061822 | Ga0207652_100618222 | 134 |
| 391 | 3300025921 | Ga0207652_10199441 | Ga0207652_101994412 | 134 |
| 392 | 3300025921 | Ga0207652_10410038 | Ga0207652_104100383 | 134 |
| 393 | 3300025921 | Ga0207652_10630206 | Ga0207652_106302062 | 134 |
| 394 | 3300025924 | Ga0207694_10013044 | Ga0207694_100130445 | 134 |
| 395 | 3300025925 | Ga0207650_10366683 | Ga0207650_103666832 | 134 |
| 396 | 3300025928 | Ga0207700_10051893 | Ga0207700_100518932 | 134 |
| 397 | 3300025929 | Ga0207664_10051484 | Ga0207664_100514843 | 134 |
| 398 | 3300025929 | Ga0207664_10525446 | Ga0207664_105254462 | 134 |
| 399 | 3300025939 | Ga0207665_10090988 | Ga0207665_100909883 | 134 |
| 400 | 3300025941 | Ga0207711_10410744 | Ga0207711_104107442 | 134 |
| 401 | 3300025942 | Ga0207689_10587932 | Ga0207689_105879322 | 134 |
| 402 | 3300025944 | Ga0207661_10478239 | Ga0207661_104782393 | 134 |
| 403 | 3300025944 | Ga0207661_10912634 | Ga0207661_109126342 | 134 |
| 404 | 3300025949 | Ga0207667_10005066 | Ga0207667_100050664 | 134 |
| 405 | 3300025949 | Ga0207667_10005792 | Ga0207667_100057925 | 134 |
| 406 | 3300025949 | Ga0207667_10106081 | Ga0207667_101060812 | 134 |
| 407 | 3300025949 | Ga0207667_11012733 | Ga0207667_110127332 | 134 |
| 408 | 3300025961 | Ga0207712_11549907 | Ga0207712_115499071 | 134 |
| 409 | 3300025981 | Ga0207640_11097968 | Ga0207640_110979681 | 134 |
| 410 | 3300025986 | Ga0207658_11633505 | Ga0207658_116335052 | 134 |
| 411 | 3300026035 | Ga0207703_10175707 | Ga0207703_101757073 | 134 |
| 412 | 3300026041 | Ga0207639_12153296 | Ga0207639_121532961 | 134 |
| 413 | 3300026078 | Ga0207702_10065885 | Ga0207702_100658853 | 134 |
| 414 | 3300026078 | Ga0207702_10218293 | Ga0207702_102182933 | 134 |
| 415 | 3300026088 | Ga0207641_11610818 | Ga0207641_116108181 | 134 |
| 416 | 3300026142 | Ga0207698_10050668 | Ga0207698_100506682 | 134 |
| 417 | 3300026142 | Ga0207698_10113392 | Ga0207698_101133922 | 134 |
| 418 | 3300027111 | Ga0209281_1003273 | Ga0209281_10032733 | 134 |
| 419 | 3300027666 | Ga0209282_1000003 | Ga0209282_1000003296 | 134 |
| 420 | 3300027907 | Ga0207428_10028142 | Ga0207428_100281423 | 134 |
| 421 | 3300028379 | Ga0268266_10220152 | Ga0268266_102201522 | 134 |
| 422 | 3300028380 | Ga0268265_10212748 | Ga0268265_102127483 | 134 |
| 423 | 3300028380 | Ga0268265_10309817 | Ga0268265_103098172 | 134 |
| 424 | 3300028380 | Ga0268265_10529325 | Ga0268265_105293252 | 134 |
| 425 | 3300028380 | Ga0268265_10607820 | Ga0268265_106078202 | 134 |
| 426 | 3300028381 | Ga0268264_10268383 | Ga0268264_102683832 | 134 |
| 427 | 3300028794 | Ga0307515_10131650 | Ga0307515_101316502 | 134 |
| 428 | 3300031548 | Ga0307408_100003066 | Ga0307408_1000030665 | 134 |
| 429 | 3300031548 | Ga0307408_100298101 | Ga0307408_1002981012 | 134 |
| 430 | 3300031649 | Ga0307514_10277457 | Ga0307514_102774572 | 134 |
| 431 | 3300031731 | Ga0307405_10002451 | Ga0307405_100024513 | 134 |
| 432 | 3300031731 | Ga0307405_10353393 | Ga0307405_103533932 | 134 |
| 433 | 3300031731 | Ga0307405_10870958 | Ga0307405_108709582 | 134 |
| 434 | 3300031731 | Ga0307405_10875321 | Ga0307405_108753212 | 134 |
| 435 | 3300031824 | Ga0307413_10000693 | Ga0307413_100006938 | 134 |
| 436 | 3300031824 | Ga0307413_10040495 | Ga0307413_100404952 | 134 |
| 437 | 3300031824 | Ga0307413_10195166 | Ga0307413_101951663 | 134 |
| 438 | 3300031824 | Ga0307413_10380658 | Ga0307413_103806582 | 134 |
| 439 | 3300031824 | Ga0307413_10577946 | Ga0307413_105779462 | 134 |
| 440 | 3300031838 | Ga0307518_10177492 | Ga0307518_101774922 | 134 |
| 441 | 3300031852 | Ga0307410_10000242 | Ga0307410_1000024211 | 134 |
| 442 | 3300031852 | Ga0307410_10653981 | Ga0307410_106539812 | 134 |
| 443 | 3300031901 | Ga0307406_10000861 | Ga0307406_100008619 | 134 |
| 444 | 3300031901 | Ga0307406_10151560 | Ga0307406_101515602 | 134 |
| 445 | 3300031903 | Ga0307407_10000863 | Ga0307407_100008634 | 134 |
| 446 | 3300031903 | Ga0307407_10053308 | Ga0307407_100533082 | 134 |
| 447 | 3300031911 | Ga0307412_10004727 | Ga0307412_100047274 | 134 |
| 448 | 3300031911 | Ga0307412_10516573 | Ga0307412_105165732 | 134 |
| 449 | 3300031911 | Ga0307412_11016421 | Ga0307412_110164212 | 134 |
| 450 | 3300031995 | Ga0307409_100000279 | Ga0307409_1000002794 | 134 |
| 451 | 3300031995 | Ga0307409_100022928 | Ga0307409_1000229283 | 134 |
| 452 | 3300031995 | Ga0307409_100160957 | Ga0307409_1001609572 | 134 |
| 453 | 3300031995 | Ga0307409_100453468 | Ga0307409_1004534682 | 134 |
| 454 | 3300032002 | Ga0307416_100000333 | Ga0307416_10000033315 | 134 |
| 455 | 3300032002 | Ga0307416_100033131 | Ga0307416_1000331314 | 134 |
| 456 | 3300032002 | Ga0307416_100207453 | Ga0307416_1002074532 | 134 |
| 457 | 3300032002 | Ga0307416_101356067 | Ga0307416_1013560672 | 134 |
| 458 | 3300032002 | Ga0307416_102622839 | Ga0307416_1026228392 | 134 |
| 459 | 3300032004 | Ga0307414_10032339 | Ga0307414_100323394 | 134 |
| 460 | 3300032004 | Ga0307414_10063787 | Ga0307414_100637872 | 134 |
| 461 | 3300032004 | Ga0307414_10346838 | Ga0307414_103468383 | 134 |
| 462 | 3300032004 | Ga0307414_10736238 | Ga0307414_107362381 | 134 |
| 463 | 3300032005 | Ga0307411_10000636 | Ga0307411_100006367 | 134 |
| 464 | 3300032005 | Ga0307411_10032059 | Ga0307411_100320593 | 134 |
| 465 | 3300032005 | Ga0307411_10111683 | Ga0307411_101116832 | 134 |
| 466 | 3300032005 | Ga0307411_10468984 | Ga0307411_104689842 | 134 |
| 467 | 3300032126 | Ga0307415_100002195 | Ga0307415_1000021957 | 134 |
| 468 | 3300032126 | Ga0307415_100089144 | Ga0307415_1000891442 | 134 |
| 469 | 3300032126 | Ga0307415_100677348 | Ga0307415_1006773482 | 134 |
| 470 | 3300034817 | Ga0373948_0082320 | Ga0373948_0082320_25_429 | 134 |
| 471 | 3300035088 | Ga0373940_0076869 | Ga0373940_0076869_50_454 | 134 |
| 472 | 3300035090 | Ga0373949_0132512 | Ga0373949_0132512_133_537 | 134 |
| 473 | 3300035092 | Ga0373952_0006708 | Ga0373952_0006708_378_806 | 134 |
| 474 | 3300035092 | Ga0373952_0171144 | Ga0373952_0171144_158_562 | 134 |
| 475 | 3300035111 | Ga0373923_0519553 | Ga0373923_0519553_47_451 | 134 |
| 476 | 3300035121 | Ga0373960_0062686 | Ga0373960_0062686_405_809 | 134 |
| 477 | 3300035170 | Ga0373943_0852558 | Ga0373943_0852558_62_466 | 134 |
| 478 | 3300035171 | Ga0373946_0373535 | Ga0373946_0373535_219_623 | 134 |
| 479 | 3300035172 | Ga0373955_0044590 | Ga0373955_0044590_949_1353 | 134 |
| 480 | 3300035207 | Ga0373942_0016086 | Ga0373942_0016086_1361_1789 | 134 |
| 481 | 3300035241 | Ga0373961_0073445 | Ga0373961_0073445_87_515 | 134 |
| 482 | 3300035692 | Ga0373935_0671051 | Ga0373935_0671051_56_460 | 134 |
| 483 | 3300035695 | Ga0373927_0244245 | Ga0373927_0244245_169_576 | 134 |
| 484 | 3300035695 | Ga0373927_0318049 | Ga0373927_0318049_467_871 | 134 |
| 485 | 3300035724 | Ga0373933_0100729 | Ga0373933_0100729_699_1103 | 134 |
| 486 | 3300036401 | Ga0373937_0057662 | Ga0373937_0057662_3107_3511 | 134 |
| 487 | 3300037068 | Ga0373925_0126901 | Ga0373925_0126901_73_477 | 134 |
| 488 | 3300037418 | Ga0395900_0341037 | Ga0395900_0341037_821_1225 | 134 |
| 489 | 3300037466 | Ga0395898_0307138 | Ga0395898_0307138_1078_1482 | 134 |
| 490 | 3300037471 | Ga0395905_0115299 | Ga0395905_0115299_974_1378 | 134 |
| 491 | 3300037471 | Ga0395905_0644266 | Ga0395905_0644266_267_734 | 134 |
| 492 | 3300039437 | Ga0436365_1665182 | Ga0436365_1665182_616_1029 | 134 |
| 493 | 3300041492 | Ga0451835_1199059 | Ga0451835_1199059_90_494 | 134 |
| 494 | 3300042139 | Ga0450904_005021 | Ga0450904_005021_459_920 | 134 |
| 495 | 3300042876 | Ga0451577_0505903 | Ga0451577_0505903_295_699 | 134 |
| 496 | 3300044658 | Ga0466972_0048350 | Ga0466972_0048350_935_1339 | 134 |
| 497 | 3300044672 | Ga0466982_0125914 | Ga0466982_0125914_1073_1489 | 134 |
| 498 | 3300044683 | Ga0466965_0046091 | Ga0466965_0046091_1674_2090 | 134 |
| 499 | 3300044683 | Ga0466965_0554776 | Ga0466965_0554776_154_570 | 134 |
| 500 | 3300044694 | Ga0466963_0584106 | Ga0466963_0584106_349_753 | 134 |
| 501 | 3300044735 | Ga0466968_0018413 | Ga0466968_0018413_1921_2337 | 134 |
| 502 | 3300044735 | Ga0466968_0085819 | Ga0466968_0085819_667_1071 | 134 |
| 503 | 3300044765 | Ga0466970_0004357 | Ga0466970_0004357_6328_6744 | 134 |
| 504 | 3300044901 | Ga0466960_0089231 | Ga0466960_0089231_1047_1451 | 134 |
| 505 | 3300044901 | Ga0466960_0351065 | Ga0466960_0351065_12_428 | 134 |
| 506 | 3300044901 | Ga0466960_0430497 | Ga0466960_0430497_76_543 | 134 |
| 507 | 3300045976 | Ga0466967_0561193 | Ga0466967_0561193_188_655 | 134 |
| 508 | 3300045976 | Ga0466967_2570491 | Ga0466967_2570491_12_428 | 134 |
| 509 | 3300046462 | Ga0495651_1011169 | Ga0495651_1011169_62_466 | 134 |
| 510 | 3300046472 | Ga0495580_0046966 | Ga0495580_0046966_2151_2558 | 134 |
| 511 | 3300046472 | Ga0495580_0048809 | Ga0495580_0048809_828_1232 | 134 |
| 512 | 3300046473 | Ga0495582_0052425 | Ga0495582_0052425_801_1205 | 134 |
| 513 | 3300046475 | Ga0495639_0017984 | Ga0495639_0017984_1601_2005 | 134 |
| 514 | 3300046492 | Ga0495585_0003702 | Ga0495585_0003702_1258_1725 | 134 |
| 515 | 3300046492 | Ga0495585_0024732 | Ga0495585_0024732_1615_2082 | 134 |
| 516 | 3300046501 | Ga0495607_0275535 | Ga0495607_0275535_131_547 | 134 |
| 517 | 3300046506 | Ga0495583_0085190 | Ga0495583_0085190_551_1018 | 134 |
| 518 | 3300046507 | Ga0495606_0063614 | Ga0495606_0063614_169_636 | 134 |
| 519 | 3300046507 | Ga0495606_0089158 | Ga0495606_0089158_1317_1733 | 134 |
| 520 | 3300046513 | Ga0495616_0001048 | Ga0495616_0001048_4071_4538 | 134 |
| 521 | 3300046513 | Ga0495616_0005059 | Ga0495616_0005059_4542_5009 | 134 |
| 522 | 3300046515 | Ga0495620_0006267 | Ga0495620_0006267_211_678 | 134 |
| 523 | 3300046518 | Ga0495631_0098152 | Ga0495631_0098152_637_1104 | 134 |
| 524 | 3300046522 | Ga0495643_0000003 | Ga0495643_0000003_449416_449820 | 134 |
| 525 | 3300046522 | Ga0495643_0048489 | Ga0495643_0048489_339_755 | 134 |
| 526 | 3300046528 | Ga0495642_0001678 | Ga0495642_0001678_7273_7740 | 134 |
| 527 | 3300046531 | Ga0495665_0040221 | Ga0495665_0040221_1745_2152 | 134 |
| 528 | 3300046531 | Ga0495665_0040822 | Ga0495665_0040822_699_1103 | 134 |
| 529 | 3300046535 | Ga0495586_0205985 | Ga0495586_0205985_133_537 | 134 |
| 530 | 3300046535 | Ga0495586_0349855 | Ga0495586_0349855_199_606 | 134 |
| 531 | 3300046538 | Ga0495609_0014519 | Ga0495609_0014519_622_1038 | 134 |
| 532 | 3300046538 | Ga0495609_0216022 | Ga0495609_0216022_103_570 | 134 |
| 533 | 3300046558 | Ga0495633_0144813 | Ga0495633_0144813_555_1022 | 134 |
| 534 | 3300046559 | Ga0495667_0202268 | Ga0495667_0202268_74_478 | 134 |
| 535 | 3300046660 | Ga0495625_0210218 | Ga0495625_0210218_434_850 | 134 |
| 536 | 3300046665 | Ga0495661_0008237 | Ga0495661_0008237_3461_3928 | 134 |
| 537 | 3300046684 | Ga0495669_0562547 | Ga0495669_0562547_56_523 | 134 |
| 538 | 3300046809 | Ga0495600_0237151 | Ga0495600_0237151_603_1007 | 134 |
| 539 | 3300046810 | Ga0495660_0000242 | Ga0495660_0000242_10695_11111 | 134 |
| 540 | 3300046810 | Ga0495660_0033648 | Ga0495660_0033648_732_1199 | 134 |
| 541 | 3300047315 | Ga0495581_0005859 | Ga0495581_0005859_1832_2236 | 134 |
| 542 | 3300047323 | Ga0495683_0117254 | Ga0495683_0117254_12_479 | 134 |
| 543 | 3300047445 | Ga0495677_0411927 | Ga0495677_0411927_51_518 | 134 |
| 544 | 3300047470 | Ga0495681_0022790 | Ga0495681_0022790_1278_1745 | 134 |
| 545 | 3300047472 | Ga0495686_0013673 | Ga0495686_0013673_1306_1722 | 134 |
| 546 | 3300048906 | Ga0496103_0551870 | Ga0496103_0551870_239_706 | 134 |
| 547 | 3300048909 | Ga0496106_0119194 | Ga0496106_0119194_952_1419 | 134 |
| 548 | 3300048910 | Ga0496107_0059826 | Ga0496107_0059826_1258_1725 | 134 |
| 549 | 3300048911 | Ga0496108_0326256 | Ga0496108_0326256_328_744 | 134 |
| 550 | 3300048912 | Ga0496109_0615155 | Ga0496109_0615155_164_568 | 134 |
| 551 | 3300048914 | Ga0496111_0303297 | Ga0496111_0303297_169_585 | 134 |
| 552 | 3300048915 | Ga0496112_0155062 | Ga0496112_0155062_285_689 | 134 |
| 553 | 3300048915 | Ga0496112_0511336 | Ga0496112_0511336_233_637 | 134 |
| 554 | 3300048916 | Ga0496113_1335573 | Ga0496113_1335573_113_517 | 134 |
| 555 | 3300048918 | Ga0496115_0018283 | Ga0496115_0018283_2760_3164 | 134 |
| 556 | 3300048918 | Ga0496115_0266424 | Ga0496115_0266424_648_1052 | 134 |
| 557 | 3300048924 | Ga0496121_0204466 | Ga0496121_0204466_138_569 | 134 |
| 558 | 3300048929 | Ga0496126_0004368 | Ga0496126_0004368_11357_11794 | 134 |
| 559 | 3300048929 | Ga0496126_0050763 | Ga0496126_0050763_2723_3175 | 134 |
| 560 | 3300049521 | Ga0501298_072821 | Ga0501298_072821_229_639 | 134 |
| 561 | 3300049522 | Ga0501299_023212 | Ga0501299_023212_512_922 | 134 |
| 562 | 3300049568 | Ga0501031_0226213 | Ga0501031_0226213_333_740 | 134 |
| 563 | 3300049572 | Ga0501036_1637746 | Ga0501036_1637746_65_472 | 134 |
| 564 | 3300049573 | Ga0501037_0474592 | Ga0501037_0474592_363_767 | 134 |
| 565 | 3300049574 | Ga0501038_0229997 | Ga0501038_0229997_696_1136 | 134 |
| 566 | 3300049576 | Ga0501040_0128227 | Ga0501040_0128227_942_1346 | 134 |
| 567 | 3300049577 | Ga0501041_0054609 | Ga0501041_0054609_259_663 | 134 |
| 568 | 3300049578 | Ga0501042_0549657 | Ga0501042_0549657_294_698 | 134 |
| 569 | 3300049578 | Ga0501042_1420586 | Ga0501042_1420586_82_486 | 134 |
| 570 | 3300049580 | Ga0501046_0534663 | Ga0501046_0534663_153_557 | 134 |
| 571 | 3300049582 | Ga0501048_0361752 | Ga0501048_0361752_372_779 | 134 |
| 572 | 3300049582 | Ga0501048_0518057 | Ga0501048_0518057_439_843 | 134 |
| 573 | 3300049583 | Ga0501067_0016178 | Ga0501067_0016178_3207_3611 | 134 |
| 574 | 3300049584 | Ga0501068_0033811 | Ga0501068_0033811_651_1055 | 134 |
| 575 | 3300049585 | Ga0501069_0010953 | Ga0501069_0010953_1373_1777 | 134 |
| 576 | 3300049587 | Ga0501071_0038701 | Ga0501071_0038701_1479_1883 | 134 |
| 577 | 3300049587 | Ga0501071_0274640 | Ga0501071_0274640_548_952 | 134 |
| 578 | 3300049588 | Ga0501072_0014673 | Ga0501072_0014673_2414_2818 | 134 |
| 579 | 3300049589 | Ga0501073_0493563 | Ga0501073_0493563_61_501 | 134 |
| 580 | 3300049590 | Ga0501074_0602050 | Ga0501074_0602050_344_748 | 134 |
| 581 | 3300049591 | Ga0501075_0282236 | Ga0501075_0282236_394_798 | 134 |
| 582 | 3300049591 | Ga0501075_0511686 | Ga0501075_0511686_55_459 | 134 |
| 583 | 3300049591 | Ga0501075_0831753 | Ga0501075_0831753_53_457 | 134 |
| 584 | 3300049592 | Ga0501076_0011033 | Ga0501076_0011033_1226_1630 | 134 |
| 585 | 3300049592 | Ga0501076_0600862 | Ga0501076_0600862_387_791 | 134 |
| 586 | 3300049593 | Ga0501077_0313826 | Ga0501077_0313826_228_632 | 134 |
| 587 | 3300049671 | Ga0501238_005001 | Ga0501238_005001_41_457 | 134 |
| 588 | 3300049671 | Ga0501238_059615 | Ga0501238_059615_20_436 | 134 |
| 589 | 3300049675 | Ga0501243_104276 | Ga0501243_104276_80_490 | 134 |
| 590 | 3300049705 | Ga0501225_0140280 | Ga0501225_0140280_280_696 | 134 |
| 591 | 3300049741 | Ga0501079_0101306 | Ga0501079_0101306_961_1365 | 134 |
| 592 | 3300049742 | Ga0501080_0060591 | Ga0501080_0060591_1413_1853 | 134 |
| 593 | 3300049743 | Ga0501081_0146581 | Ga0501081_0146581_778_1182 | 134 |
| 594 | 3300049744 | Ga0501083_0441284 | Ga0501083_0441284_213_617 | 134 |
| 595 | 3300049771 | Ga0501274_010619 | Ga0501274_010619_129_539 | 134 |
| 596 | 3300049822 | Ga0501035_0572788 | Ga0501035_0572788_330_770 | 134 |
| 597 | 3300049823 | Ga0501044_0084088 | Ga0501044_0084088_2245_2685 | 134 |
| 598 | 3300049824 | Ga0501045_0018451 | Ga0501045_0018451_815_1219 | 134 |
| 599 | 3300050493 | nmdc:mga0k408_117871_c1 | nmdc:mga0k408_117871_c1_1055_1459 | 134 |
| 600 | 3300050493 | nmdc:mga0k408_45001_c1 | nmdc:mga0k408_45001_c1_161_565 | 134 |
| 601 | 3300050494 | nmdc:mga06z11_17838_c1 | nmdc:mga06z11_17838_c1_2310_2714 | 134 |
| 602 | 3300050508 | nmdc:mga09592_244908_c1 | nmdc:mga09592_244908_c1_327_731 | 134 |
| 603 | 3300050508 | nmdc:mga09592_552247_c1 | nmdc:mga09592_552247_c1_190_600 | 134 |
| 604 | 3300050509 | nmdc:mga0qj67_24235_c1 | nmdc:mga0qj67_24235_c1_1932_2336 | 134 |
| 605 | 3300050509 | nmdc:mga0qj67_258942_c1 | nmdc:mga0qj67_258942_c1_28_438 | 134 |
| 606 | 3300050509 | nmdc:mga0qj67_549092_c1 | nmdc:mga0qj67_549092_c1_393_803 | 134 |
| 607 | 3300050510 | nmdc:mga06r32_1045755_c1 | nmdc:mga06r32_1045755_c1_47_451 | 134 |
| 608 | 3300050510 | nmdc:mga06r32_111503_c1 | nmdc:mga06r32_111503_c1_237_641 | 134 |
| 609 | 3300050510 | nmdc:mga06r32_196731_c1 | nmdc:mga06r32_196731_c1_590_1000 | 134 |
| 610 | 3300050510 | nmdc:mga06r32_222353_c1 | nmdc:mga06r32_222353_c1_219_623 | 134 |
| 611 | 3300050511 | nmdc:mga08y16_194887_c1 | nmdc:mga08y16_194887_c1_71_475 | 134 |
| 612 | 3300050511 | nmdc:mga08y16_90986_c1 | nmdc:mga08y16_90986_c1_818_1222 | 134 |
| 613 | 3300050512 | nmdc:mga0n895_1155057_c1 | nmdc:mga0n895_1155057_c1_24_428 | 134 |
| 614 | 3300050513 | nmdc:mga0rr50_633402_c1 | nmdc:mga0rr50_633402_c1_369_773 | 134 |
| 615 | 3300050514 | nmdc:mga08x19_506665_c1 | nmdc:mga08x19_506665_c1_338_742 | 134 |
| 616 | 3300050515 | nmdc:mga0a205_360817_c1 | nmdc:mga0a205_360817_c1_86_490 | 134 |
| 617 | 3300053085 | Ga0495619_0038766 | Ga0495619_0038766_959_1366 | 134 |
| 618 | 3300053085 | Ga0495619_0049522 | Ga0495619_0049522_570_974 | 134 |
| 619 | 3300053139 | Ga0500568_0019210 | Ga0500568_0019210_1738_2145 | 134 |
| 620 | 3300053139 | Ga0500568_0030978 | Ga0500568_0030978_1399_1803 | 134 |
| 621 | 3300053151 | Ga0500604_0035556 | Ga0500604_0035556_412_816 | 134 |
| 622 | 3300054114 | Ga0501084_0267769 | Ga0501084_0267769_441_845 | 134 |
| 623 | 3300060353 | Ga0501082_1701048 | Ga0501082_1701048_132_536 | 134 |
| 624 | iso_pu_bacteria | 2857357740 | 2857367147 | 134 |
| 625 | 3300003320 | rootH2_10183960 | rootH2_101839602 | 135 |
| 626 | 3300003322 | rootL2_10039180 | rootL2_100391803 | 135 |
| 627 | 3300003322 | rootL2_10061762 | rootL2_100617622 | 135 |
| 628 | 3300005327 | Ga0070658_10979007 | Ga0070658_109790071 | 135 |
| 629 | 3300006353 | Ga0075370_10308232 | Ga0075370_103082322 | 135 |
| 630 | 3300006844 | Ga0075428_100602726 | Ga0075428_1006027263 | 135 |
| 631 | 3300006871 | Ga0075434_102064395 | Ga0075434_1020643952 | 135 |
| 632 | 3300014326 | Ga0157380_12298480 | Ga0157380_122984802 | 135 |
| 633 | 3300015688 | Ga0183367_1004 | Ga0183367_100460 | 135 |
| 634 | 3300026041 | Ga0207639_10000009 | Ga0207639_10000009280 | 135 |
| 635 | 3300026067 | Ga0207678_11654541 | Ga0207678_116545411 | 135 |
| 636 | 3300046491 | Ga0495584_0172400 | Ga0495584_0172400_154_624 | 135 |
| 637 | 3300046499 | Ga0495594_0518035 | Ga0495594_0518035_190_660 | 135 |
| 638 | 3300046500 | Ga0495596_0033604 | Ga0495596_0033604_17_487 | 135 |
| 639 | 3300046501 | Ga0495607_0131773 | Ga0495607_0131773_663_1133 | 135 |
| 640 | 3300046518 | Ga0495631_0085548 | Ga0495631_0085548_448_918 | 135 |
| 641 | 3300046528 | Ga0495642_0407943 | Ga0495642_0407943_80_550 | 135 |
| 642 | 3300046538 | Ga0495609_0001447 | Ga0495609_0001447_1254_1724 | 135 |
| 643 | 3300046557 | Ga0495622_0025563 | Ga0495622_0025563_907_1377 | 135 |
| 644 | 3300047320 | Ga0495672_0104581 | Ga0495672_0104581_889_1359 | 135 |
| 645 | 3300047323 | Ga0495683_0011331 | Ga0495683_0011331_4093_4563 | 135 |
| 646 | 3300047445 | Ga0495677_0112296 | Ga0495677_0112296_388_858 | 135 |
| 647 | 3300047469 | Ga0495673_0028104 | Ga0495673_0028104_662_1132 | 135 |
| 648 | 3300048091 | Ga0495626_0043126 | Ga0495626_0043126_43_513 | 135 |
| 649 | 3300049570 | Ga0501033_0039232 | Ga0501033_0039232_2917_3360 | 135 |
| 650 | 3300049571 | Ga0501034_0224227 | Ga0501034_0224227_610_1053 | 135 |
| 651 | 3300049573 | Ga0501037_0364354 | Ga0501037_0364354_300_743 | 135 |
| 652 | 3300049574 | Ga0501038_0233076 | Ga0501038_0233076_612_1055 | 135 |
| 653 | 3300049579 | Ga0501043_0011457 | Ga0501043_0011457_612_1055 | 135 |
| 654 | 3300049581 | Ga0501047_0011388 | Ga0501047_0011388_7365_7808 | 135 |
| 655 | 3300049582 | Ga0501048_1029393 | Ga0501048_1029393_136_579 | 135 |
| 656 | 3300049743 | Ga0501081_0644794 | Ga0501081_0644794_232_651 | 135 |
| 657 | 3300049823 | Ga0501044_0007782 | Ga0501044_0007782_1420_1863 | 135 |
| 658 | 3300050490 | nmdc:mga03n38_13122_c1 | nmdc:mga03n38_13122_c1_484_927 | 135 |
| 659 | 3300050496 | nmdc:mga07m45_164537_c1 | nmdc:mga07m45_164537_c1_620_1063 | 135 |
| 660 | 3300050512 | nmdc:mga0n895_1036639_c1 | nmdc:mga0n895_1036639_c1_88_495 | 135 |
| 661 | 3300053136 | Ga0500559_0207376 | Ga0500559_0207376_189_596 | 135 |
| 662 | 3300053153 | Ga0500616_0030617 | Ga0500616_0030617_540_947 | 135 |
| 663 | 3300025918 | Ga0207662_10444356 | Ga0207662_104443562 | 136 |
| 664 | 3300044684 | Ga0466966_0143183 | Ga0466966_0143183_431_853 | 136 |
| 665 | 3300005331 | Ga0070670_100067240 | Ga0070670_1000672404 | 137 |
| 666 | 3300032002 | Ga0307416_100289780 | Ga0307416_1002897803 | 137 |
| 667 | 3300053177 | Ga0500636_0079908 | Ga0500636_0079908_259_672 | 137 |
| 668 | iso_pu_bacteria | 2738541276 | 2738713318 | 137 |
| 669 | 3300005327 | Ga0070658_10001128 | Ga0070658_1000112816 | 138 |
| 670 | 3300006358 | Ga0068871_100915719 | Ga0068871_1009157192 | 138 |
| 671 | 3300014326 | Ga0157380_12340171 | Ga0157380_123401712 | 138 |
| 672 | 3300025909 | Ga0207705_10057917 | Ga0207705_100579173 | 138 |
| 673 | 3300035172 | Ga0373955_0334499 | Ga0373955_0334499_342_758 | 138 |
| 674 | 3300036401 | Ga0373937_0099742 | Ga0373937_0099742_996_1412 | 138 |
| 675 | 3300046517 | Ga0495630_0352729 | Ga0495630_0352729_249_665 | 138 |
| 676 | 3300046679 | Ga0495623_0152070 | Ga0495623_0152070_273_689 | 138 |
| 677 | 3300053136 | Ga0500559_0246455 | Ga0500559_0246455_112_534 | 138 |
| 678 | 3300053150 | Ga0500603_181108 | Ga0500603_181108_231_653 | 138 |
| 679 | 3300053163 | Ga0500639_322944 | Ga0500639_322944_34_456 | 138 |
| 680 | 3300006163 | Ga0070715_10036392 | Ga0070715_100363923 | 139 |
| 681 | 3300025905 | Ga0207685_10280035 | Ga0207685_102800352 | 139 |
| 682 | 3300025928 | Ga0207700_10532336 | Ga0207700_105323361 | 139 |
| 683 | 3300003316 | rootH1_10139171 | rootH1_101391712 | 140 |
| 684 | 3300003323 | rootH1_10050409 | rootH1_100504094 | 140 |
| 685 | 3300005335 | Ga0070666_10154080 | Ga0070666_101540802 | 140 |
| 686 | 3300005548 | Ga0070665_100113985 | Ga0070665_1001139852 | 140 |
| 687 | 3300005617 | Ga0068859_101658899 | Ga0068859_1016588991 | 140 |
| 688 | 3300006931 | Ga0097620_101658379 | Ga0097620_1016583791 | 140 |
| 689 | 3300009177 | Ga0105248_10472666 | Ga0105248_104726662 | 140 |
| 690 | 3300010375 | Ga0105239_10756816 | Ga0105239_107568162 | 140 |
| 691 | 3300025903 | Ga0207680_10380949 | Ga0207680_103809492 | 140 |
| 692 | 3300025904 | Ga0207647_10003933 | Ga0207647_100039337 | 140 |
| 693 | 3300028379 | Ga0268266_10459017 | Ga0268266_104590172 | 140 |
| 694 | 3300035724 | Ga0373933_0662190 | Ga0373933_0662190_100_525 | 140 |
| 695 | 3300036401 | Ga0373937_1764998 | Ga0373937_1764998_68_493 | 140 |
| 696 | 3300046471 | Ga0495650_0085656 | Ga0495650_0085656_606_1082 | 140 |
| 697 | 3300046507 | Ga0495606_0094953 | Ga0495606_0094953_694_1116 | 140 |
| 698 | 3300046522 | Ga0495643_0101005 | Ga0495643_0101005_949_1371 | 140 |
| 699 | 3300046616 | Ga0495668_0045789 | Ga0495668_0045789_1175_1597 | 140 |
| 700 | 3300046694 | Ga0495649_0008250 | Ga0495649_0008250_4180_4602 | 140 |
| 701 | 3300047318 | Ga0495636_0069911 | Ga0495636_0069911_225_647 | 140 |
| 702 | 3300047443 | Ga0495687_009802 | Ga0495687_009802_1034_1456 | 140 |
| 703 | 3300049460 | Ga0495682_0108932 | Ga0495682_0108932_133_555 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gkz-assembly1.cif.gz_A | branched-chain alpha-ketoacid dehydrogenase kinase (bck) complxed with adp | 0.8511 | 79 | 140 |
| 6m36-assembly1.cif.gz_G | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.822 | 6 | 139 |
| 6m36-assembly2.cif.gz_I | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.8178 | 6 | 140 |
| 6m36-assembly2.cif.gz_M | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.8067 | 6 | 140 |
| 6m36-assembly2.cif.gz_I | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.8037 | 6 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3j9x101 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8398 | 23 | 59 | 1.20.58.800 |
| af_Q9LIR0_51_379_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.816 | 64 | 84 | 2.130.10.10 |
| 3ke6B02 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8048 | 10 | 140 | 3.30.565.10 |
| af_P39986_495_668_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.7883 | 67 | 84 | 3.40.1110.10 |
| 1tidC00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7655 | 6 | 138 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3PC47-F1-model_v4 | deleted | 0.974 | 6 | 93 |
|
| AF-A0A418MFE8-F1-model_v4 | Anti-sigma regulatory factor | 0.9733 | 6 | 140 |
|
| AF-A0A2V7L193-F1-model_v4 | ATP-binding protein | 0.9701 | 13 | 140 |
GO:0004674
GO:0005524 |
| AF-S4N0S0-F1-model_v4 | PPM-type phosphatase domain-containing protein | 0.9663 | 23 | 139 |
|
| AF-B9X9T7-F1-model_v4 | Putative anti-sigma regulatory factor, serine/threonine protein kinase | 0.9624 | 10 | 139 |
GO:0004674
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar