F476295

General Info

Members Datasets Scaffolds Average Seq Length
703 391 684 135

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100289780|Ga0307416_1002897803
Length 147
Sequence VAGTSTADAELAFEASTDLALRSSEDVVRLRGAVRERAIAAGLGLVDQTKIITAASELGRNTVQYGGGGTATVAIVTGKGGRRGVRLQFVDRGPGIADIDLALKDGYTTGGGLGLGLSGARRLSDEFELRSRPGEGTRVTILRWKPF

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
5 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
6 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
7 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
8 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
9 2857553236 Duganella sp. R-74557 Isolate Unclassified
10 2857558681 Duganella sp. R-74565 Isolate Unclassified
11 2857564685 Duganella sp. R-74599 Isolate Unclassified
12 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
13 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
14 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
15 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
16 2891562705 Microbispora tritici MT50 Isolate Unclassified
17 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
18 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
19 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
246 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
276 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
308 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
331 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
356 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
357 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
385 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.84
Nodule 0.43
Rhizoplane 1.85
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 4.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10139171 3300003316 Bacteria 1824
2 rootH2_10183960 3300003320 Bacteria 1637
3 rootL2_10030680 3300003322 Bacteria 8099
4 rootL2_10039180 3300003322 Bacteria 2138
5 rootL2_10061762 3300003322 Bacteria 1674
6 rootH1_10050409 3300003323 Bacteria 56358
7 Ga0055524_1000053 3300003775 Bacteria 144892
8 JGI25405J52794_10006918 3300003911 Bacteria 2080
9 Ga0065165_1116071 3300005262 Bacteria 654
10 Ga0070658_10001128 3300005327 Bacteria 22780
11 Ga0070658_10104538 3300005327 Bacteria 2343
12 Ga0070658_10229931 3300005327 Bacteria 1570
13 Ga0070658_10230195 3300005327 Bacteria 1569
14 Ga0070658_10979007 3300005327 Bacteria 736
15 Ga0070676_10813073 3300005328 Bacteria 690
16 Ga0070683_100945281 3300005329 Bacteria 827
17 Ga0070690_100014098 3300005330 Bacteria 4738
18 Ga0070670_100067240 3300005331 Bacteria 3075
19 Ga0070670_101342121 3300005331 Bacteria 655
20 Ga0068869_100172038 3300005334 Bacteria 1692
21 Ga0068869_100570631 3300005334 Bacteria 953
22 Ga0070666_10154080 3300005335 Bacteria 1604
23 Ga0070680_100003184 3300005336 Bacteria 12192
24 Ga0070680_100120036 3300005336 Bacteria 2194
25 Ga0070680_100275800 3300005336 Bacteria 1424
26 Ga0070680_100413854 3300005336 Bacteria 1150
27 Ga0070682_100269085 3300005337 Bacteria 1237
28 Ga0068868_100434416 3300005338 Bacteria 1139
29 Ga0070660_100003463 3300005339 Bacteria 10864
30 Ga0070660_100166220 3300005339 Bacteria 1780
31 Ga0070689_100006738 3300005340 Bacteria 7984
32 Ga0070689_100169672 3300005340 Bacteria 1767
33 Ga0070687_100857239 3300005343 Bacteria 648
34 Ga0070661_100361850 3300005344 Bacteria 1140
35 Ga0070692_10046431 3300005345 Bacteria 2245
36 Ga0070668_100833351 3300005347 Bacteria 821
37 Ga0070669_100596968 3300005353 Bacteria 925
38 Ga0070675_100811582 3300005354 Unclassified 855
39 Ga0070674_100364042 3300005356 Bacteria 1172
40 Ga0070673_100025140 3300005364 Bacteria 4378
41 Ga0070673_100218708 3300005364 Bacteria 1648
42 Ga0070673_101147492 3300005364 Bacteria 727
43 Ga0070688_100141103 3300005365 Bacteria 1637
44 Ga0070659_100125288 3300005366 Bacteria 2084
45 Ga0070659_101353396 3300005366 Bacteria 632
46 Ga0070714_100099223 3300005435 Bacteria 2563
47 Ga0070713_100260801 3300005436 Bacteria 1584
48 Ga0070701_10111036 3300005438 Bacteria 1532
49 Ga0070701_10760553 3300005438 Bacteria 657
50 Ga0070711_100945710 3300005439 Bacteria 737
51 Ga0070705_100150530 3300005440 Bacteria 1543
52 Ga0070700_100002626 3300005441 Bacteria 9192
53 Ga0070700_100016842 3300005441 Bacteria 4168
54 Ga0070700_101075440 3300005441 Bacteria 665
55 Ga0070694_100540157 3300005444 Bacteria 932
56 Ga0070663_101087340 3300005455 Unclassified 699
57 Ga0070678_100028309 3300005456 Bacteria 3820
58 Ga0070678_100197526 3300005456 Bacteria 1658
59 Ga0070681_10116648 3300005458 Bacteria 2607
60 Ga0070681_10270923 3300005458 Bacteria 1609
61 Ga0070681_10702081 3300005458 Bacteria 927
62 Ga0068867_100028822 3300005459 Bacteria 3997
63 Ga0068867_101173629 3300005459 Unclassified 704
64 Ga0070685_10016541 3300005466 Bacteria 3932
65 Ga0070685_10017590 3300005466 Bacteria 3828
66 Ga0070685_10237829 3300005466 Bacteria 1201
67 Ga0070685_10543773 3300005466 Bacteria 828
68 Ga0070698_100251978 3300005471 Bacteria 1698
69 Ga0070679_100026857 3300005530 Bacteria 5662
70 Ga0070679_100029361 3300005530 Bacteria 5426
71 Ga0070679_100038082 3300005530 Bacteria 4780
72 Ga0070679_100041268 3300005530 Bacteria 4592
73 Ga0070679_100345386 3300005530 Bacteria 1436
74 Ga0070679_100825197 3300005530 Bacteria 870
75 Ga0070679_101217493 3300005530 Bacteria 698
76 Ga0070684_100004937 3300005535 Bacteria 10179
77 Ga0070684_101278260 3300005535 Bacteria 690
78 Ga0070672_100015776 3300005543 Bacteria 5394
79 Ga0070672_101504176 3300005543 Bacteria 603
80 Ga0070686_100012542 3300005544 Bacteria 4829
81 Ga0070686_100351496 3300005544 Bacteria 1108
82 Ga0070695_100110679 3300005545 Bacteria 1863
83 Ga0070696_100204993 3300005546 Bacteria 1474
84 Ga0070696_101132939 3300005546 Bacteria 659
85 Ga0070693_100161055 3300005547 Bacteria 1429
86 Ga0070693_100197798 3300005547 Bacteria 1303
87 Ga0070665_100002550 3300005548 Bacteria 20005
88 Ga0070665_100113985 3300005548 Bacteria 2706
89 Ga0070665_100916454 3300005548 Bacteria 889
90 Ga0070665_102070826 3300005548 Bacteria 574
91 Ga0070704_100657034 3300005549 Bacteria 926
92 Ga0068855_100001103 3300005563 Bacteria 33569
93 Ga0068855_100008079 3300005563 Bacteria 12714
94 Ga0068855_100019512 3300005563 Bacteria 8147
95 Ga0068855_100033873 3300005563 Bacteria 6093
96 Ga0070664_100432787 3300005564 Bacteria 1206
97 Ga0068857_100044553 3300005577 Bacteria 3936
98 Ga0068857_100552029 3300005577 Bacteria 1085
99 Ga0068857_100599601 3300005577 Bacteria 1041
100 Ga0068857_101643573 3300005577 Unclassified 627
101 Ga0068854_100014453 3300005578 Bacteria 5205
102 Ga0068854_101551260 3300005578 Unclassified 602
103 Ga0068856_100155196 3300005614 Bacteria 2299
104 Ga0068856_100463843 3300005614 Bacteria 1287
105 Ga0070702_100001989 3300005615 Bacteria 8611
106 Ga0068852_100264107 3300005616 Bacteria 1654
107 Ga0068852_100689139 3300005616 Bacteria 1031
108 Ga0068859_100160678 3300005617 Bacteria 2326
109 Ga0068859_100309242 3300005617 Bacteria 1674
110 Ga0068859_100544978 3300005617 Bacteria 1255
111 Ga0068859_101658899 3300005617 Bacteria 706
112 Ga0068864_101197904 3300005618 Bacteria 758
113 Ga0068866_10007387 3300005718 Bacteria 4598
114 Ga0068861_100007885 3300005719 Bacteria 7327
115 Ga0068861_101979189 3300005719 Bacteria 581
116 Ga0068870_10139494 3300005840 Bacteria 1417
117 Ga0068863_100333837 3300005841 Bacteria 1474
118 Ga0068858_100152274 3300005842 Bacteria 2175
119 Ga0068858_100199727 3300005842 Bacteria 1890
120 Ga0068860_100179414 3300005843 Bacteria 2047
121 Ga0068860_100306046 3300005843 Bacteria 1558
122 Ga0068860_101469181 3300005843 Bacteria 703
123 Ga0068862_100140171 3300005844 Bacteria 2145
124 Ga0068862_100510650 3300005844 Bacteria 1142
125 Ga0068862_101047838 3300005844 Unclassified 809
126 Ga0068862_102006346 3300005844 Unclassified 589
127 Ga0081455_10000014 3300005937 Bacteria 193884
128 Ga0070717_10000036 3300006028 Bacteria 125184
129 Ga0070717_10184259 3300006028 Bacteria 1821
130 Ga0070717_10766210 3300006028 Bacteria 877
131 Ga0075365_10423370 3300006038 Bacteria 940
132 Ga0075368_10329072 3300006042 Bacteria 663
133 Ga0075364_10535509 3300006051 Bacteria 801
134 Ga0070715_10036392 3300006163 Bacteria 2030
135 Ga0070712_100943231 3300006175 Unclassified 745
136 Ga0075367_10232121 3300006178 Bacteria 1155
137 Ga0075366_10043620 3300006195 Bacteria 2657
138 Ga0097621_100022166 3300006237 Bacteria 4927
139 Ga0075370_10308232 3300006353 Bacteria 942
140 Ga0068871_100037404 3300006358 Bacteria 3870
141 Ga0068871_100367646 3300006358 Bacteria 1275
142 Ga0068871_100915719 3300006358 Bacteria 813
143 Ga0068871_101679453 3300006358 Bacteria 602
144 Ga0075428_100000226 3300006844 Bacteria 54970
145 Ga0075428_100037690 3300006844 Bacteria 5321
146 Ga0075428_100602726 3300006844 Bacteria 1173
147 Ga0075431_100006379 3300006847 Bacteria 11705
148 Ga0075431_100262936 3300006847 Bacteria 1751
149 Ga0075431_101705587 3300006847 Bacteria 587
150 Ga0075433_10351286 3300006852 Bacteria 1303
151 Ga0075433_11047875 3300006852 Unclassified 710
152 Ga0075434_101035319 3300006871 Bacteria 835
153 Ga0075434_102064395 3300006871 Bacteria 575
154 Ga0075434_102507014 3300006871 Unclassified 517
155 Ga0075429_100009079 3300006880 Bacteria 8634
156 Ga0075429_100168158 3300006880 Unclassified 1921
157 Ga0075429_100228242 3300006880 Bacteria 1631
158 Ga0068865_100173611 3300006881 Bacteria 1654
159 Ga0075436_100002922 3300006914 Bacteria 11715
160 Ga0075436_100007186 3300006914 Bacteria 7615
161 Ga0075436_100321208 3300006914 Bacteria 1112
162 Ga0097620_100160684 3300006931 Bacteria 2326
163 Ga0097620_100309240 3300006931 Bacteria 1674
164 Ga0097620_100544981 3300006931 Bacteria 1255
165 Ga0097620_101658379 3300006931 Bacteria 706
166 Ga0099826_10000006 3300006948 Bacteria 432260
167 Ga0075435_102007094 3300007076 Unclassified 508
168 Ga0105240_10551680 3300009093 Bacteria 1275
169 Ga0111539_10000016 3300009094 Bacteria 276730
170 Ga0111539_10002174 3300009094 Bacteria 26216
171 Ga0111539_10007326 3300009094 Bacteria 14127
172 Ga0111539_10843652 3300009094 Bacteria 1066
173 Ga0111539_11160050 3300009094 Unclassified 898
174 Ga0105245_10007823 3300009098 Bacteria 9362
175 Ga0105247_10159095 3300009101 Bacteria 1494
176 Ga0114129_10021544 3300009147 Bacteria 9150
177 Ga0114129_10047439 3300009147 Bacteria 6035
178 Ga0114129_10465416 3300009147 Bacteria 1656
179 Ga0105243_10003699 3300009148 Bacteria 12290
180 Ga0105242_10140337 3300009176 Bacteria 2096
181 Ga0105248_10089155 3300009177 Bacteria 3472
182 Ga0105248_10140343 3300009177 Bacteria 2726
183 Ga0105248_10472666 3300009177 Bacteria 1413
184 Ga0105237_10000012 3300009545 Bacteria 298377
185 Ga0105237_10014196 3300009545 Bacteria 8341
186 Ga0105237_10462738 3300009545 Bacteria 1274
187 Ga0105238_10001720 3300009551 Bacteria 22065
188 Ga0105249_10027997 3300009553 Bacteria 5087
189 Ga0105249_10299259 3300009553 Bacteria 1613
190 Ga0105249_11148901 3300009553 Unclassified 847
191 Ga0105249_11684691 3300009553 Bacteria 707
192 Ga0105239_10358868 3300010375 Bacteria 1646
193 Ga0105239_10756816 3300010375 Bacteria 1112
194 Ga0105246_10073253 3300011119 Bacteria 2418
195 Ga0105246_10399892 3300011119 Bacteria 1140
196 Ga0157373_10648608 3300013100 Bacteria 771
197 Ga0157371_10582264 3300013102 Bacteria 831
198 Ga0157371_10681822 3300013102 Unclassified 768
199 Ga0157370_10002059 3300013104 Bacteria 24637
200 Ga0157370_10002509 3300013104 Bacteria 22106
201 Ga0157369_10003075 3300013105 Bacteria 19928
202 Ga0157369_10004385 3300013105 Bacteria 16661
203 Ga0157378_10043324 3300013297 Bacteria 3996
204 Ga0157378_11152953 3300013297 Bacteria 813
205 Ga0163162_10181697 3300013306 Bacteria 2229
206 Ga0163162_11722967 3300013306 Bacteria 716
207 Ga0157372_10009024 3300013307 Bacteria 10598
208 Ga0157372_10476810 3300013307 Bacteria 1454
209 Ga0157372_11679355 3300013307 Bacteria 731
210 Ga0157375_13625221 3300013308 Unclassified 514
211 Ga0163163_10137363 3300014325 Unclassified 2486
212 Ga0157380_10081622 3300014326 Bacteria 2646
213 Ga0157380_10104985 3300014326 Bacteria 2361
214 Ga0157380_10384922 3300014326 Bacteria 1325
215 Ga0157380_10488406 3300014326 Bacteria 1193
216 Ga0157380_10553702 3300014326 Bacteria 1129
217 Ga0157380_11998069 3300014326 Unclassified 642
218 Ga0157380_12298480 3300014326 Unclassified 604
219 Ga0157380_12340171 3300014326 Bacteria 599
220 Ga0182008_10016812 3300014497 Bacteria 3795
221 Ga0182008_10565645 3300014497 Bacteria 634
222 Ga0157379_10089527 3300014968 Bacteria 2761
223 Ga0157376_10839678 3300014969 Bacteria 933
224 Ga0182006_1000042 3300015261 Bacteria 202969
225 Ga0182007_10066084 3300015262 Bacteria 1184
226 Ga0182005_1000008 3300015265 Bacteria 471394
227 Ga0182005_1008283 3300015265 Bacteria 3071
228 Ga0183367_1004 3300015688 Bacteria 716880
229 Ga0213872_10005586 3300021361 Bacteria 6425
230 Ga0213872_10015310 3300021361 Bacteria 3568
231 Ga0213872_10056966 3300021361 Bacteria 1770
232 Ga0209565_1016569 3300025263 Bacteria 1636
233 Ga0209564_1017872 3300025295 Bacteria 2736
234 Ga0209256_1000035 3300025299 Bacteria 386754
235 Ga0207642_10041913 3300025899 Bacteria 2008
236 Ga0207680_10380949 3300025903 Bacteria 994
237 Ga0207647_10003933 3300025904 Bacteria 11094
238 Ga0207647_10504886 3300025904 Bacteria 674
239 Ga0207685_10280035 3300025905 Bacteria 818
240 Ga0207643_10142358 3300025908 Bacteria 1433
241 Ga0207705_10057917 3300025909 Bacteria 2795
242 Ga0207705_10065434 3300025909 Unclassified 2628
243 Ga0207705_10635643 3300025909 Unclassified 830
244 Ga0207705_10889176 3300025909 Bacteria 690
245 Ga0207654_10618575 3300025911 Bacteria 774
246 Ga0207707_10016645 3300025912 Bacteria 6409
247 Ga0207707_10258464 3300025912 Bacteria 1511
248 Ga0207707_10279185 3300025912 Bacteria 1447
249 Ga0207707_10391968 3300025912 Bacteria 1193
250 Ga0207707_10806817 3300025912 Bacteria 782
251 Ga0207707_11065482 3300025912 Bacteria 660
252 Ga0207695_10298660 3300025913 Bacteria 1502
253 Ga0207671_10000029 3300025914 Bacteria 254968
254 Ga0207671_10007997 3300025914 Bacteria 9056
255 Ga0207671_10678524 3300025914 Unclassified 820
256 Ga0207693_10375686 3300025915 Bacteria 1112
257 Ga0207693_10624526 3300025915 Bacteria 838
258 Ga0207663_11491445 3300025916 Bacteria 544
259 Ga0207660_10000785 3300025917 Bacteria 21106
260 Ga0207660_10038108 3300025917 Bacteria 3355
261 Ga0207660_10174318 3300025917 Bacteria 1667
262 Ga0207660_10198600 3300025917 Bacteria 1566
263 Ga0207660_10367620 3300025917 Bacteria 1155
264 Ga0207662_10042815 3300025918 Bacteria 2670
265 Ga0207662_10444356 3300025918 Bacteria 886
266 Ga0207657_10005066 3300025919 Bacteria 13822
267 Ga0207657_10228271 3300025919 Bacteria 1490
268 Ga0207657_10265115 3300025919 Bacteria 1366
269 Ga0207649_10310279 3300025920 Bacteria 1156
270 Ga0207652_10061822 3300025921 Bacteria 3235
271 Ga0207652_10199441 3300025921 Bacteria 1801
272 Ga0207652_10227272 3300025921 Bacteria 1682
273 Ga0207652_10410038 3300025921 Bacteria 1222
274 Ga0207652_10630206 3300025921 Bacteria 960
275 Ga0207652_11350306 3300025921 Bacteria 616
276 Ga0207681_10839870 3300025923 Bacteria 768
277 Ga0207694_10013044 3300025924 Bacteria 6255
278 Ga0207650_10366683 3300025925 Bacteria 1187
279 Ga0207687_10288662 3300025927 Bacteria 1318
280 Ga0207700_10051893 3300025928 Bacteria 3063
281 Ga0207700_10532336 3300025928 Bacteria 1042
282 Ga0207664_10051484 3300025929 Bacteria 3252
283 Ga0207664_10525446 3300025929 Bacteria 1061
284 Ga0207690_10578793 3300025932 Bacteria 915
285 Ga0207686_10039024 3300025934 Bacteria 2878
286 Ga0207709_10010267 3300025935 Bacteria 5158
287 Ga0207670_10042394 3300025936 Bacteria 2998
288 Ga0207670_10268969 3300025936 Bacteria 1324
289 Ga0207669_10088581 3300025937 Bacteria 2008
290 Ga0207704_10021968 3300025938 Bacteria 3410
291 Ga0207665_10090988 3300025939 Bacteria 2115
292 Ga0207691_10016851 3300025940 Bacteria 6933
293 Ga0207711_10410744 3300025941 Bacteria 1258
294 Ga0207711_10623261 3300025941 Bacteria 1006
295 Ga0207689_10003010 3300025942 Bacteria 15541
296 Ga0207689_10587932 3300025942 Bacteria 936
297 Ga0207661_10010866 3300025944 Bacteria 6570
298 Ga0207661_10478239 3300025944 Bacteria 1137
299 Ga0207661_10912634 3300025944 Bacteria 809
300 Ga0207679_10018197 3300025945 Bacteria 4703
301 Ga0207667_10005066 3300025949 Bacteria 16095
302 Ga0207667_10005792 3300025949 Bacteria 15075
303 Ga0207667_10008709 3300025949 Bacteria 12025
304 Ga0207667_10106081 3300025949 Bacteria 2898
305 Ga0207667_11012733 3300025949 Bacteria 817
306 Ga0207712_10069421 3300025961 Bacteria 2528
307 Ga0207712_10139576 3300025961 Bacteria 1858
308 Ga0207712_11549907 3300025961 Bacteria 594
309 Ga0207640_11097968 3300025981 Bacteria 704
310 Ga0207658_11599948 3300025986 Bacteria 596
311 Ga0207658_11633505 3300025986 Bacteria 589
312 Ga0207677_10363820 3300026023 Bacteria 1216
313 Ga0207703_10051062 3300026035 Bacteria 3349
314 Ga0207703_10175707 3300026035 Bacteria 1887
315 Ga0207639_10000009 3300026041 Bacteria 432727
316 Ga0207639_12153296 3300026041 Bacteria 519
317 Ga0207678_11654541 3300026067 Bacteria 563
318 Ga0207708_10001951 3300026075 Bacteria 15210
319 Ga0207708_11471769 3300026075 Unclassified 598
320 Ga0207702_10065885 3300026078 Bacteria 3103
321 Ga0207702_10218293 3300026078 Bacteria 1776
322 Ga0207641_11610818 3300026088 Unclassified 651
323 Ga0207648_10005501 3300026089 Bacteria 12768
324 Ga0207648_12133391 3300026089 Unclassified 521
325 Ga0207674_10061068 3300026116 Bacteria 3809
326 Ga0207675_100001542 3300026118 Bacteria 23075
327 Ga0207683_10042530 3300026121 Bacteria 3969
328 Ga0207698_10050668 3300026142 Bacteria 3169
329 Ga0207698_10113392 3300026142 Bacteria 2277
330 Ga0209281_1003273 3300027111 Bacteria 5485
331 Ga0209282_1000003 3300027666 Bacteria 856377
332 Ga0207428_10000020 3300027907 Bacteria 276713
333 Ga0207428_10005589 3300027907 Bacteria 11692
334 Ga0207428_10023676 3300027907 Bacteria 5160
335 Ga0207428_10028142 3300027907 Bacteria 4672
336 Ga0268266_10220152 3300028379 Bacteria 1744
337 Ga0268266_10459017 3300028379 Bacteria 1212
338 Ga0268266_10528348 3300028379 Bacteria 1129
339 Ga0268265_10028174 3300028380 Bacteria 4019
340 Ga0268265_10212748 3300028380 Bacteria 1686
341 Ga0268265_10309817 3300028380 Bacteria 1425
342 Ga0268265_10425999 3300028380 Bacteria 1233
343 Ga0268265_10529325 3300028380 Bacteria 1115
344 Ga0268265_10607820 3300028380 Bacteria 1046
345 Ga0268264_10106910 3300028381 Bacteria 2443
346 Ga0268264_10268383 3300028381 Bacteria 1593
347 Ga0268264_11103148 3300028381 Bacteria 802
348 Ga0307515_10131650 3300028794 Bacteria 2750
349 Ga0265338_10028566 3300028800 Bacteria 5558
350 Ga0307509_10081840 3300031507 Bacteria 3333
351 Ga0307408_100003066 3300031548 Bacteria 11529
352 Ga0307408_100298101 3300031548 Bacteria 1349
353 Ga0265313_10220561 3300031595 Bacteria 782
354 Ga0307514_10277457 3300031649 Bacteria 963
355 Ga0307405_10002451 3300031731 Bacteria 8178
356 Ga0307405_10054159 3300031731 Bacteria 2503
357 Ga0307405_10353393 3300031731 Bacteria 1134
358 Ga0307405_10870958 3300031731 Bacteria 760
359 Ga0307405_10875321 3300031731 Bacteria 758
360 Ga0307405_11624257 3300031731 Bacteria 571
361 Ga0307413_10000693 3300031824 Bacteria 11527
362 Ga0307413_10040495 3300031824 Bacteria 2719
363 Ga0307413_10195166 3300031824 Bacteria 1457
364 Ga0307413_10380658 3300031824 Bacteria 1099
365 Ga0307413_10577946 3300031824 Bacteria 916
366 Ga0307413_10776131 3300031824 Bacteria 803
367 Ga0307518_10177492 3300031838 Bacteria 1444
368 Ga0307410_10000242 3300031852 Bacteria 20597
369 Ga0307410_10091729 3300031852 Bacteria 2158
370 Ga0307410_10653981 3300031852 Bacteria 882
371 Ga0307406_10000861 3300031901 Bacteria 17085
372 Ga0307406_10134260 3300031901 Bacteria 1742
373 Ga0307406_10151560 3300031901 Bacteria 1655
374 Ga0307407_10000863 3300031903 Bacteria 10167
375 Ga0307407_10042714 3300031903 Bacteria 2544
376 Ga0307407_10053308 3300031903 Bacteria 2327
377 Ga0307412_10004727 3300031911 Bacteria 7600
378 Ga0307412_10516573 3300031911 Bacteria 997
379 Ga0307412_11016421 3300031911 Unclassified 733
380 Ga0307412_11061513 3300031911 Bacteria 719
381 Ga0307409_100000279 3300031995 Bacteria 20674
382 Ga0307409_100022928 3300031995 Bacteria 4313
383 Ga0307409_100160957 3300031995 Bacteria 1963
384 Ga0307409_100453468 3300031995 Bacteria 1238
385 Ga0307416_100000333 3300032002 Bacteria 24386
386 Ga0307416_100033131 3300032002 Bacteria 3913
387 Ga0307416_100207453 3300032002 Bacteria 1865
388 Ga0307416_100289780 3300032002 Bacteria 1620
389 Ga0307416_101356067 3300032002 Bacteria 817
390 Ga0307416_101366091 3300032002 Bacteria 814
391 Ga0307416_101635456 3300032002 Bacteria 749
392 Ga0307416_102414286 3300032002 Bacteria 625
393 Ga0307416_102622839 3300032002 Bacteria 601
394 Ga0307414_10032339 3300032004 Bacteria 3443
395 Ga0307414_10063787 3300032004 Bacteria 2620
396 Ga0307414_10346838 3300032004 Bacteria 1273
397 Ga0307414_10736238 3300032004 Bacteria 895
398 Ga0307414_11692986 3300032004 Unclassified 590
399 Ga0307411_10000636 3300032005 Bacteria 12721
400 Ga0307411_10032059 3300032005 Bacteria 3243
401 Ga0307411_10111683 3300032005 Bacteria 1957
402 Ga0307411_10468984 3300032005 Bacteria 1057
403 Ga0307411_10702929 3300032005 Unclassified 881
404 Ga0307411_11278700 3300032005 Bacteria 668
405 Ga0307415_100002195 3300032126 Bacteria 9661
406 Ga0307415_100089144 3300032126 Bacteria 2227
407 Ga0307415_100501589 3300032126 Unclassified 1061
408 Ga0307415_100677348 3300032126 Bacteria 928
409 Ga0307415_100760724 3300032126 Bacteria 880
410 Ga0307415_101893297 3300032126 Bacteria 579
411 Ga0373948_0082320 3300034817 Bacteria 736
412 Ga0373934_0150904 3300035086 Bacteria 952
413 Ga0373940_0076869 3300035088 Bacteria 981
414 Ga0373949_0132512 3300035090 Unclassified 708
415 Ga0373952_0006708 3300035092 Bacteria 2136
416 Ga0373952_0171144 3300035092 Bacteria 621
417 Ga0373923_0519553 3300035111 Unclassified 582
418 Ga0373932_0000476 3300035112 Bacteria 12299
419 Ga0373960_0062686 3300035121 Bacteria 1132
420 Ga0373943_0852558 3300035170 Bacteria 543
421 Ga0373946_0373535 3300035171 Bacteria 716
422 Ga0373955_0044590 3300035172 Bacteria 2390
423 Ga0373955_0130994 3300035172 Bacteria 1464
424 Ga0373955_0334499 3300035172 Bacteria 916
425 Ga0373942_0016086 3300035207 Bacteria 1831
426 Ga0373961_0073445 3300035241 Bacteria 1062
427 Ga0373935_0018247 3300035692 Bacteria 4266
428 Ga0373935_0671051 3300035692 Unclassified 761
429 Ga0373927_0244245 3300035695 Bacteria 1180
430 Ga0373927_0318049 3300035695 Bacteria 1025
431 Ga0373927_0480261 3300035695 Bacteria 821
432 Ga0373933_0100729 3300035724 Bacteria 1792
433 Ga0373933_0350557 3300035724 Bacteria 959
434 Ga0373933_0662190 3300035724 Bacteria 686
435 Ga0373937_0057662 3300036401 Bacteria 3568
436 Ga0373937_0078823 3300036401 Bacteria 3045
437 Ga0373937_0099742 3300036401 Bacteria 2694
438 Ga0373937_1764998 3300036401 Bacteria 565
439 Ga0373925_0053750 3300037068 Bacteria 3012
440 Ga0373925_0126901 3300037068 Bacteria 1986
441 Ga0395899_0012086 3300037312 Bacteria 6614
442 Ga0395900_0013169 3300037418 Bacteria 8453
443 Ga0395900_0341037 3300037418 Bacteria 1474
444 Ga0395898_0005775 3300037466 Bacteria 13317
445 Ga0395898_0307138 3300037466 Unclassified 1513
446 Ga0395905_0115299 3300037471 Bacteria 2525
447 Ga0395905_0644266 3300037471 Bacteria 961
448 Ga0395905_1779310 3300037471 Bacteria 522
449 Ga0395901_0035092 3300038443 Bacteria 5183
450 Ga0395901_0038821 3300038443 Bacteria 4925
451 Ga0436365_1454359 3300039437 Bacteria 631
452 Ga0436365_1665182 3300039437 Bacteria 16581
453 Ga0436361_0413757 3300039447 Bacteria 13774
454 Ga0436361_0919867 3300039447 Bacteria 1324
455 Ga0436361_0961791 3300039447 Bacteria 1354
456 Ga0436361_0962333 3300039447 Bacteria 1731
457 Ga0436362_0089214 3300039453 Bacteria 1822
458 Ga0439436_0061058 3300041404 Bacteria 1055
459 Ga0451835_1199059 3300041492 Bacteria 560
460 Ga0450904_005021 3300042139 Bacteria 1355
461 Ga0451577_0505903 3300042876 Bacteria 1097
462 Ga0466972_0048350 3300044658 Bacteria 2055
463 Ga0466982_0125914 3300044672 Bacteria 1579
464 Ga0466965_0046091 3300044683 Bacteria 2157
465 Ga0466965_0554776 3300044683 Bacteria 649
466 Ga0466966_0143183 3300044684 Bacteria 1460
467 Ga0466961_0208207 3300044693 Bacteria 1208
468 Ga0466963_0584106 3300044694 Bacteria 789
469 Ga0466964_0042039 3300044706 Bacteria 1851
470 Ga0466968_0018413 3300044735 Bacteria 2801
471 Ga0466968_0085819 3300044735 Bacteria 1389
472 Ga0466970_0004357 3300044765 Bacteria 6972
473 Ga0466970_0126580 3300044765 Bacteria 1401
474 Ga0466957_0265881 3300044842 Bacteria 1144
475 Ga0466957_1438368 3300044842 Unclassified 502
476 Ga0466960_0089231 3300044901 Bacteria 1568
477 Ga0466960_0351065 3300044901 Bacteria 841
478 Ga0466960_0430497 3300044901 Bacteria 764
479 Ga0466959_0009284 3300045049 Bacteria 6989
480 Ga0451576_0561119 3300045051 Bacteria 1200
481 Ga0466967_0561193 3300045976 Bacteria 1124
482 Ga0466967_1262505 3300045976 Bacteria 736
483 Ga0466967_2570491 3300045976 Bacteria 504
484 Ga0495651_1011169 3300046462 Bacteria 504
485 Ga0495650_0085656 3300046471 Bacteria 1207
486 Ga0495580_0046966 3300046472 Bacteria 3062
487 Ga0495580_0048809 3300046472 Unclassified 2995
488 Ga0495582_0052425 3300046473 Bacteria 2250
489 Ga0495639_0017984 3300046475 Bacteria 3073
490 Ga0495639_0180740 3300046475 Bacteria 1027
491 Ga0495662_0008247 3300046476 Bacteria 5132
492 Ga0495584_0172400 3300046491 Bacteria 1099
493 Ga0495585_0003702 3300046492 Bacteria 10216
494 Ga0495585_0024732 3300046492 Bacteria 3442
495 Ga0495594_0518035 3300046499 Bacteria 677
496 Ga0495596_0033604 3300046500 Bacteria 2040
497 Ga0495607_0131773 3300046501 Bacteria 1300
498 Ga0495607_0275535 3300046501 Bacteria 800
499 Ga0495583_0085190 3300046506 Bacteria 1368
500 Ga0495606_0063614 3300046507 Bacteria 2351
501 Ga0495606_0089158 3300046507 Bacteria 1900
502 Ga0495606_0094953 3300046507 Bacteria 1827
503 Ga0495616_0001048 3300046513 Bacteria 19722
504 Ga0495616_0005059 3300046513 Bacteria 8203
505 Ga0495620_0006267 3300046515 Bacteria 6548
506 Ga0495628_0188683 3300046516 Bacteria 1557
507 Ga0495630_0089205 3300046517 Bacteria 2329
508 Ga0495630_0352729 3300046517 Bacteria 1126
509 Ga0495631_0085548 3300046518 Bacteria 1358
510 Ga0495631_0098152 3300046518 Bacteria 1261
511 Ga0495637_0051051 3300046520 Bacteria 1733
512 Ga0495643_0000003 3300046522 Bacteria 571962
513 Ga0495643_0048489 3300046522 Bacteria 2295
514 Ga0495643_0101005 3300046522 Bacteria 1478
515 Ga0495642_0001678 3300046528 Bacteria 9592
516 Ga0495642_0407943 3300046528 Bacteria 599
517 Ga0495665_0040221 3300046531 Bacteria 2490
518 Ga0495665_0040822 3300046531 Unclassified 2470
519 Ga0495640_0218253 3300046533 Bacteria 1203
520 Ga0495586_0114441 3300046535 Bacteria 1503
521 Ga0495586_0205985 3300046535 Bacteria 1116
522 Ga0495586_0349855 3300046535 Bacteria 849
523 Ga0495609_0001447 3300046538 Bacteria 15768
524 Ga0495609_0014519 3300046538 Bacteria 3700
525 Ga0495609_0027667 3300046538 Bacteria 2590
526 Ga0495609_0216022 3300046538 Bacteria 797
527 Ga0495645_0085696 3300046543 Bacteria 2255
528 Ga0495622_0025563 3300046557 Bacteria 2757
529 Ga0495633_0144813 3300046558 Bacteria 1098
530 Ga0495667_0202268 3300046559 Bacteria 1271
531 Ga0495668_0045789 3300046616 Bacteria 2432
532 Ga0495625_0072250 3300046660 Bacteria 2420
533 Ga0495625_0210218 3300046660 Bacteria 1279
534 Ga0495659_0368303 3300046664 Bacteria 616
535 Ga0495661_0008237 3300046665 Bacteria 7221
536 Ga0495588_0001439 3300046674 Bacteria 10183
537 Ga0495623_0152070 3300046679 Bacteria 1367
538 Ga0495647_0084956 3300046681 Bacteria 1289
539 Ga0495669_0562547 3300046684 Bacteria 555
540 Ga0495624_0078271 3300046690 Bacteria 2051
541 Ga0495649_0008250 3300046694 Bacteria 6276
542 Ga0495600_0237151 3300046809 Unclassified 1163
543 Ga0495660_0000242 3300046810 Bacteria 53380
544 Ga0495660_0033648 3300046810 Bacteria 2872
545 Ga0495581_0005859 3300047315 Bacteria 7124
546 Ga0495581_0379129 3300047315 Bacteria 825
547 Ga0495636_0069911 3300047318 Bacteria 1497
548 Ga0495672_0104581 3300047320 Bacteria 1529
549 Ga0495676_0344903 3300047321 Bacteria 996
550 Ga0495683_0011331 3300047323 Bacteria 4693
551 Ga0495683_0117254 3300047323 Bacteria 1266
552 Ga0495687_009802 3300047443 Bacteria 5320
553 Ga0495677_0112296 3300047445 Bacteria 1036
554 Ga0495677_0411927 3300047445 Bacteria 535
555 Ga0495673_0028104 3300047469 Bacteria 2667
556 Ga0495681_0022790 3300047470 Bacteria 3342
557 Ga0495684_0866906 3300047471 Bacteria 584
558 Ga0495686_0000248 3300047472 Bacteria 97017
559 Ga0495686_0013673 3300047472 Bacteria 5625
560 Ga0495686_0017927 3300047472 Bacteria 4761
561 Ga0495593_0151598 3300047673 Bacteria 1172
562 Ga0495626_0001949 3300048091 Bacteria 15326
563 Ga0495626_0008173 3300048091 Bacteria 5764
564 Ga0495626_0043126 3300048091 Bacteria 2117
565 Ga0496103_0551870 3300048906 Bacteria 735
566 Ga0496106_0119194 3300048909 Bacteria 2061
567 Ga0496107_0059826 3300048910 Bacteria 2757
568 Ga0496108_0326256 3300048911 Bacteria 1338
569 Ga0496109_0615155 3300048912 Bacteria 1023
570 Ga0496110_1659174 3300048913 Bacteria 549
571 Ga0496111_0303297 3300048914 Bacteria 1184
572 Ga0496112_0155062 3300048915 Bacteria 2257
573 Ga0496112_0511336 3300048915 Unclassified 1136
574 Ga0496112_1065537 3300048915 Unclassified 727
575 Ga0496113_1335573 3300048916 Bacteria 557
576 Ga0496115_0018283 3300048918 Bacteria 5378
577 Ga0496115_0266424 3300048918 Bacteria 1408
578 Ga0496121_0204466 3300048924 Bacteria 1404
579 Ga0496121_0249130 3300048924 Bacteria 1233
580 Ga0496124_0359823 3300048927 Bacteria 1026
581 Ga0496126_0004368 3300048929 Bacteria 16944
582 Ga0496126_0050763 3300048929 Bacteria 3779
583 Ga0495682_0108932 3300049460 Bacteria 993
584 Ga0501298_072821 3300049521 Bacteria 744
585 Ga0501299_023212 3300049522 Bacteria 1149
586 Ga0501031_0226213 3300049568 Bacteria 1218
587 Ga0501033_0039232 3300049570 Bacteria 3538
588 Ga0501034_0224227 3300049571 Bacteria 1831
589 Ga0501036_1637746 3300049572 Bacteria 519
590 Ga0501037_0364354 3300049573 Bacteria 995
591 Ga0501037_0474592 3300049573 Bacteria 851
592 Ga0501038_0229997 3300049574 Bacteria 1476
593 Ga0501038_0233076 3300049574 Bacteria 1464
594 Ga0501040_0128227 3300049576 Bacteria 1783
595 Ga0501041_0054609 3300049577 Bacteria 2437
596 Ga0501042_0549657 3300049578 Bacteria 839
597 Ga0501042_1021540 3300049578 Bacteria 603
598 Ga0501042_1420586 3300049578 Unclassified 506
599 Ga0501043_0011457 3300049579 Bacteria 6943
600 Ga0501046_0534663 3300049580 Bacteria 837
601 Ga0501047_0011388 3300049581 Bacteria 8419
602 Ga0501048_0361752 3300049582 Bacteria 1035
603 Ga0501048_0518057 3300049582 Bacteria 855
604 Ga0501048_1029393 3300049582 Bacteria 592
605 Ga0501067_0016178 3300049583 Bacteria 4123
606 Ga0501068_0033811 3300049584 Bacteria 3047
607 Ga0501069_0010953 3300049585 Bacteria 4808
608 Ga0501071_0038701 3300049587 Bacteria 3408
609 Ga0501071_0274640 3300049587 Bacteria 1275
610 Ga0501072_0014673 3300049588 Bacteria 6007
611 Ga0501073_0493563 3300049589 Bacteria 847
612 Ga0501074_0602050 3300049590 Bacteria 777
613 Ga0501075_0282236 3300049591 Bacteria 1265
614 Ga0501075_0511686 3300049591 Bacteria 916
615 Ga0501075_0831753 3300049591 Bacteria 702
616 Ga0501076_0011033 3300049592 Bacteria 6719
617 Ga0501076_0600862 3300049592 Bacteria 908
618 Ga0501077_0313826 3300049593 Bacteria 999
619 Ga0501238_005001 3300049671 Bacteria 1670
620 Ga0501238_059615 3300049671 Bacteria 581
621 Ga0501243_104276 3300049675 Bacteria 575
622 Ga0501225_0140280 3300049705 Bacteria 730
623 Ga0501079_0101306 3300049741 Bacteria 2233
624 Ga0501080_0060591 3300049742 Bacteria 3523
625 Ga0501080_1296376 3300049742 Bacteria 624
626 Ga0501081_0146581 3300049743 Bacteria 1694
627 Ga0501081_0644794 3300049743 Bacteria 794
628 Ga0501083_0441284 3300049744 Bacteria 847
629 Ga0501274_010619 3300049771 Bacteria 851
630 Ga0501035_0572788 3300049822 Bacteria 923
631 Ga0501044_0007782 3300049823 Bacteria 11779
632 Ga0501044_0082060 3300049823 Bacteria 3263
633 Ga0501044_0084088 3300049823 Bacteria 3216
634 Ga0501045_0018451 3300049824 Bacteria 4963
635 nmdc:mga03n38_13122_c1 3300050490 Bacteria 3138
636 nmdc:mga0k408_117871_c1 3300050493 Bacteria 1571
637 nmdc:mga0k408_45001_c1 3300050493 Bacteria 2546
638 nmdc:mga0k408_645346_c1 3300050493 Bacteria 623
639 nmdc:mga06z11_17838_c1 3300050494 Bacteria 3231
640 nmdc:mga07m45_164537_c1 3300050496 Bacteria 1288
641 nmdc:mga05p37_227110_c1 3300050507 Bacteria 2250
642 nmdc:mga05p37_7832_c1 3300050507 Bacteria 12609
643 nmdc:mga09592_244908_c1 3300050508 Bacteria 1554
644 nmdc:mga09592_35837_c1 3300050508 Bacteria 4154
645 nmdc:mga09592_4810_c1 3300050508 Bacteria 10942
646 nmdc:mga09592_552247_c1 3300050508 Bacteria 989
647 nmdc:mga0qj67_24235_c1 3300050509 Bacteria 4676
648 nmdc:mga0qj67_258942_c1 3300050509 Bacteria 1411
649 nmdc:mga0qj67_549092_c1 3300050509 Unclassified 927
650 nmdc:mga06r32_1045755_c1 3300050510 Bacteria 767
651 nmdc:mga06r32_111503_c1 3300050510 Bacteria 2692
652 nmdc:mga06r32_196731_c1 3300050510 Bacteria 2003
653 nmdc:mga06r32_222353_c1 3300050510 Bacteria 1876
654 nmdc:mga06r32_64417_c1 3300050510 Bacteria 3535
655 nmdc:mga08y16_194887_c1 3300050511 Bacteria 2101
656 nmdc:mga08y16_20_c1 3300050511 Bacteria 276739
657 nmdc:mga08y16_43855_c1 3300050511 Unclassified 4687
658 nmdc:mga08y16_5750_c1 3300050511 Bacteria 12989
659 nmdc:mga08y16_90986_c1 3300050511 Bacteria 3180
660 nmdc:mga0n895_1036639_c1 3300050512 Bacteria 800
661 nmdc:mga0n895_1155057_c1 3300050512 Bacteria 750
662 nmdc:mga0rr50_1129999_c1 3300050513 Unclassified 666
663 nmdc:mga0rr50_633402_c1 3300050513 Bacteria 912
664 nmdc:mga08x19_506259_c1 3300050514 Unclassified 853
665 nmdc:mga08x19_506665_c1 3300050514 Bacteria 852
666 nmdc:mga08x19_5223_c1 3300050514 Bacteria 7683
667 nmdc:mga0a205_360817_c1 3300050515 Bacteria 1320
668 Ga0495612_0248505 3300053078 Bacteria 791
669 Ga0495619_0038766 3300053085 Bacteria 3109
670 Ga0495619_0049522 3300053085 Bacteria 2771
671 Ga0500618_001550 3300053125 Bacteria 10053
672 Ga0500559_0207376 3300053136 Bacteria 924
673 Ga0500559_0246455 3300053136 Bacteria 842
674 Ga0500568_0019210 3300053139 Bacteria 2975
675 Ga0500568_0030978 3300053139 Bacteria 2211
676 Ga0500603_181108 3300053150 Bacteria 663
677 Ga0500604_0035556 3300053151 Bacteria 1483
678 Ga0500616_0030617 3300053153 Bacteria 2954
679 Ga0500639_322944 3300053163 Bacteria 564
680 Ga0500636_0079908 3300053177 Bacteria 1885
681 Ga0501084_0267769 3300054114 Bacteria 1442
682 Ga0501082_0119246 3300060353 Bacteria 2286
683 Ga0501082_1701048 3300060353 Bacteria 550
684 Ga0530510_0004920 3300061734 Bacteria 9230

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0061058 Ga0439436_0061058_279_641 113
2 3300005546 Ga0070696_101132939 Ga0070696_1011329391 115
3 3300006914 Ga0075436_100321208 Ga0075436_1003212082 115
4 3300025941 Ga0207711_10623261 Ga0207711_106232612 115
5 3300045051 Ga0451576_0561119 Ga0451576_0561119_154_501 115
6 3300005340 Ga0070689_100169672 Ga0070689_1001696722 117
7 3300005353 Ga0070669_100596968 Ga0070669_1005969682 117
8 3300005356 Ga0070674_100364042 Ga0070674_1003640422 117
9 3300005364 Ga0070673_100218708 Ga0070673_1002187083 117
10 3300005365 Ga0070688_100141103 Ga0070688_1001411032 117
11 3300005456 Ga0070678_100197526 Ga0070678_1001975262 117
12 3300005466 Ga0070685_10017590 Ga0070685_100175906 117
13 3300005543 Ga0070672_100015776 Ga0070672_1000157763 117
14 3300005548 Ga0070665_100916454 Ga0070665_1009164542 117
15 3300005577 Ga0068857_100044553 Ga0068857_1000445534 117
16 3300005617 Ga0068859_100160678 Ga0068859_1001606783 117
17 3300006931 Ga0097620_100160684 Ga0097620_1001606843 117
18 3300025923 Ga0207681_10839870 Ga0207681_108398701 117
19 3300025936 Ga0207670_10268969 Ga0207670_102689692 117
20 3300025937 Ga0207669_10088581 Ga0207669_100885813 117
21 3300025940 Ga0207691_10016851 Ga0207691_100168513 117
22 3300026116 Ga0207674_10061068 Ga0207674_100610685 117
23 3300028379 Ga0268266_10528348 Ga0268266_105283483 117
24 3300050493 nmdc:mga0k408_645346_c1 nmdc:mga0k408_645346_c1_228_590 117
25 3300005343 Ga0070687_100857239 Ga0070687_1008572391 118
26 3300037068 Ga0373925_0053750 Ga0373925_0053750_333_713 118
27 3300006847 Ga0075431_101705587 Ga0075431_1017055872 120
28 3300039447 Ga0436361_0961791 Ga0436361_0961791_631_1008 124
29 3300005547 Ga0070693_100161055 Ga0070693_1001610552 125
30 3300005843 Ga0068860_101469181 Ga0068860_1014691812 125
31 3300006358 Ga0068871_100367646 Ga0068871_1003676463 125
32 3300013102 Ga0157371_10582264 Ga0157371_105822642 125
33 3300028381 Ga0268264_11103148 Ga0268264_111031482 125
34 3300045976 Ga0466967_1262505 Ga0466967_1262505_206_613 125
35 3300005327 Ga0070658_10104538 Ga0070658_101045381 126
36 3300005339 Ga0070660_100003463 Ga0070660_1000034637 126
37 3300005347 Ga0070668_100833351 Ga0070668_1008333512 126
38 3300005530 Ga0070679_100345386 Ga0070679_1003453862 126
39 3300005543 Ga0070672_101504176 Ga0070672_1015041762 126
40 3300006844 Ga0075428_100000226 Ga0075428_10000022615 126
41 3300006847 Ga0075431_100006379 Ga0075431_10000637911 126
42 3300006880 Ga0075429_100009079 Ga0075429_1000090797 126
43 3300009094 Ga0111539_10002174 Ga0111539_100021748 126
44 3300009147 Ga0114129_10021544 Ga0114129_100215448 126
45 3300013104 Ga0157370_10002509 Ga0157370_100025096 126
46 3300013307 Ga0157372_10476810 Ga0157372_104768102 126
47 3300013308 Ga0157375_13625221 Ga0157375_136252212 126
48 3300021361 Ga0213872_10056966 Ga0213872_100569662 126
49 3300025912 Ga0207707_10806817 Ga0207707_108068172 126
50 3300025919 Ga0207657_10005066 Ga0207657_100050662 126
51 3300025921 Ga0207652_10227272 Ga0207652_102272723 126
52 3300025932 Ga0207690_10578793 Ga0207690_105787932 126
53 3300025986 Ga0207658_11599948 Ga0207658_115999481 126
54 3300027907 Ga0207428_10023676 Ga0207428_100236763 126
55 3300032002 Ga0307416_102414286 Ga0307416_1024142862 126
56 3300032004 Ga0307414_11692986 Ga0307414_116929862 126
57 3300039447 Ga0436361_0919867 Ga0436361_0919867_820_1218 126
58 3300039453 Ga0436362_0089214 Ga0436362_0089214_1016_1414 126
59 3300044842 Ga0466957_0265881 Ga0466957_0265881_77_508 126
60 3300050507 nmdc:mga05p37_7832_c1 nmdc:mga05p37_7832_c1_6823_7227 126
61 3300050508 nmdc:mga09592_4810_c1 nmdc:mga09592_4810_c1_5832_6236 126
62 3300050510 nmdc:mga06r32_64417_c1 nmdc:mga06r32_64417_c1_973_1377 126
63 3300050511 nmdc:mga08y16_5750_c1 nmdc:mga08y16_5750_c1_5496_5900 126
64 3300006914 Ga0075436_100002922 Ga0075436_1000029229 127
65 3300021361 Ga0213872_10015310 Ga0213872_100153103 127
66 3300032005 Ga0307411_10702929 Ga0307411_107029292 127
67 3300032126 Ga0307415_100501589 Ga0307415_1005015892 127
68 3300039447 Ga0436361_0413757 Ga0436361_0413757_11912_12316 127
69 3300050514 nmdc:mga08x19_5223_c1 nmdc:mga08x19_5223_c1_4115_4501 127
70 iso_pu_bacteria 2856741275 2856742999 127
71 iso_pu_bacteria 2891562705 2891563565 127
72 3300005328 Ga0070676_10813073 Ga0070676_108130732 128
73 3300005330 Ga0070690_100014098 Ga0070690_1000140986 128
74 3300005334 Ga0068869_100172038 Ga0068869_1001720382 128
75 3300005336 Ga0070680_100413854 Ga0070680_1004138542 128
76 3300005338 Ga0068868_100434416 Ga0068868_1004344162 128
77 3300005340 Ga0070689_100006738 Ga0070689_1000067386 128
78 3300005345 Ga0070692_10046431 Ga0070692_100464312 128
79 3300005438 Ga0070701_10111036 Ga0070701_101110362 128
80 3300005440 Ga0070705_100150530 Ga0070705_1001505303 128
81 3300005441 Ga0070700_100002626 Ga0070700_1000026266 128
82 3300005444 Ga0070694_100540157 Ga0070694_1005401572 128
83 3300005456 Ga0070678_100028309 Ga0070678_1000283093 128
84 3300005459 Ga0068867_100028822 Ga0068867_1000288223 128
85 3300005466 Ga0070685_10237829 Ga0070685_102378293 128
86 3300005544 Ga0070686_100012542 Ga0070686_1000125424 128
87 3300005545 Ga0070695_100110679 Ga0070695_1001106791 128
88 3300005546 Ga0070696_100204993 Ga0070696_1002049933 128
89 3300005547 Ga0070693_100197798 Ga0070693_1001977982 128
90 3300005549 Ga0070704_100657034 Ga0070704_1006570342 128
91 3300005615 Ga0070702_100001989 Ga0070702_1000019894 128
92 3300005718 Ga0068866_10007387 Ga0068866_100073878 128
93 3300005719 Ga0068861_100007885 Ga0068861_1000078854 128
94 3300005840 Ga0068870_10139494 Ga0068870_101394942 128
95 3300005842 Ga0068858_100199727 Ga0068858_1001997272 128
96 3300005843 Ga0068860_100179414 Ga0068860_1001794142 128
97 3300005844 Ga0068862_100140171 Ga0068862_1001401712 128
98 3300006237 Ga0097621_100022166 Ga0097621_1000221665 128
99 3300006358 Ga0068871_100037404 Ga0068871_1000374047 128
100 3300006881 Ga0068865_100173611 Ga0068865_1001736112 128
101 3300009098 Ga0105245_10007823 Ga0105245_100078235 128
102 3300009148 Ga0105243_10003699 Ga0105243_100036994 128
103 3300009176 Ga0105242_10140337 Ga0105242_101403372 128
104 3300009177 Ga0105248_10089155 Ga0105248_100891551 128
105 3300009553 Ga0105249_10027997 Ga0105249_100279974 128
106 3300011119 Ga0105246_10399892 Ga0105246_103998922 128
107 3300013297 Ga0157378_10043324 Ga0157378_100433244 128
108 3300013306 Ga0163162_10181697 Ga0163162_101816973 128
109 3300014326 Ga0157380_10384922 Ga0157380_103849222 128
110 3300014968 Ga0157379_10089527 Ga0157379_100895271 128
111 3300014969 Ga0157376_10839678 Ga0157376_108396781 128
112 3300025899 Ga0207642_10041913 Ga0207642_100419133 128
113 3300025908 Ga0207643_10142358 Ga0207643_101423582 128
114 3300025917 Ga0207660_10038108 Ga0207660_100381082 128
115 3300025918 Ga0207662_10042815 Ga0207662_100428152 128
116 3300025927 Ga0207687_10288662 Ga0207687_102886622 128
117 3300025934 Ga0207686_10039024 Ga0207686_100390245 128
118 3300025935 Ga0207709_10010267 Ga0207709_100102673 128
119 3300025936 Ga0207670_10042394 Ga0207670_100423941 128
120 3300025938 Ga0207704_10021968 Ga0207704_100219682 128
121 3300025942 Ga0207689_10003010 Ga0207689_1000301011 128
122 3300025961 Ga0207712_10069421 Ga0207712_100694211 128
123 3300026023 Ga0207677_10363820 Ga0207677_103638202 128
124 3300026035 Ga0207703_10051062 Ga0207703_100510622 128
125 3300026075 Ga0207708_10001951 Ga0207708_1000195111 128
126 3300026089 Ga0207648_10005501 Ga0207648_1000550110 128
127 3300026118 Ga0207675_100001542 Ga0207675_10000154214 128
128 3300026121 Ga0207683_10042530 Ga0207683_100425303 128
129 3300028380 Ga0268265_10028174 Ga0268265_100281747 128
130 3300028381 Ga0268264_10106910 Ga0268264_101069101 128
131 3300032126 Ga0307415_101893297 Ga0307415_1018932971 128
132 3300044842 Ga0466957_1438368 Ga0466957_1438368_40_447 128
133 3300046664 Ga0495659_0368303 Ga0495659_0368303_159_575 128
134 iso_pu_bacteria 2895427314 2895431686 128
135 3300003775 Ga0055524_1000053 Ga0055524_100005334 129
136 3300003911 JGI25405J52794_10006918 JGI25405J52794_100069183 129
137 3300005937 Ga0081455_10000014 Ga0081455_10000014137 129
138 3300025915 Ga0207693_10375686 Ga0207693_103756862 129
139 3300025917 Ga0207660_10367620 Ga0207660_103676201 129
140 3300044706 Ga0466964_0042039 Ga0466964_0042039_990_1430 129
141 3300048927 Ga0496124_0359823 Ga0496124_0359823_11_412 129
142 iso_pu_bacteria 2511231026 2511387479 129
143 iso_pu_bacteria 2818991449 2819617801 129
144 iso_pu_bacteria 2857558681 2857562859 129
145 iso_pu_bacteria 2919046199 2919050408 129
146 3300005577 Ga0068857_101643573 Ga0068857_1016435732 130
147 3300025921 Ga0207652_11350306 Ga0207652_113503062 130
148 3300038443 Ga0395901_0035092 Ga0395901_0035092_2032_2439 130
149 3300044693 Ga0466961_0208207 Ga0466961_0208207_258_662 130
150 3300048915 Ga0496112_1065537 Ga0496112_1065537_245_646 130
151 iso_pu_bacteria 2643221645 2644252805 130
152 iso_pu_bacteria 2643221664 2644355150 130
153 iso_pu_bacteria 2889306138 2889307467 130
154 3300003322 rootL2_10030680 rootL2_100306802 131
155 3300005327 Ga0070658_10229931 Ga0070658_102299312 131
156 3300014326 Ga0157380_10553702 Ga0157380_105537022 131
157 3300031731 Ga0307405_11624257 Ga0307405_116242572 131
158 3300031911 Ga0307412_11061513 Ga0307412_110615132 131
159 3300032002 Ga0307416_101366091 Ga0307416_1013660912 131
160 3300032002 Ga0307416_101635456 Ga0307416_1016354562 131
161 3300039437 Ga0436365_1454359 Ga0436365_1454359_33_428 131
162 3300046475 Ga0495639_0180740 Ga0495639_0180740_411_806 131
163 3300046476 Ga0495662_0008247 Ga0495662_0008247_3595_3990 131
164 3300046516 Ga0495628_0188683 Ga0495628_0188683_482_877 131
165 3300046517 Ga0495630_0089205 Ga0495630_0089205_1199_1594 131
166 3300046520 Ga0495637_0051051 Ga0495637_0051051_834_1292 131
167 3300046533 Ga0495640_0218253 Ga0495640_0218253_456_851 131
168 3300046535 Ga0495586_0114441 Ga0495586_0114441_389_784 131
169 3300046681 Ga0495647_0084956 Ga0495647_0084956_757_1152 131
170 3300046690 Ga0495624_0078271 Ga0495624_0078271_1478_1873 131
171 3300047315 Ga0495581_0379129 Ga0495581_0379129_376_771 131
172 3300047321 Ga0495676_0344903 Ga0495676_0344903_384_779 131
173 3300047471 Ga0495684_0866906 Ga0495684_0866906_61_456 131
174 3300047673 Ga0495593_0151598 Ga0495593_0151598_584_979 131
175 3300048091 Ga0495626_0001949 Ga0495626_0001949_8093_8551 131
176 3300053078 Ga0495612_0248505 Ga0495612_0248505_137_532 131
177 iso_pu_bacteria 2857553236 2857557455 131
178 iso_pu_bacteria 2857564685 2857567205 131
179 iso_pu_bacteria 2862281513 2862287655 131
180 iso_pu_bacteria 2877676314 2877683733 131
181 iso_pu_bacteria 2919468124 2919473779 131
182 3300005458 Ga0070681_10702081 Ga0070681_107020812 132
183 3300005530 Ga0070679_101217493 Ga0070679_1012174931 132
184 3300005535 Ga0070684_100004937 Ga0070684_10000493711 132
185 3300005563 Ga0068855_100019512 Ga0068855_1000195126 132
186 3300005578 Ga0068854_100014453 Ga0068854_1000144533 132
187 3300006844 Ga0075428_100037690 Ga0075428_1000376904 132
188 3300006914 Ga0075436_100007186 Ga0075436_1000071866 132
189 3300009545 Ga0105237_10014196 Ga0105237_100141966 132
190 3300014497 Ga0182008_10565645 Ga0182008_105656452 132
191 3300021361 Ga0213872_10005586 Ga0213872_100055863 132
192 3300025912 Ga0207707_10279185 Ga0207707_102791852 132
193 3300025914 Ga0207671_10007997 Ga0207671_100079975 132
194 3300025916 Ga0207663_11491445 Ga0207663_114914451 132
195 3300025944 Ga0207661_10010866 Ga0207661_100108666 132
196 3300025945 Ga0207679_10018197 Ga0207679_100181973 132
197 3300025949 Ga0207667_10008709 Ga0207667_100087096 132
198 3300028800 Ga0265338_10028566 Ga0265338_100285666 132
199 3300031507 Ga0307509_10081840 Ga0307509_100818404 132
200 3300031595 Ga0265313_10220561 Ga0265313_102205612 132
201 3300031731 Ga0307405_10054159 Ga0307405_100541594 132
202 3300031824 Ga0307413_10776131 Ga0307413_107761311 132
203 3300031852 Ga0307410_10091729 Ga0307410_100917291 132
204 3300031901 Ga0307406_10134260 Ga0307406_101342603 132
205 3300031903 Ga0307407_10042714 Ga0307407_100427143 132
206 3300032005 Ga0307411_11278700 Ga0307411_112787002 132
207 3300032126 Ga0307415_100760724 Ga0307415_1007607242 132
208 3300035086 Ga0373934_0150904 Ga0373934_0150904_133_555 132
209 3300035172 Ga0373955_0130994 Ga0373955_0130994_913_1311 132
210 3300035692 Ga0373935_0018247 Ga0373935_0018247_2475_2873 132
211 3300035695 Ga0373927_0480261 Ga0373927_0480261_135_533 132
212 3300035724 Ga0373933_0350557 Ga0373933_0350557_285_683 132
213 3300036401 Ga0373937_0078823 Ga0373937_0078823_1768_2166 132
214 3300037312 Ga0395899_0012086 Ga0395899_0012086_6047_6445 132
215 3300037418 Ga0395900_0013169 Ga0395900_0013169_2336_2734 132
216 3300037466 Ga0395898_0005775 Ga0395898_0005775_7422_7820 132
217 3300037471 Ga0395905_1779310 Ga0395905_1779310_53_460 132
218 3300038443 Ga0395901_0038821 Ga0395901_0038821_846_1244 132
219 3300039447 Ga0436361_0962333 Ga0436361_0962333_196_594 132
220 3300044765 Ga0466970_0126580 Ga0466970_0126580_267_677 132
221 3300045049 Ga0466959_0009284 Ga0466959_0009284_6307_6717 132
222 3300046543 Ga0495645_0085696 Ga0495645_0085696_1718_2125 132
223 3300048924 Ga0496121_0249130 Ga0496121_0249130_613_1023 132
224 3300049578 Ga0501042_1021540 Ga0501042_1021540_184_582 132
225 3300049742 Ga0501080_1296376 Ga0501080_1296376_106_504 132
226 3300049823 Ga0501044_0082060 Ga0501044_0082060_830_1240 132
227 3300050513 nmdc:mga0rr50_1129999_c1 nmdc:mga0rr50_1129999_c1_35_439 132
228 3300050514 nmdc:mga08x19_506259_c1 nmdc:mga08x19_506259_c1_93_497 132
229 3300053125 Ga0500618_001550 Ga0500618_001550_9536_9946 132
230 3300060353 Ga0501082_0119246 Ga0501082_0119246_1583_1981 132
231 3300061734 Ga0530510_0004920 Ga0530510_0004920_4416_4814 132
232 iso_pu_bacteria 2811994917 2812479038 132
233 3300005459 Ga0068867_101173629 Ga0068867_1011736291 133
234 3300005471 Ga0070698_100251978 Ga0070698_1002519782 133
235 3300005844 Ga0068862_101047838 Ga0068862_1010478381 133
236 3300006028 Ga0070717_10184259 Ga0070717_101842593 133
237 3300006852 Ga0075433_11047875 Ga0075433_110478751 133
238 3300006871 Ga0075434_102507014 Ga0075434_1025070141 133
239 3300006880 Ga0075429_100168158 Ga0075429_1001681583 133
240 3300007076 Ga0075435_102007094 Ga0075435_1020070941 133
241 3300009094 Ga0111539_10000016 Ga0111539_1000001634 133
242 3300009094 Ga0111539_10843652 Ga0111539_108436522 133
243 3300009094 Ga0111539_11160050 Ga0111539_111600502 133
244 3300009147 Ga0114129_10465416 Ga0114129_104654162 133
245 3300009553 Ga0105249_11148901 Ga0105249_111489011 133
246 3300014326 Ga0157380_10488406 Ga0157380_104884062 133
247 3300014326 Ga0157380_11998069 Ga0157380_119980692 133
248 3300025961 Ga0207712_10139576 Ga0207712_101395763 133
249 3300026075 Ga0207708_11471769 Ga0207708_114717692 133
250 3300026089 Ga0207648_12133391 Ga0207648_121333911 133
251 3300027907 Ga0207428_10000020 Ga0207428_1000002034 133
252 3300027907 Ga0207428_10005589 Ga0207428_100055898 133
253 3300028380 Ga0268265_10425999 Ga0268265_104259993 133
254 3300035112 Ga0373932_0000476 Ga0373932_0000476_754_1158 133
255 3300046538 Ga0495609_0027667 Ga0495609_0027667_963_1427 133
256 3300046660 Ga0495625_0072250 Ga0495625_0072250_767_1231 133
257 3300046674 Ga0495588_0001439 Ga0495588_0001439_5691_6155 133
258 3300047472 Ga0495686_0000248 Ga0495686_0000248_46470_46886 133
259 3300047472 Ga0495686_0017927 Ga0495686_0017927_1661_2062 133
260 3300048091 Ga0495626_0008173 Ga0495626_0008173_3773_4237 133
261 3300048913 Ga0496110_1659174 Ga0496110_1659174_123_530 133
262 3300050507 nmdc:mga05p37_227110_c1 nmdc:mga05p37_227110_c1_1836_2237 133
263 3300050508 nmdc:mga09592_35837_c1 nmdc:mga09592_35837_c1_3656_4057 133
264 3300050511 nmdc:mga08y16_20_c1 nmdc:mga08y16_20_c1_32037_32438 133
265 3300050511 nmdc:mga08y16_43855_c1 nmdc:mga08y16_43855_c1_4003_4404 133
266 iso_pu_bacteria 2883087390 2883087393 133
267 3300005262 Ga0065165_1116071 Ga0065165_11160712 134
268 3300005327 Ga0070658_10230195 Ga0070658_102301951 134
269 3300005329 Ga0070683_100945281 Ga0070683_1009452812 134
270 3300005331 Ga0070670_101342121 Ga0070670_1013421211 134
271 3300005334 Ga0068869_100570631 Ga0068869_1005706312 134
272 3300005336 Ga0070680_100003184 Ga0070680_1000031849 134
273 3300005336 Ga0070680_100120036 Ga0070680_1001200362 134
274 3300005336 Ga0070680_100275800 Ga0070680_1002758001 134
275 3300005337 Ga0070682_100269085 Ga0070682_1002690852 134
276 3300005339 Ga0070660_100166220 Ga0070660_1001662203 134
277 3300005344 Ga0070661_100361850 Ga0070661_1003618502 134
278 3300005354 Ga0070675_100811582 Ga0070675_1008115822 134
279 3300005364 Ga0070673_100025140 Ga0070673_1000251404 134
280 3300005364 Ga0070673_101147492 Ga0070673_1011474921 134
281 3300005366 Ga0070659_100125288 Ga0070659_1001252883 134
282 3300005366 Ga0070659_101353396 Ga0070659_1013533962 134
283 3300005435 Ga0070714_100099223 Ga0070714_1000992233 134
284 3300005436 Ga0070713_100260801 Ga0070713_1002608013 134
285 3300005438 Ga0070701_10760553 Ga0070701_107605532 134
286 3300005439 Ga0070711_100945710 Ga0070711_1009457102 134
287 3300005441 Ga0070700_100016842 Ga0070700_1000168423 134
288 3300005441 Ga0070700_101075440 Ga0070700_1010754402 134
289 3300005455 Ga0070663_101087340 Ga0070663_1010873401 134
290 3300005458 Ga0070681_10116648 Ga0070681_101166483 134
291 3300005458 Ga0070681_10270923 Ga0070681_102709232 134
292 3300005466 Ga0070685_10016541 Ga0070685_100165414 134
293 3300005466 Ga0070685_10543773 Ga0070685_105437731 134
294 3300005530 Ga0070679_100026857 Ga0070679_1000268573 134
295 3300005530 Ga0070679_100029361 Ga0070679_1000293615 134
296 3300005530 Ga0070679_100038082 Ga0070679_1000380825 134
297 3300005530 Ga0070679_100041268 Ga0070679_1000412686 134
298 3300005530 Ga0070679_100825197 Ga0070679_1008251972 134
299 3300005535 Ga0070684_101278260 Ga0070684_1012782602 134
300 3300005544 Ga0070686_100351496 Ga0070686_1003514962 134
301 3300005548 Ga0070665_100002550 Ga0070665_10000255010 134
302 3300005548 Ga0070665_102070826 Ga0070665_1020708261 134
303 3300005563 Ga0068855_100001103 Ga0068855_1000011039 134
304 3300005563 Ga0068855_100008079 Ga0068855_1000080799 134
305 3300005563 Ga0068855_100033873 Ga0068855_1000338734 134
306 3300005564 Ga0070664_100432787 Ga0070664_1004327872 134
307 3300005577 Ga0068857_100552029 Ga0068857_1005520292 134
308 3300005577 Ga0068857_100599601 Ga0068857_1005996011 134
309 3300005578 Ga0068854_101551260 Ga0068854_1015512601 134
310 3300005614 Ga0068856_100155196 Ga0068856_1001551963 134
311 3300005614 Ga0068856_100463843 Ga0068856_1004638432 134
312 3300005616 Ga0068852_100264107 Ga0068852_1002641073 134
313 3300005616 Ga0068852_100689139 Ga0068852_1006891392 134
314 3300005617 Ga0068859_100309242 Ga0068859_1003092422 134
315 3300005617 Ga0068859_100544978 Ga0068859_1005449782 134
316 3300005618 Ga0068864_101197904 Ga0068864_1011979042 134
317 3300005719 Ga0068861_101979189 Ga0068861_1019791892 134
318 3300005841 Ga0068863_100333837 Ga0068863_1003338372 134
319 3300005842 Ga0068858_100152274 Ga0068858_1001522742 134
320 3300005843 Ga0068860_100306046 Ga0068860_1003060462 134
321 3300005844 Ga0068862_100510650 Ga0068862_1005106502 134
322 3300005844 Ga0068862_102006346 Ga0068862_1020063462 134
323 3300006028 Ga0070717_10000036 Ga0070717_1000003687 134
324 3300006028 Ga0070717_10766210 Ga0070717_107662102 134
325 3300006038 Ga0075365_10423370 Ga0075365_104233702 134
326 3300006042 Ga0075368_10329072 Ga0075368_103290722 134
327 3300006051 Ga0075364_10535509 Ga0075364_105355092 134
328 3300006175 Ga0070712_100943231 Ga0070712_1009432312 134
329 3300006178 Ga0075367_10232121 Ga0075367_102321212 134
330 3300006195 Ga0075366_10043620 Ga0075366_100436202 134
331 3300006358 Ga0068871_101679453 Ga0068871_1016794532 134
332 3300006847 Ga0075431_100262936 Ga0075431_1002629362 134
333 3300006852 Ga0075433_10351286 Ga0075433_103512863 134
334 3300006871 Ga0075434_101035319 Ga0075434_1010353192 134
335 3300006880 Ga0075429_100228242 Ga0075429_1002282422 134
336 3300006931 Ga0097620_100309240 Ga0097620_1003092402 134
337 3300006931 Ga0097620_100544981 Ga0097620_1005449812 134
338 3300006948 Ga0099826_10000006 Ga0099826_1000000676 134
339 3300009093 Ga0105240_10551680 Ga0105240_105516802 134
340 3300009094 Ga0111539_10007326 Ga0111539_100073267 134
341 3300009101 Ga0105247_10159095 Ga0105247_101590952 134
342 3300009147 Ga0114129_10047439 Ga0114129_100474392 134
343 3300009177 Ga0105248_10140343 Ga0105248_101403435 134
344 3300009545 Ga0105237_10000012 Ga0105237_10000012100 134
345 3300009545 Ga0105237_10462738 Ga0105237_104627383 134
346 3300009551 Ga0105238_10001720 Ga0105238_1000172016 134
347 3300009553 Ga0105249_10299259 Ga0105249_102992592 134
348 3300009553 Ga0105249_11684691 Ga0105249_116846911 134
349 3300010375 Ga0105239_10358868 Ga0105239_103588682 134
350 3300011119 Ga0105246_10073253 Ga0105246_100732533 134
351 3300013100 Ga0157373_10648608 Ga0157373_106486081 134
352 3300013102 Ga0157371_10681822 Ga0157371_106818222 134
353 3300013104 Ga0157370_10002059 Ga0157370_1000205919 134
354 3300013105 Ga0157369_10003075 Ga0157369_100030754 134
355 3300013105 Ga0157369_10004385 Ga0157369_1000438511 134
356 3300013297 Ga0157378_11152953 Ga0157378_111529532 134
357 3300013306 Ga0163162_11722967 Ga0163162_117229671 134
358 3300013307 Ga0157372_10009024 Ga0157372_100090246 134
359 3300013307 Ga0157372_11679355 Ga0157372_116793551 134
360 3300014325 Ga0163163_10137363 Ga0163163_101373632 134
361 3300014326 Ga0157380_10081622 Ga0157380_100816222 134
362 3300014326 Ga0157380_10104985 Ga0157380_101049854 134
363 3300014497 Ga0182008_10016812 Ga0182008_100168123 134
364 3300015261 Ga0182006_1000042 Ga0182006_100004279 134
365 3300015262 Ga0182007_10066084 Ga0182007_100660842 134
366 3300015265 Ga0182005_1000008 Ga0182005_100000861 134
367 3300015265 Ga0182005_1008283 Ga0182005_10082833 134
368 3300025263 Ga0209565_1016569 Ga0209565_10165692 134
369 3300025295 Ga0209564_1017872 Ga0209564_10178724 134
370 3300025299 Ga0209256_1000035 Ga0209256_1000035332 134
371 3300025904 Ga0207647_10504886 Ga0207647_105048861 134
372 3300025909 Ga0207705_10065434 Ga0207705_100654344 134
373 3300025909 Ga0207705_10635643 Ga0207705_106356432 134
374 3300025909 Ga0207705_10889176 Ga0207705_108891762 134
375 3300025911 Ga0207654_10618575 Ga0207654_106185752 134
376 3300025912 Ga0207707_10016645 Ga0207707_100166455 134
377 3300025912 Ga0207707_10258464 Ga0207707_102584642 134
378 3300025912 Ga0207707_10391968 Ga0207707_103919681 134
379 3300025912 Ga0207707_11065482 Ga0207707_110654821 134
380 3300025913 Ga0207695_10298660 Ga0207695_102986603 134
381 3300025914 Ga0207671_10000029 Ga0207671_10000029172 134
382 3300025914 Ga0207671_10678524 Ga0207671_106785242 134
383 3300025915 Ga0207693_10624526 Ga0207693_106245262 134
384 3300025917 Ga0207660_10000785 Ga0207660_100007852 134
385 3300025917 Ga0207660_10174318 Ga0207660_101743182 134
386 3300025917 Ga0207660_10198600 Ga0207660_101986002 134
387 3300025919 Ga0207657_10228271 Ga0207657_102282712 134
388 3300025919 Ga0207657_10265115 Ga0207657_102651153 134
389 3300025920 Ga0207649_10310279 Ga0207649_103102792 134
390 3300025921 Ga0207652_10061822 Ga0207652_100618222 134
391 3300025921 Ga0207652_10199441 Ga0207652_101994412 134
392 3300025921 Ga0207652_10410038 Ga0207652_104100383 134
393 3300025921 Ga0207652_10630206 Ga0207652_106302062 134
394 3300025924 Ga0207694_10013044 Ga0207694_100130445 134
395 3300025925 Ga0207650_10366683 Ga0207650_103666832 134
396 3300025928 Ga0207700_10051893 Ga0207700_100518932 134
397 3300025929 Ga0207664_10051484 Ga0207664_100514843 134
398 3300025929 Ga0207664_10525446 Ga0207664_105254462 134
399 3300025939 Ga0207665_10090988 Ga0207665_100909883 134
400 3300025941 Ga0207711_10410744 Ga0207711_104107442 134
401 3300025942 Ga0207689_10587932 Ga0207689_105879322 134
402 3300025944 Ga0207661_10478239 Ga0207661_104782393 134
403 3300025944 Ga0207661_10912634 Ga0207661_109126342 134
404 3300025949 Ga0207667_10005066 Ga0207667_100050664 134
405 3300025949 Ga0207667_10005792 Ga0207667_100057925 134
406 3300025949 Ga0207667_10106081 Ga0207667_101060812 134
407 3300025949 Ga0207667_11012733 Ga0207667_110127332 134
408 3300025961 Ga0207712_11549907 Ga0207712_115499071 134
409 3300025981 Ga0207640_11097968 Ga0207640_110979681 134
410 3300025986 Ga0207658_11633505 Ga0207658_116335052 134
411 3300026035 Ga0207703_10175707 Ga0207703_101757073 134
412 3300026041 Ga0207639_12153296 Ga0207639_121532961 134
413 3300026078 Ga0207702_10065885 Ga0207702_100658853 134
414 3300026078 Ga0207702_10218293 Ga0207702_102182933 134
415 3300026088 Ga0207641_11610818 Ga0207641_116108181 134
416 3300026142 Ga0207698_10050668 Ga0207698_100506682 134
417 3300026142 Ga0207698_10113392 Ga0207698_101133922 134
418 3300027111 Ga0209281_1003273 Ga0209281_10032733 134
419 3300027666 Ga0209282_1000003 Ga0209282_1000003296 134
420 3300027907 Ga0207428_10028142 Ga0207428_100281423 134
421 3300028379 Ga0268266_10220152 Ga0268266_102201522 134
422 3300028380 Ga0268265_10212748 Ga0268265_102127483 134
423 3300028380 Ga0268265_10309817 Ga0268265_103098172 134
424 3300028380 Ga0268265_10529325 Ga0268265_105293252 134
425 3300028380 Ga0268265_10607820 Ga0268265_106078202 134
426 3300028381 Ga0268264_10268383 Ga0268264_102683832 134
427 3300028794 Ga0307515_10131650 Ga0307515_101316502 134
428 3300031548 Ga0307408_100003066 Ga0307408_1000030665 134
429 3300031548 Ga0307408_100298101 Ga0307408_1002981012 134
430 3300031649 Ga0307514_10277457 Ga0307514_102774572 134
431 3300031731 Ga0307405_10002451 Ga0307405_100024513 134
432 3300031731 Ga0307405_10353393 Ga0307405_103533932 134
433 3300031731 Ga0307405_10870958 Ga0307405_108709582 134
434 3300031731 Ga0307405_10875321 Ga0307405_108753212 134
435 3300031824 Ga0307413_10000693 Ga0307413_100006938 134
436 3300031824 Ga0307413_10040495 Ga0307413_100404952 134
437 3300031824 Ga0307413_10195166 Ga0307413_101951663 134
438 3300031824 Ga0307413_10380658 Ga0307413_103806582 134
439 3300031824 Ga0307413_10577946 Ga0307413_105779462 134
440 3300031838 Ga0307518_10177492 Ga0307518_101774922 134
441 3300031852 Ga0307410_10000242 Ga0307410_1000024211 134
442 3300031852 Ga0307410_10653981 Ga0307410_106539812 134
443 3300031901 Ga0307406_10000861 Ga0307406_100008619 134
444 3300031901 Ga0307406_10151560 Ga0307406_101515602 134
445 3300031903 Ga0307407_10000863 Ga0307407_100008634 134
446 3300031903 Ga0307407_10053308 Ga0307407_100533082 134
447 3300031911 Ga0307412_10004727 Ga0307412_100047274 134
448 3300031911 Ga0307412_10516573 Ga0307412_105165732 134
449 3300031911 Ga0307412_11016421 Ga0307412_110164212 134
450 3300031995 Ga0307409_100000279 Ga0307409_1000002794 134
451 3300031995 Ga0307409_100022928 Ga0307409_1000229283 134
452 3300031995 Ga0307409_100160957 Ga0307409_1001609572 134
453 3300031995 Ga0307409_100453468 Ga0307409_1004534682 134
454 3300032002 Ga0307416_100000333 Ga0307416_10000033315 134
455 3300032002 Ga0307416_100033131 Ga0307416_1000331314 134
456 3300032002 Ga0307416_100207453 Ga0307416_1002074532 134
457 3300032002 Ga0307416_101356067 Ga0307416_1013560672 134
458 3300032002 Ga0307416_102622839 Ga0307416_1026228392 134
459 3300032004 Ga0307414_10032339 Ga0307414_100323394 134
460 3300032004 Ga0307414_10063787 Ga0307414_100637872 134
461 3300032004 Ga0307414_10346838 Ga0307414_103468383 134
462 3300032004 Ga0307414_10736238 Ga0307414_107362381 134
463 3300032005 Ga0307411_10000636 Ga0307411_100006367 134
464 3300032005 Ga0307411_10032059 Ga0307411_100320593 134
465 3300032005 Ga0307411_10111683 Ga0307411_101116832 134
466 3300032005 Ga0307411_10468984 Ga0307411_104689842 134
467 3300032126 Ga0307415_100002195 Ga0307415_1000021957 134
468 3300032126 Ga0307415_100089144 Ga0307415_1000891442 134
469 3300032126 Ga0307415_100677348 Ga0307415_1006773482 134
470 3300034817 Ga0373948_0082320 Ga0373948_0082320_25_429 134
471 3300035088 Ga0373940_0076869 Ga0373940_0076869_50_454 134
472 3300035090 Ga0373949_0132512 Ga0373949_0132512_133_537 134
473 3300035092 Ga0373952_0006708 Ga0373952_0006708_378_806 134
474 3300035092 Ga0373952_0171144 Ga0373952_0171144_158_562 134
475 3300035111 Ga0373923_0519553 Ga0373923_0519553_47_451 134
476 3300035121 Ga0373960_0062686 Ga0373960_0062686_405_809 134
477 3300035170 Ga0373943_0852558 Ga0373943_0852558_62_466 134
478 3300035171 Ga0373946_0373535 Ga0373946_0373535_219_623 134
479 3300035172 Ga0373955_0044590 Ga0373955_0044590_949_1353 134
480 3300035207 Ga0373942_0016086 Ga0373942_0016086_1361_1789 134
481 3300035241 Ga0373961_0073445 Ga0373961_0073445_87_515 134
482 3300035692 Ga0373935_0671051 Ga0373935_0671051_56_460 134
483 3300035695 Ga0373927_0244245 Ga0373927_0244245_169_576 134
484 3300035695 Ga0373927_0318049 Ga0373927_0318049_467_871 134
485 3300035724 Ga0373933_0100729 Ga0373933_0100729_699_1103 134
486 3300036401 Ga0373937_0057662 Ga0373937_0057662_3107_3511 134
487 3300037068 Ga0373925_0126901 Ga0373925_0126901_73_477 134
488 3300037418 Ga0395900_0341037 Ga0395900_0341037_821_1225 134
489 3300037466 Ga0395898_0307138 Ga0395898_0307138_1078_1482 134
490 3300037471 Ga0395905_0115299 Ga0395905_0115299_974_1378 134
491 3300037471 Ga0395905_0644266 Ga0395905_0644266_267_734 134
492 3300039437 Ga0436365_1665182 Ga0436365_1665182_616_1029 134
493 3300041492 Ga0451835_1199059 Ga0451835_1199059_90_494 134
494 3300042139 Ga0450904_005021 Ga0450904_005021_459_920 134
495 3300042876 Ga0451577_0505903 Ga0451577_0505903_295_699 134
496 3300044658 Ga0466972_0048350 Ga0466972_0048350_935_1339 134
497 3300044672 Ga0466982_0125914 Ga0466982_0125914_1073_1489 134
498 3300044683 Ga0466965_0046091 Ga0466965_0046091_1674_2090 134
499 3300044683 Ga0466965_0554776 Ga0466965_0554776_154_570 134
500 3300044694 Ga0466963_0584106 Ga0466963_0584106_349_753 134
501 3300044735 Ga0466968_0018413 Ga0466968_0018413_1921_2337 134
502 3300044735 Ga0466968_0085819 Ga0466968_0085819_667_1071 134
503 3300044765 Ga0466970_0004357 Ga0466970_0004357_6328_6744 134
504 3300044901 Ga0466960_0089231 Ga0466960_0089231_1047_1451 134
505 3300044901 Ga0466960_0351065 Ga0466960_0351065_12_428 134
506 3300044901 Ga0466960_0430497 Ga0466960_0430497_76_543 134
507 3300045976 Ga0466967_0561193 Ga0466967_0561193_188_655 134
508 3300045976 Ga0466967_2570491 Ga0466967_2570491_12_428 134
509 3300046462 Ga0495651_1011169 Ga0495651_1011169_62_466 134
510 3300046472 Ga0495580_0046966 Ga0495580_0046966_2151_2558 134
511 3300046472 Ga0495580_0048809 Ga0495580_0048809_828_1232 134
512 3300046473 Ga0495582_0052425 Ga0495582_0052425_801_1205 134
513 3300046475 Ga0495639_0017984 Ga0495639_0017984_1601_2005 134
514 3300046492 Ga0495585_0003702 Ga0495585_0003702_1258_1725 134
515 3300046492 Ga0495585_0024732 Ga0495585_0024732_1615_2082 134
516 3300046501 Ga0495607_0275535 Ga0495607_0275535_131_547 134
517 3300046506 Ga0495583_0085190 Ga0495583_0085190_551_1018 134
518 3300046507 Ga0495606_0063614 Ga0495606_0063614_169_636 134
519 3300046507 Ga0495606_0089158 Ga0495606_0089158_1317_1733 134
520 3300046513 Ga0495616_0001048 Ga0495616_0001048_4071_4538 134
521 3300046513 Ga0495616_0005059 Ga0495616_0005059_4542_5009 134
522 3300046515 Ga0495620_0006267 Ga0495620_0006267_211_678 134
523 3300046518 Ga0495631_0098152 Ga0495631_0098152_637_1104 134
524 3300046522 Ga0495643_0000003 Ga0495643_0000003_449416_449820 134
525 3300046522 Ga0495643_0048489 Ga0495643_0048489_339_755 134
526 3300046528 Ga0495642_0001678 Ga0495642_0001678_7273_7740 134
527 3300046531 Ga0495665_0040221 Ga0495665_0040221_1745_2152 134
528 3300046531 Ga0495665_0040822 Ga0495665_0040822_699_1103 134
529 3300046535 Ga0495586_0205985 Ga0495586_0205985_133_537 134
530 3300046535 Ga0495586_0349855 Ga0495586_0349855_199_606 134
531 3300046538 Ga0495609_0014519 Ga0495609_0014519_622_1038 134
532 3300046538 Ga0495609_0216022 Ga0495609_0216022_103_570 134
533 3300046558 Ga0495633_0144813 Ga0495633_0144813_555_1022 134
534 3300046559 Ga0495667_0202268 Ga0495667_0202268_74_478 134
535 3300046660 Ga0495625_0210218 Ga0495625_0210218_434_850 134
536 3300046665 Ga0495661_0008237 Ga0495661_0008237_3461_3928 134
537 3300046684 Ga0495669_0562547 Ga0495669_0562547_56_523 134
538 3300046809 Ga0495600_0237151 Ga0495600_0237151_603_1007 134
539 3300046810 Ga0495660_0000242 Ga0495660_0000242_10695_11111 134
540 3300046810 Ga0495660_0033648 Ga0495660_0033648_732_1199 134
541 3300047315 Ga0495581_0005859 Ga0495581_0005859_1832_2236 134
542 3300047323 Ga0495683_0117254 Ga0495683_0117254_12_479 134
543 3300047445 Ga0495677_0411927 Ga0495677_0411927_51_518 134
544 3300047470 Ga0495681_0022790 Ga0495681_0022790_1278_1745 134
545 3300047472 Ga0495686_0013673 Ga0495686_0013673_1306_1722 134
546 3300048906 Ga0496103_0551870 Ga0496103_0551870_239_706 134
547 3300048909 Ga0496106_0119194 Ga0496106_0119194_952_1419 134
548 3300048910 Ga0496107_0059826 Ga0496107_0059826_1258_1725 134
549 3300048911 Ga0496108_0326256 Ga0496108_0326256_328_744 134
550 3300048912 Ga0496109_0615155 Ga0496109_0615155_164_568 134
551 3300048914 Ga0496111_0303297 Ga0496111_0303297_169_585 134
552 3300048915 Ga0496112_0155062 Ga0496112_0155062_285_689 134
553 3300048915 Ga0496112_0511336 Ga0496112_0511336_233_637 134
554 3300048916 Ga0496113_1335573 Ga0496113_1335573_113_517 134
555 3300048918 Ga0496115_0018283 Ga0496115_0018283_2760_3164 134
556 3300048918 Ga0496115_0266424 Ga0496115_0266424_648_1052 134
557 3300048924 Ga0496121_0204466 Ga0496121_0204466_138_569 134
558 3300048929 Ga0496126_0004368 Ga0496126_0004368_11357_11794 134
559 3300048929 Ga0496126_0050763 Ga0496126_0050763_2723_3175 134
560 3300049521 Ga0501298_072821 Ga0501298_072821_229_639 134
561 3300049522 Ga0501299_023212 Ga0501299_023212_512_922 134
562 3300049568 Ga0501031_0226213 Ga0501031_0226213_333_740 134
563 3300049572 Ga0501036_1637746 Ga0501036_1637746_65_472 134
564 3300049573 Ga0501037_0474592 Ga0501037_0474592_363_767 134
565 3300049574 Ga0501038_0229997 Ga0501038_0229997_696_1136 134
566 3300049576 Ga0501040_0128227 Ga0501040_0128227_942_1346 134
567 3300049577 Ga0501041_0054609 Ga0501041_0054609_259_663 134
568 3300049578 Ga0501042_0549657 Ga0501042_0549657_294_698 134
569 3300049578 Ga0501042_1420586 Ga0501042_1420586_82_486 134
570 3300049580 Ga0501046_0534663 Ga0501046_0534663_153_557 134
571 3300049582 Ga0501048_0361752 Ga0501048_0361752_372_779 134
572 3300049582 Ga0501048_0518057 Ga0501048_0518057_439_843 134
573 3300049583 Ga0501067_0016178 Ga0501067_0016178_3207_3611 134
574 3300049584 Ga0501068_0033811 Ga0501068_0033811_651_1055 134
575 3300049585 Ga0501069_0010953 Ga0501069_0010953_1373_1777 134
576 3300049587 Ga0501071_0038701 Ga0501071_0038701_1479_1883 134
577 3300049587 Ga0501071_0274640 Ga0501071_0274640_548_952 134
578 3300049588 Ga0501072_0014673 Ga0501072_0014673_2414_2818 134
579 3300049589 Ga0501073_0493563 Ga0501073_0493563_61_501 134
580 3300049590 Ga0501074_0602050 Ga0501074_0602050_344_748 134
581 3300049591 Ga0501075_0282236 Ga0501075_0282236_394_798 134
582 3300049591 Ga0501075_0511686 Ga0501075_0511686_55_459 134
583 3300049591 Ga0501075_0831753 Ga0501075_0831753_53_457 134
584 3300049592 Ga0501076_0011033 Ga0501076_0011033_1226_1630 134
585 3300049592 Ga0501076_0600862 Ga0501076_0600862_387_791 134
586 3300049593 Ga0501077_0313826 Ga0501077_0313826_228_632 134
587 3300049671 Ga0501238_005001 Ga0501238_005001_41_457 134
588 3300049671 Ga0501238_059615 Ga0501238_059615_20_436 134
589 3300049675 Ga0501243_104276 Ga0501243_104276_80_490 134
590 3300049705 Ga0501225_0140280 Ga0501225_0140280_280_696 134
591 3300049741 Ga0501079_0101306 Ga0501079_0101306_961_1365 134
592 3300049742 Ga0501080_0060591 Ga0501080_0060591_1413_1853 134
593 3300049743 Ga0501081_0146581 Ga0501081_0146581_778_1182 134
594 3300049744 Ga0501083_0441284 Ga0501083_0441284_213_617 134
595 3300049771 Ga0501274_010619 Ga0501274_010619_129_539 134
596 3300049822 Ga0501035_0572788 Ga0501035_0572788_330_770 134
597 3300049823 Ga0501044_0084088 Ga0501044_0084088_2245_2685 134
598 3300049824 Ga0501045_0018451 Ga0501045_0018451_815_1219 134
599 3300050493 nmdc:mga0k408_117871_c1 nmdc:mga0k408_117871_c1_1055_1459 134
600 3300050493 nmdc:mga0k408_45001_c1 nmdc:mga0k408_45001_c1_161_565 134
601 3300050494 nmdc:mga06z11_17838_c1 nmdc:mga06z11_17838_c1_2310_2714 134
602 3300050508 nmdc:mga09592_244908_c1 nmdc:mga09592_244908_c1_327_731 134
603 3300050508 nmdc:mga09592_552247_c1 nmdc:mga09592_552247_c1_190_600 134
604 3300050509 nmdc:mga0qj67_24235_c1 nmdc:mga0qj67_24235_c1_1932_2336 134
605 3300050509 nmdc:mga0qj67_258942_c1 nmdc:mga0qj67_258942_c1_28_438 134
606 3300050509 nmdc:mga0qj67_549092_c1 nmdc:mga0qj67_549092_c1_393_803 134
607 3300050510 nmdc:mga06r32_1045755_c1 nmdc:mga06r32_1045755_c1_47_451 134
608 3300050510 nmdc:mga06r32_111503_c1 nmdc:mga06r32_111503_c1_237_641 134
609 3300050510 nmdc:mga06r32_196731_c1 nmdc:mga06r32_196731_c1_590_1000 134
610 3300050510 nmdc:mga06r32_222353_c1 nmdc:mga06r32_222353_c1_219_623 134
611 3300050511 nmdc:mga08y16_194887_c1 nmdc:mga08y16_194887_c1_71_475 134
612 3300050511 nmdc:mga08y16_90986_c1 nmdc:mga08y16_90986_c1_818_1222 134
613 3300050512 nmdc:mga0n895_1155057_c1 nmdc:mga0n895_1155057_c1_24_428 134
614 3300050513 nmdc:mga0rr50_633402_c1 nmdc:mga0rr50_633402_c1_369_773 134
615 3300050514 nmdc:mga08x19_506665_c1 nmdc:mga08x19_506665_c1_338_742 134
616 3300050515 nmdc:mga0a205_360817_c1 nmdc:mga0a205_360817_c1_86_490 134
617 3300053085 Ga0495619_0038766 Ga0495619_0038766_959_1366 134
618 3300053085 Ga0495619_0049522 Ga0495619_0049522_570_974 134
619 3300053139 Ga0500568_0019210 Ga0500568_0019210_1738_2145 134
620 3300053139 Ga0500568_0030978 Ga0500568_0030978_1399_1803 134
621 3300053151 Ga0500604_0035556 Ga0500604_0035556_412_816 134
622 3300054114 Ga0501084_0267769 Ga0501084_0267769_441_845 134
623 3300060353 Ga0501082_1701048 Ga0501082_1701048_132_536 134
624 iso_pu_bacteria 2857357740 2857367147 134
625 3300003320 rootH2_10183960 rootH2_101839602 135
626 3300003322 rootL2_10039180 rootL2_100391803 135
627 3300003322 rootL2_10061762 rootL2_100617622 135
628 3300005327 Ga0070658_10979007 Ga0070658_109790071 135
629 3300006353 Ga0075370_10308232 Ga0075370_103082322 135
630 3300006844 Ga0075428_100602726 Ga0075428_1006027263 135
631 3300006871 Ga0075434_102064395 Ga0075434_1020643952 135
632 3300014326 Ga0157380_12298480 Ga0157380_122984802 135
633 3300015688 Ga0183367_1004 Ga0183367_100460 135
634 3300026041 Ga0207639_10000009 Ga0207639_10000009280 135
635 3300026067 Ga0207678_11654541 Ga0207678_116545411 135
636 3300046491 Ga0495584_0172400 Ga0495584_0172400_154_624 135
637 3300046499 Ga0495594_0518035 Ga0495594_0518035_190_660 135
638 3300046500 Ga0495596_0033604 Ga0495596_0033604_17_487 135
639 3300046501 Ga0495607_0131773 Ga0495607_0131773_663_1133 135
640 3300046518 Ga0495631_0085548 Ga0495631_0085548_448_918 135
641 3300046528 Ga0495642_0407943 Ga0495642_0407943_80_550 135
642 3300046538 Ga0495609_0001447 Ga0495609_0001447_1254_1724 135
643 3300046557 Ga0495622_0025563 Ga0495622_0025563_907_1377 135
644 3300047320 Ga0495672_0104581 Ga0495672_0104581_889_1359 135
645 3300047323 Ga0495683_0011331 Ga0495683_0011331_4093_4563 135
646 3300047445 Ga0495677_0112296 Ga0495677_0112296_388_858 135
647 3300047469 Ga0495673_0028104 Ga0495673_0028104_662_1132 135
648 3300048091 Ga0495626_0043126 Ga0495626_0043126_43_513 135
649 3300049570 Ga0501033_0039232 Ga0501033_0039232_2917_3360 135
650 3300049571 Ga0501034_0224227 Ga0501034_0224227_610_1053 135
651 3300049573 Ga0501037_0364354 Ga0501037_0364354_300_743 135
652 3300049574 Ga0501038_0233076 Ga0501038_0233076_612_1055 135
653 3300049579 Ga0501043_0011457 Ga0501043_0011457_612_1055 135
654 3300049581 Ga0501047_0011388 Ga0501047_0011388_7365_7808 135
655 3300049582 Ga0501048_1029393 Ga0501048_1029393_136_579 135
656 3300049743 Ga0501081_0644794 Ga0501081_0644794_232_651 135
657 3300049823 Ga0501044_0007782 Ga0501044_0007782_1420_1863 135
658 3300050490 nmdc:mga03n38_13122_c1 nmdc:mga03n38_13122_c1_484_927 135
659 3300050496 nmdc:mga07m45_164537_c1 nmdc:mga07m45_164537_c1_620_1063 135
660 3300050512 nmdc:mga0n895_1036639_c1 nmdc:mga0n895_1036639_c1_88_495 135
661 3300053136 Ga0500559_0207376 Ga0500559_0207376_189_596 135
662 3300053153 Ga0500616_0030617 Ga0500616_0030617_540_947 135
663 3300025918 Ga0207662_10444356 Ga0207662_104443562 136
664 3300044684 Ga0466966_0143183 Ga0466966_0143183_431_853 136
665 3300005331 Ga0070670_100067240 Ga0070670_1000672404 137
666 3300032002 Ga0307416_100289780 Ga0307416_1002897803 137
667 3300053177 Ga0500636_0079908 Ga0500636_0079908_259_672 137
668 iso_pu_bacteria 2738541276 2738713318 137
669 3300005327 Ga0070658_10001128 Ga0070658_1000112816 138
670 3300006358 Ga0068871_100915719 Ga0068871_1009157192 138
671 3300014326 Ga0157380_12340171 Ga0157380_123401712 138
672 3300025909 Ga0207705_10057917 Ga0207705_100579173 138
673 3300035172 Ga0373955_0334499 Ga0373955_0334499_342_758 138
674 3300036401 Ga0373937_0099742 Ga0373937_0099742_996_1412 138
675 3300046517 Ga0495630_0352729 Ga0495630_0352729_249_665 138
676 3300046679 Ga0495623_0152070 Ga0495623_0152070_273_689 138
677 3300053136 Ga0500559_0246455 Ga0500559_0246455_112_534 138
678 3300053150 Ga0500603_181108 Ga0500603_181108_231_653 138
679 3300053163 Ga0500639_322944 Ga0500639_322944_34_456 138
680 3300006163 Ga0070715_10036392 Ga0070715_100363923 139
681 3300025905 Ga0207685_10280035 Ga0207685_102800352 139
682 3300025928 Ga0207700_10532336 Ga0207700_105323361 139
683 3300003316 rootH1_10139171 rootH1_101391712 140
684 3300003323 rootH1_10050409 rootH1_100504094 140
685 3300005335 Ga0070666_10154080 Ga0070666_101540802 140
686 3300005548 Ga0070665_100113985 Ga0070665_1001139852 140
687 3300005617 Ga0068859_101658899 Ga0068859_1016588991 140
688 3300006931 Ga0097620_101658379 Ga0097620_1016583791 140
689 3300009177 Ga0105248_10472666 Ga0105248_104726662 140
690 3300010375 Ga0105239_10756816 Ga0105239_107568162 140
691 3300025903 Ga0207680_10380949 Ga0207680_103809492 140
692 3300025904 Ga0207647_10003933 Ga0207647_100039337 140
693 3300028379 Ga0268266_10459017 Ga0268266_104590172 140
694 3300035724 Ga0373933_0662190 Ga0373933_0662190_100_525 140
695 3300036401 Ga0373937_1764998 Ga0373937_1764998_68_493 140
696 3300046471 Ga0495650_0085656 Ga0495650_0085656_606_1082 140
697 3300046507 Ga0495606_0094953 Ga0495606_0094953_694_1116 140
698 3300046522 Ga0495643_0101005 Ga0495643_0101005_949_1371 140
699 3300046616 Ga0495668_0045789 Ga0495668_0045789_1175_1597 140
700 3300046694 Ga0495649_0008250 Ga0495649_0008250_4180_4602 140
701 3300047318 Ga0495636_0069911 Ga0495636_0069911_225_647 140
702 3300047443 Ga0495687_009802 Ga0495687_009802_1034_1456 140
703 3300049460 Ga0495682_0108932 Ga0495682_0108932_133_555 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

46

146

0.91

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

21

144

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gkz-assembly1.cif.gz_A branched-chain alpha-ketoacid dehydrogenase kinase (bck) complxed with adp 0.8511 79 140
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.822 6 139
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8178 6 140
6m36-assembly2.cif.gz_M the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8067 6 140
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8037 6 140
ID Description Score Start End Superfamily
3j9x101 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8398 23 59 1.20.58.800
af_Q9LIR0_51_379_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.816 64 84 2.130.10.10
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8048 10 140 3.30.565.10
af_P39986_495_668_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.7883 67 84 3.40.1110.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7655 6 138 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A4Q3PC47-F1-model_v4 deleted 0.974 6 93
AF-A0A418MFE8-F1-model_v4 Anti-sigma regulatory factor 0.9733 6 140
AF-A0A2V7L193-F1-model_v4 ATP-binding protein 0.9701 13 140 GO:0004674
GO:0005524
AF-S4N0S0-F1-model_v4 PPM-type phosphatase domain-containing protein 0.9663 23 139
AF-B9X9T7-F1-model_v4 Putative anti-sigma regulatory factor, serine/threonine protein kinase 0.9624 10 139 GO:0004674

Feature Viewer

pLDDT pTM Quality
89.74 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map