F476330
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 421 | 678 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10012913|Ga0070658_100129135 |
| Length | 205 |
| Sequence | MQQPRRVFSMIREFHLADWFTLGNAVSGVSALFSTMSYLQYGERWHLYLACALVALALIFDVLDGRVARWRQKSSAMGRELDSLADVISFGVVPAVIGYGCGMQGSLDRVVLAFFVACGVSRLARYNVTAEANSQDGKVKFFEGTPIPTSLVLVAVLAWAAWAGALGDALWFGSVAFGPLELHPLVLMFAVSGSFMISRIRIPKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 8 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 9 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 10 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 11 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 12 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 13 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 16 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 17 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 18 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 19 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 20 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 21 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 22 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 23 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 24 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 25 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 26 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 27 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 28 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 33 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 125 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 230 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 238 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 263 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 264 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 265 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 266 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 267 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 268 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 269 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 270 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 271 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 272 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 277 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 278 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 279 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 346 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 372 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 373 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 375 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 377 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 381 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 382 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 404 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 406 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 408 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 415 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 417 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 418 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 419 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 421 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.88 |
| Metatranscriptomes | 0.28 |
| Isolates | 3.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.05 |
| Nodule | 0.57 |
| Rhizoplane | 3.55 |
| Rhizosphere | 68.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000419 | 3300002705 | Bacteria | 26375 |
| 2 | JGI25156J39149_1009299 | 3300002705 | Bacteria | 2401 |
| 3 | JGI25156J39149_1016439 | 3300002705 | Bacteria | 1438 |
| 4 | JGI25157J39369_1000174 | 3300002741 | Bacteria | 54162 |
| 5 | JGI25163J39215_1002977 | 3300002771 | Bacteria | 1486 |
| 6 | JGI25164J39214_1012596 | 3300002772 | Bacteria | 801 |
| 7 | JGI25152J39213_1001436 | 3300002773 | Bacteria | 10273 |
| 8 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 9 | rootH2_10000113 | 3300003320 | Bacteria | 75503 |
| 10 | rootH2_10034065 | 3300003320 | Bacteria | 4008 |
| 11 | rootH1_10078733 | 3300003316 | Bacteria | 1995 |
| 12 | rootH1_10078733 | 3300003323 | Bacteria | 3046 |
| 13 | JGI25160J50197_1000120 | 3300003354 | Bacteria | 71260 |
| 14 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 15 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 16 | Ga0055539_1000365 | 3300003752 | Bacteria | 19247 |
| 17 | Ga0055539_1001538 | 3300003752 | Bacteria | 4196 |
| 18 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 19 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 20 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 21 | Ga0055525_1000989 | 3300003759 | Bacteria | 7651 |
| 22 | Ga0055535_1000097 | 3300003761 | Bacteria | 95927 |
| 23 | Ga0055529_1000202 | 3300003763 | Bacteria | 79179 |
| 24 | Ga0055526_1001497 | 3300003771 | Bacteria | 16540 |
| 25 | Ga0055530_10000764 | 3300003791 | Bacteria | 26787 |
| 26 | Ga0055530_10001161 | 3300003791 | Bacteria | 20415 |
| 27 | Ga0055540_1000357 | 3300003792 | Bacteria | 38830 |
| 28 | Ga0055531_10016737 | 3300003794 | Bacteria | 3143 |
| 29 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 30 | Ga0065165_1000382 | 3300005262 | Bacteria | 71834 |
| 31 | Ga0065165_1001129 | 3300005262 | Bacteria | 31369 |
| 32 | Ga0065704_10449773 | 3300005289 | Bacteria | 698 |
| 33 | Ga0070658_10012913 | 3300005327 | Bacteria | 6705 |
| 34 | Ga0070658_10060818 | 3300005327 | Bacteria | 3076 |
| 35 | Ga0070658_10428196 | 3300005327 | Bacteria | 1139 |
| 36 | Ga0070683_100331849 | 3300005329 | Bacteria | 1448 |
| 37 | Ga0070690_100021105 | 3300005330 | Bacteria | 3974 |
| 38 | Ga0070670_100019957 | 3300005331 | Bacteria | 5754 |
| 39 | Ga0068869_100006181 | 3300005334 | Bacteria | 7580 |
| 40 | Ga0068869_100244373 | 3300005334 | Bacteria | 1431 |
| 41 | Ga0070666_10000010 | 3300005335 | Bacteria | 264789 |
| 42 | Ga0070666_10129752 | 3300005335 | Bacteria | 1751 |
| 43 | Ga0070680_100238870 | 3300005336 | Bacteria | 1535 |
| 44 | Ga0068868_100113107 | 3300005338 | Bacteria | 2207 |
| 45 | Ga0070660_100197829 | 3300005339 | Bacteria | 1630 |
| 46 | Ga0070661_100096203 | 3300005344 | Bacteria | 2197 |
| 47 | Ga0070669_100023434 | 3300005353 | Bacteria | 4421 |
| 48 | Ga0070674_100054606 | 3300005356 | Bacteria | 2764 |
| 49 | Ga0070673_100104622 | 3300005364 | Bacteria | 2338 |
| 50 | Ga0070659_100333978 | 3300005366 | Bacteria | 1269 |
| 51 | Ga0070659_100447996 | 3300005366 | Bacteria | 1095 |
| 52 | Ga0070667_100028205 | 3300005367 | Bacteria | 4673 |
| 53 | Ga0070667_100136741 | 3300005367 | Bacteria | 2143 |
| 54 | Ga0070667_100248445 | 3300005367 | Bacteria | 1590 |
| 55 | Ga0070700_100888108 | 3300005441 | Bacteria | 725 |
| 56 | Ga0070694_100011360 | 3300005444 | Bacteria | 5513 |
| 57 | Ga0070708_100703490 | 3300005445 | Bacteria | 951 |
| 58 | Ga0070662_100001459 | 3300005457 | Bacteria | 14573 |
| 59 | Ga0070662_100029344 | 3300005457 | Bacteria | 3839 |
| 60 | Ga0070662_100570032 | 3300005457 | Unclassified | 950 |
| 61 | Ga0070681_10269399 | 3300005458 | Bacteria | 1614 |
| 62 | Ga0068867_100007205 | 3300005459 | Bacteria | 7862 |
| 63 | Ga0068867_100690295 | 3300005459 | Bacteria | 900 |
| 64 | Ga0070697_100607481 | 3300005536 | Bacteria | 962 |
| 65 | Ga0068853_100815855 | 3300005539 | Bacteria | 894 |
| 66 | Ga0068853_100904758 | 3300005539 | Bacteria | 848 |
| 67 | Ga0070672_100046459 | 3300005543 | Bacteria | 3364 |
| 68 | Ga0070672_100275709 | 3300005543 | Bacteria | 1421 |
| 69 | Ga0070695_100014906 | 3300005545 | Bacteria | 4688 |
| 70 | Ga0070695_100065331 | 3300005545 | Bacteria | 2369 |
| 71 | Ga0070695_100694331 | 3300005545 | Bacteria | 807 |
| 72 | Ga0070665_100000179 | 3300005548 | Bacteria | 112608 |
| 73 | Ga0070665_100001343 | 3300005548 | Bacteria | 29249 |
| 74 | Ga0070665_100067913 | 3300005548 | Bacteria | 3574 |
| 75 | Ga0068855_100000971 | 3300005563 | Bacteria | 35725 |
| 76 | Ga0068855_100130777 | 3300005563 | Bacteria | 2867 |
| 77 | Ga0068855_100204845 | 3300005563 | Bacteria | 2220 |
| 78 | Ga0068855_100560002 | 3300005563 | Bacteria | 1237 |
| 79 | Ga0068857_100001909 | 3300005577 | Bacteria | 16794 |
| 80 | Ga0068857_100105739 | 3300005577 | Bacteria | 2527 |
| 81 | Ga0068856_100000951 | 3300005614 | Bacteria | 31014 |
| 82 | Ga0068856_100037225 | 3300005614 | Bacteria | 4774 |
| 83 | Ga0068852_100284628 | 3300005616 | Bacteria | 1595 |
| 84 | Ga0068852_100649096 | 3300005616 | Bacteria | 1063 |
| 85 | Ga0068852_100772266 | 3300005616 | Bacteria | 974 |
| 86 | Ga0068859_100076958 | 3300005617 | Bacteria | 3377 |
| 87 | Ga0068859_100597680 | 3300005617 | Bacteria | 1196 |
| 88 | Ga0068864_100102994 | 3300005618 | Bacteria | 2534 |
| 89 | Ga0068866_10116826 | 3300005718 | Bacteria | 1497 |
| 90 | Ga0068861_100005361 | 3300005719 | Bacteria | 8671 |
| 91 | Ga0068861_100178854 | 3300005719 | Bacteria | 1764 |
| 92 | Ga0068870_10020325 | 3300005840 | Bacteria | 3232 |
| 93 | Ga0068863_100004114 | 3300005841 | Bacteria | 14377 |
| 94 | Ga0068863_100474568 | 3300005841 | Bacteria | 1229 |
| 95 | Ga0068858_100097882 | 3300005842 | Bacteria | 2735 |
| 96 | Ga0068858_100386115 | 3300005842 | Bacteria | 1344 |
| 97 | Ga0068860_100001386 | 3300005843 | Bacteria | 26300 |
| 98 | Ga0068860_100032799 | 3300005843 | Bacteria | 4989 |
| 99 | Ga0068860_100047929 | 3300005843 | Bacteria | 4072 |
| 100 | Ga0068862_100085310 | 3300005844 | Bacteria | 2744 |
| 101 | Ga0081455_10119463 | 3300005937 | Bacteria | 2078 |
| 102 | Ga0075365_10220865 | 3300006038 | Bacteria | 1329 |
| 103 | Ga0075368_10002555 | 3300006042 | Bacteria | 5961 |
| 104 | Ga0075363_100000257 | 3300006048 | Bacteria | 15188 |
| 105 | Ga0075364_10054342 | 3300006051 | Bacteria | 2619 |
| 106 | Ga0075362_10000645 | 3300006177 | Bacteria | 10238 |
| 107 | Ga0075367_10001844 | 3300006178 | Bacteria | 9354 |
| 108 | Ga0075367_10119232 | 3300006178 | Bacteria | 1625 |
| 109 | Ga0075369_10005125 | 3300006186 | Bacteria | 4880 |
| 110 | Ga0075366_10015454 | 3300006195 | Bacteria | 4375 |
| 111 | Ga0075366_10059182 | 3300006195 | Bacteria | 2276 |
| 112 | Ga0075366_10109609 | 3300006195 | Bacteria | 1660 |
| 113 | Ga0075366_10130409 | 3300006195 | Bacteria | 1517 |
| 114 | Ga0075366_10166527 | 3300006195 | Bacteria | 1337 |
| 115 | Ga0097621_100542356 | 3300006237 | Bacteria | 1058 |
| 116 | Ga0075370_10000235 | 3300006353 | Bacteria | 19837 |
| 117 | Ga0075370_10002670 | 3300006353 | Bacteria | 8337 |
| 118 | Ga0075370_10098264 | 3300006353 | Bacteria | 1693 |
| 119 | Ga0068871_100545966 | 3300006358 | Bacteria | 1049 |
| 120 | Ga0068871_100718675 | 3300006358 | Unclassified | 916 |
| 121 | Ga0075428_100310146 | 3300006844 | Bacteria | 1696 |
| 122 | Ga0075428_101066772 | 3300006844 | Eukaryota | 854 |
| 123 | Ga0075428_101101231 | 3300006844 | Bacteria | 839 |
| 124 | Ga0075430_100066749 | 3300006846 | Bacteria | 3021 |
| 125 | Ga0075431_100013608 | 3300006847 | Bacteria | 8220 |
| 126 | Ga0075431_100064105 | 3300006847 | Bacteria | 3793 |
| 127 | Ga0075431_100101045 | 3300006847 | Unclassified | 2976 |
| 128 | Ga0075431_100608669 | 3300006847 | Bacteria | 1076 |
| 129 | Ga0075433_10076721 | 3300006852 | Unclassified | 2943 |
| 130 | Ga0075434_100150286 | 3300006871 | Bacteria | 2349 |
| 131 | Ga0075434_100310067 | 3300006871 | Bacteria | 1598 |
| 132 | Ga0075429_100482086 | 3300006880 | Unclassified | 1087 |
| 133 | Ga0068865_100004561 | 3300006881 | Bacteria | 8358 |
| 134 | Ga0068865_100013094 | 3300006881 | Bacteria | 5233 |
| 135 | Ga0075436_100036963 | 3300006914 | Unclassified | 3371 |
| 136 | Ga0097620_100076957 | 3300006931 | Bacteria | 3377 |
| 137 | Ga0097620_100597691 | 3300006931 | Bacteria | 1196 |
| 138 | Ga0079104_1000019 | 3300006946 | Bacteria | 269313 |
| 139 | Ga0105244_10111065 | 3300009036 | Bacteria | 1333 |
| 140 | Ga0105240_10030798 | 3300009093 | Bacteria | 6970 |
| 141 | Ga0105240_10087409 | 3300009093 | Bacteria | 3818 |
| 142 | Ga0105240_10122896 | 3300009093 | Bacteria | 3124 |
| 143 | Ga0105240_10181221 | 3300009093 | Bacteria | 2485 |
| 144 | Ga0105240_10188392 | 3300009093 | Bacteria | 2428 |
| 145 | Ga0105245_10020472 | 3300009098 | Bacteria | 5802 |
| 146 | Ga0105245_10080032 | 3300009098 | Bacteria | 2984 |
| 147 | Ga0105245_10305379 | 3300009098 | Bacteria | 1563 |
| 148 | Ga0105245_10383253 | 3300009098 | Bacteria | 1401 |
| 149 | Ga0114129_10004078 | 3300009147 | Bacteria | 20633 |
| 150 | Ga0114129_10027695 | 3300009147 | Bacteria | 8023 |
| 151 | Ga0114129_10037014 | 3300009147 | Bacteria | 6889 |
| 152 | Ga0114129_10080685 | 3300009147 | Bacteria | 4522 |
| 153 | Ga0114129_10894858 | 3300009147 | Bacteria | 1125 |
| 154 | Ga0105243_10035142 | 3300009148 | Bacteria | 3884 |
| 155 | Ga0105243_10038186 | 3300009148 | Bacteria | 3739 |
| 156 | Ga0105243_10134017 | 3300009148 | Bacteria | 2105 |
| 157 | Ga0105243_10163766 | 3300009148 | Bacteria | 1920 |
| 158 | Ga0105243_10165374 | 3300009148 | Bacteria | 1911 |
| 159 | Ga0105243_10890233 | 3300009148 | Bacteria | 885 |
| 160 | Ga0105241_10007758 | 3300009174 | Bacteria | 7890 |
| 161 | Ga0105241_10115366 | 3300009174 | Bacteria | 2156 |
| 162 | Ga0105241_10148456 | 3300009174 | Bacteria | 1915 |
| 163 | Ga0105242_10000868 | 3300009176 | Bacteria | 23481 |
| 164 | Ga0105242_10035264 | 3300009176 | Bacteria | 4012 |
| 165 | Ga0105242_10156513 | 3300009176 | Bacteria | 1991 |
| 166 | Ga0105242_10190911 | 3300009176 | Bacteria | 1813 |
| 167 | Ga0105237_10010756 | 3300009545 | Bacteria | 9710 |
| 168 | Ga0105237_10026812 | 3300009545 | Bacteria | 5889 |
| 169 | Ga0105237_10028608 | 3300009545 | Bacteria | 5674 |
| 170 | Ga0105237_10140032 | 3300009545 | Bacteria | 2413 |
| 171 | Ga0105237_10157977 | 3300009545 | Bacteria | 2265 |
| 172 | Ga0105237_10716269 | 3300009545 | Bacteria | 1007 |
| 173 | Ga0105238_10001392 | 3300009551 | Bacteria | 24268 |
| 174 | Ga0105238_10006478 | 3300009551 | Bacteria | 11644 |
| 175 | Ga0105238_10007601 | 3300009551 | Bacteria | 10861 |
| 176 | Ga0105238_10031258 | 3300009551 | Bacteria | 5420 |
| 177 | Ga0105238_10139564 | 3300009551 | Bacteria | 2401 |
| 178 | Ga0105249_10150677 | 3300009553 | Bacteria | 2239 |
| 179 | Ga0105249_10335296 | 3300009553 | Bacteria | 1527 |
| 180 | Ga0105239_10000056 | 3300010375 | Bacteria | 157615 |
| 181 | Ga0105239_10006811 | 3300010375 | Bacteria | 13183 |
| 182 | Ga0105239_10007170 | 3300010375 | Bacteria | 12822 |
| 183 | Ga0105239_10044898 | 3300010375 | Unclassified | 4844 |
| 184 | Ga0105239_10196071 | 3300010375 | Bacteria | 2262 |
| 185 | Ga0105246_10174907 | 3300011119 | Bacteria | 1648 |
| 186 | Ga0105246_10988172 | 3300011119 | Bacteria | 761 |
| 187 | Ga0157336_1001030 | 3300012477 | Unclassified | 1379 |
| 188 | Ga0157321_1008976 | 3300012487 | Bacteria | 736 |
| 189 | Ga0157319_1000002 | 3300012497 | Bacteria | 410803 |
| 190 | Ga0157373_10003612 | 3300013100 | Bacteria | 11682 |
| 191 | Ga0157369_10025778 | 3300013105 | Bacteria | 6522 |
| 192 | Ga0157369_10060633 | 3300013105 | Bacteria | 4079 |
| 193 | Ga0157369_10316790 | 3300013105 | Unclassified | 1622 |
| 194 | Ga0157378_10004305 | 3300013297 | Bacteria | 12535 |
| 195 | Ga0157378_10021317 | 3300013297 | Bacteria | 5697 |
| 196 | Ga0157378_10267713 | 3300013297 | Unclassified | 1642 |
| 197 | Ga0163162_10004215 | 3300013306 | Bacteria | 13822 |
| 198 | Ga0163162_10010624 | 3300013306 | Bacteria | 8952 |
| 199 | Ga0163162_10041433 | 3300013306 | Bacteria | 4607 |
| 200 | Ga0163162_11121899 | 3300013306 | Unclassified | 891 |
| 201 | Ga0157372_10006487 | 3300013307 | Bacteria | 12450 |
| 202 | Ga0157375_10102471 | 3300013308 | Bacteria | 2947 |
| 203 | Ga0157375_11232721 | 3300013308 | Bacteria | 878 |
| 204 | Ga0163163_10208556 | 3300014325 | Unclassified | 2002 |
| 205 | Ga0163163_10764277 | 3300014325 | Bacteria | 1030 |
| 206 | Ga0157379_10098367 | 3300014968 | Bacteria | 2627 |
| 207 | Ga0157379_10501267 | 3300014968 | Bacteria | 1125 |
| 208 | Ga0157376_10267125 | 3300014969 | Bacteria | 1605 |
| 209 | Ga0157376_10396388 | 3300014969 | Bacteria | 1333 |
| 210 | Ga0163161_10274457 | 3300017792 | Bacteria | 1320 |
| 211 | Ga0163161_10302456 | 3300017792 | Bacteria | 1260 |
| 212 | Ga0213872_10026966 | 3300021361 | Bacteria | 2639 |
| 213 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 214 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 215 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 216 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 217 | Ga0209672_107976 | 3300025228 | Bacteria | 1598 |
| 218 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 219 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 220 | Ga0207427_100307 | 3300025231 | Bacteria | 34034 |
| 221 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 222 | Ga0209258_100162 | 3300025242 | Bacteria | 151725 |
| 223 | Ga0209258_101918 | 3300025242 | Bacteria | 6129 |
| 224 | Ga0207425_1000407 | 3300025245 | Bacteria | 28974 |
| 225 | Ga0209646_1000066 | 3300025246 | Bacteria | 244823 |
| 226 | Ga0209026_1000027 | 3300025250 | Bacteria | 351282 |
| 227 | Ga0209026_1009984 | 3300025250 | Bacteria | 1808 |
| 228 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 229 | Ga0209677_100178 | 3300025253 | Bacteria | 53699 |
| 230 | Ga0209677_100183 | 3300025253 | Bacteria | 51950 |
| 231 | Ga0209677_102833 | 3300025253 | Bacteria | 6133 |
| 232 | Ga0209759_1000131 | 3300025256 | Bacteria | 130014 |
| 233 | Ga0209759_1000662 | 3300025256 | Bacteria | 31972 |
| 234 | Ga0209759_1001643 | 3300025256 | Bacteria | 11800 |
| 235 | Ga0209759_1005424 | 3300025256 | Bacteria | 4471 |
| 236 | Ga0209129_1000175 | 3300025258 | Bacteria | 93817 |
| 237 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 238 | Ga0209233_1006680 | 3300025261 | Bacteria | 3700 |
| 239 | Ga0209455_1000128 | 3300025272 | Bacteria | 162413 |
| 240 | Ga0209673_1005494 | 3300025273 | Bacteria | 6353 |
| 241 | Ga0209673_1010530 | 3300025273 | Bacteria | 3891 |
| 242 | Ga0209673_1036513 | 3300025273 | Bacteria | 1457 |
| 243 | Ga0209564_1000136 | 3300025295 | Bacteria | 185198 |
| 244 | Ga0209564_1002533 | 3300025295 | Bacteria | 14100 |
| 245 | Ga0209758_1000275 | 3300025297 | Bacteria | 102404 |
| 246 | Ga0209758_1000902 | 3300025297 | Bacteria | 40345 |
| 247 | Ga0209050_1000703 | 3300025298 | Bacteria | 49694 |
| 248 | Ga0209050_1001381 | 3300025298 | Bacteria | 26455 |
| 249 | Ga0209050_1012767 | 3300025298 | Bacteria | 3813 |
| 250 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 251 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 252 | Ga0209051_1000063 | 3300025303 | Bacteria | 249739 |
| 253 | Ga0209051_1002331 | 3300025303 | Bacteria | 13787 |
| 254 | Ga0209257_1000118 | 3300025304 | Bacteria | 225963 |
| 255 | Ga0209257_1017132 | 3300025304 | Bacteria | 2876 |
| 256 | Ga0209257_1018869 | 3300025304 | Bacteria | 2628 |
| 257 | Ga0207655_1100610 | 3300025728 | Bacteria | 996 |
| 258 | Ga0207642_10065352 | 3300025899 | Bacteria | 1709 |
| 259 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 260 | Ga0207680_10008080 | 3300025903 | Bacteria | 5155 |
| 261 | Ga0207645_10005973 | 3300025907 | Bacteria | 8767 |
| 262 | Ga0207645_10052192 | 3300025907 | Bacteria | 2613 |
| 263 | Ga0207645_10144391 | 3300025907 | Bacteria | 1551 |
| 264 | Ga0207705_10067122 | 3300025909 | Bacteria | 2595 |
| 265 | Ga0207705_10528996 | 3300025909 | Bacteria | 916 |
| 266 | Ga0207684_10484286 | 3300025910 | Bacteria | 1061 |
| 267 | Ga0207654_10043012 | 3300025911 | Bacteria | 2558 |
| 268 | Ga0207654_10111096 | 3300025911 | Bacteria | 1706 |
| 269 | Ga0207707_10002429 | 3300025912 | Bacteria | 16761 |
| 270 | Ga0207695_10000243 | 3300025913 | Bacteria | 141682 |
| 271 | Ga0207695_10000663 | 3300025913 | Bacteria | 67900 |
| 272 | Ga0207695_10109938 | 3300025913 | Bacteria | 2737 |
| 273 | Ga0207695_10113680 | 3300025913 | Bacteria | 2683 |
| 274 | Ga0207695_10851117 | 3300025913 | Bacteria | 792 |
| 275 | Ga0207671_10031954 | 3300025914 | Bacteria | 3919 |
| 276 | Ga0207671_10041737 | 3300025914 | Bacteria | 3396 |
| 277 | Ga0207657_10239272 | 3300025919 | Bacteria | 1450 |
| 278 | Ga0207649_10002485 | 3300025920 | Bacteria | 10301 |
| 279 | Ga0207649_10057883 | 3300025920 | Bacteria | 2425 |
| 280 | Ga0207649_10132241 | 3300025920 | Bacteria | 1696 |
| 281 | Ga0207649_10478867 | 3300025920 | Bacteria | 944 |
| 282 | Ga0207652_10052348 | 3300025921 | Bacteria | 3503 |
| 283 | Ga0207681_10028578 | 3300025923 | Bacteria | 3613 |
| 284 | Ga0207694_10001367 | 3300025924 | Bacteria | 21012 |
| 285 | Ga0207694_10027167 | 3300025924 | Bacteria | 4358 |
| 286 | Ga0207694_10356850 | 3300025924 | Unclassified | 1211 |
| 287 | Ga0207644_10320433 | 3300025931 | Bacteria | 1253 |
| 288 | Ga0207690_10000359 | 3300025932 | Bacteria | 30319 |
| 289 | Ga0207690_10153884 | 3300025932 | Bacteria | 1707 |
| 290 | Ga0207706_10203108 | 3300025933 | Unclassified | 1738 |
| 291 | Ga0207706_10237794 | 3300025933 | Bacteria | 1592 |
| 292 | Ga0207686_10001655 | 3300025934 | Bacteria | 12411 |
| 293 | Ga0207686_10063305 | 3300025934 | Bacteria | 2352 |
| 294 | Ga0207709_10184489 | 3300025935 | Bacteria | 1476 |
| 295 | Ga0207709_10264928 | 3300025935 | Bacteria | 1262 |
| 296 | Ga0207704_10085078 | 3300025938 | Bacteria | 2057 |
| 297 | Ga0207689_10014268 | 3300025942 | Bacteria | 6761 |
| 298 | Ga0207689_10094740 | 3300025942 | Bacteria | 2452 |
| 299 | Ga0207661_10403508 | 3300025944 | Bacteria | 1240 |
| 300 | Ga0207679_10000220 | 3300025945 | Bacteria | 45059 |
| 301 | Ga0207667_10002057 | 3300025949 | Bacteria | 25223 |
| 302 | Ga0207667_10164768 | 3300025949 | Bacteria | 2279 |
| 303 | Ga0207667_10283917 | 3300025949 | Bacteria | 1691 |
| 304 | Ga0207667_10365468 | 3300025949 | Bacteria | 1471 |
| 305 | Ga0207667_10732850 | 3300025949 | Bacteria | 989 |
| 306 | Ga0207651_10041564 | 3300025960 | Bacteria | 3053 |
| 307 | Ga0207651_10070670 | 3300025960 | Bacteria | 2470 |
| 308 | Ga0207712_10288624 | 3300025961 | Bacteria | 1342 |
| 309 | Ga0207668_10139877 | 3300025972 | Bacteria | 1860 |
| 310 | Ga0207668_10865161 | 3300025972 | Bacteria | 803 |
| 311 | Ga0207640_10164555 | 3300025981 | Bacteria | 1645 |
| 312 | Ga0207640_10447630 | 3300025981 | Bacteria | 1063 |
| 313 | Ga0207658_10065783 | 3300025986 | Bacteria | 2724 |
| 314 | Ga0207658_10293960 | 3300025986 | Bacteria | 1397 |
| 315 | Ga0207677_10059083 | 3300026023 | Bacteria | 2643 |
| 316 | Ga0207677_10881646 | 3300026023 | Bacteria | 806 |
| 317 | Ga0207703_10082199 | 3300026035 | Bacteria | 2687 |
| 318 | Ga0207703_11017509 | 3300026035 | Bacteria | 795 |
| 319 | Ga0207639_10133013 | 3300026041 | Bacteria | 2062 |
| 320 | Ga0207639_10412274 | 3300026041 | Bacteria | 1220 |
| 321 | Ga0207678_10023119 | 3300026067 | Bacteria | 5440 |
| 322 | Ga0207708_10798104 | 3300026075 | Bacteria | 812 |
| 323 | Ga0207702_10000220 | 3300026078 | Bacteria | 66634 |
| 324 | Ga0207702_10196453 | 3300026078 | Unclassified | 1868 |
| 325 | Ga0207641_10002934 | 3300026088 | Bacteria | 15421 |
| 326 | Ga0207641_10217289 | 3300026088 | Bacteria | 1771 |
| 327 | Ga0207641_10450216 | 3300026088 | Bacteria | 1244 |
| 328 | Ga0207641_10572746 | 3300026088 | Bacteria | 1103 |
| 329 | Ga0207648_10001237 | 3300026089 | Bacteria | 28700 |
| 330 | Ga0207648_10003244 | 3300026089 | Bacteria | 17114 |
| 331 | Ga0207648_10066865 | 3300026089 | Bacteria | 3134 |
| 332 | Ga0207648_10545945 | 3300026089 | Bacteria | 1064 |
| 333 | Ga0207648_10576125 | 3300026089 | Bacteria | 1036 |
| 334 | Ga0207674_10011271 | 3300026116 | Bacteria | 10049 |
| 335 | Ga0207674_10089333 | 3300026116 | Bacteria | 3074 |
| 336 | Ga0207675_100001346 | 3300026118 | Bacteria | 24652 |
| 337 | Ga0207675_100347874 | 3300026118 | Bacteria | 1452 |
| 338 | Ga0207675_100683657 | 3300026118 | Bacteria | 1034 |
| 339 | Ga0207683_10281086 | 3300026121 | Bacteria | 1521 |
| 340 | Ga0207698_10511565 | 3300026142 | Bacteria | 1170 |
| 341 | Ga0207698_11355747 | 3300026142 | Bacteria | 726 |
| 342 | Ga0209281_1000149 | 3300027111 | Bacteria | 167880 |
| 343 | Ga0209995_1024043 | 3300027471 | Bacteria | 1014 |
| 344 | Ga0209983_1009900 | 3300027665 | Bacteria | 1948 |
| 345 | Ga0209971_1000923 | 3300027682 | Bacteria | 7569 |
| 346 | Ga0209966_1008929 | 3300027695 | Bacteria | 1785 |
| 347 | Ga0209998_10023569 | 3300027717 | Bacteria | 1331 |
| 348 | Ga0209813_10001664 | 3300027866 | Bacteria | 4997 |
| 349 | Ga0209974_10008910 | 3300027876 | Bacteria | 3416 |
| 350 | Ga0209974_10014134 | 3300027876 | Bacteria | 2660 |
| 351 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 352 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 353 | Ga0268266_10023539 | 3300028379 | Bacteria | 5242 |
| 354 | Ga0268265_10018728 | 3300028380 | Bacteria | 4802 |
| 355 | Ga0268265_10477202 | 3300028380 | Unclassified | 1170 |
| 356 | Ga0268265_10728971 | 3300028380 | Bacteria | 960 |
| 357 | Ga0268264_10063733 | 3300028381 | Bacteria | 3100 |
| 358 | Ga0268264_10323489 | 3300028381 | Bacteria | 1459 |
| 359 | Ga0265334_10074335 | 3300028573 | Bacteria | 1261 |
| 360 | Ga0265334_10084620 | 3300028573 | Bacteria | 1164 |
| 361 | Ga0265318_10085693 | 3300028577 | Bacteria | 1161 |
| 362 | Ga0265336_10000008 | 3300028666 | Bacteria | 336082 |
| 363 | Ga0307515_10075287 | 3300028794 | Bacteria | 4499 |
| 364 | Ga0307515_10162385 | 3300028794 | Bacteria | 2271 |
| 365 | Ga0307515_10326248 | 3300028794 | Bacteria | 1197 |
| 366 | Ga0265324_10003914 | 3300029957 | Bacteria | 6927 |
| 367 | Ga0265330_10000368 | 3300031235 | Bacteria | 31833 |
| 368 | Ga0265332_10000394 | 3300031238 | Bacteria | 31776 |
| 369 | Ga0265320_10035790 | 3300031240 | Bacteria | 2514 |
| 370 | Ga0265325_10011672 | 3300031241 | Bacteria | 5042 |
| 371 | Ga0265325_10060517 | 3300031241 | Bacteria | 1923 |
| 372 | Ga0265340_10034341 | 3300031247 | Bacteria | 2523 |
| 373 | Ga0265331_10023713 | 3300031250 | Bacteria | 3113 |
| 374 | Ga0307513_10100596 | 3300031456 | Bacteria | 2916 |
| 375 | Ga0307509_10010341 | 3300031507 | Bacteria | 11456 |
| 376 | Ga0307509_10081638 | 3300031507 | Bacteria | 3338 |
| 377 | Ga0307509_10123933 | 3300031507 | Bacteria | 2555 |
| 378 | Ga0307408_100000136 | 3300031548 | Bacteria | 81550 |
| 379 | Ga0307408_100058895 | 3300031548 | Bacteria | 2794 |
| 380 | Ga0307508_10213039 | 3300031616 | Bacteria | 1532 |
| 381 | Ga0316575_10047969 | 3300031665 | Bacteria | 1698 |
| 382 | Ga0316579_10000135 | 3300031691 | Bacteria | 20446 |
| 383 | Ga0316579_10157055 | 3300031691 | Bacteria | 1098 |
| 384 | Ga0265314_10000292 | 3300031711 | Bacteria | 71982 |
| 385 | Ga0316578_10105087 | 3300031728 | Bacteria | 1694 |
| 386 | Ga0316578_10427264 | 3300031728 | Bacteria | 784 |
| 387 | Ga0307516_10000114 | 3300031730 | Bacteria | 93691 |
| 388 | Ga0307516_10000361 | 3300031730 | Bacteria | 59122 |
| 389 | Ga0307516_10102606 | 3300031730 | Bacteria | 2675 |
| 390 | Ga0316577_10186726 | 3300031733 | Bacteria | 1171 |
| 391 | Ga0307406_10000105 | 3300031901 | Bacteria | 48938 |
| 392 | Ga0307406_10122815 | 3300031901 | Bacteria | 1809 |
| 393 | Ga0307412_10234665 | 3300031911 | Bacteria | 1415 |
| 394 | Ga0316583_10005122 | 3300032133 | Bacteria | 4696 |
| 395 | Ga0316583_10041673 | 3300032133 | Bacteria | 1624 |
| 396 | Ga0316580_10115248 | 3300032139 | Bacteria | 822 |
| 397 | Ga0307510_10000018 | 3300033180 | Bacteria | 192986 |
| 398 | Ga0307510_10032571 | 3300033180 | Bacteria | 5869 |
| 399 | Ga0307510_10088490 | 3300033180 | Bacteria | 2956 |
| 400 | Ga0373959_0066074 | 3300034820 | Bacteria | 809 |
| 401 | Ga0373939_0085252 | 3300035114 | Unclassified | 1058 |
| 402 | Ga0373945_0188362 | 3300035116 | Bacteria | 852 |
| 403 | Ga0373931_0022281 | 3300035691 | Bacteria | 3187 |
| 404 | Ga0373927_0024670 | 3300035695 | Bacteria | 3930 |
| 405 | Ga0373927_0300818 | 3300035695 | Bacteria | 1056 |
| 406 | Ga0373927_0302473 | 3300035695 | Bacteria | 1053 |
| 407 | Ga0373947_0028546 | 3300035725 | Unclassified | 3272 |
| 408 | Ga0373937_0094584 | 3300036401 | Bacteria | 2771 |
| 409 | Ga0316582_0000046 | 3300036647 | Bacteria | 29572 |
| 410 | Ga0316582_0030887 | 3300036647 | Bacteria | 3269 |
| 411 | Ga0316584_0019859 | 3300036712 | Bacteria | 4861 |
| 412 | Ga0373925_0001876 | 3300037068 | Bacteria | 17464 |
| 413 | Ga0373925_0031306 | 3300037068 | Unclassified | 3908 |
| 414 | Ga0395898_0039705 | 3300037466 | Bacteria | 4657 |
| 415 | Ga0395905_0000039 | 3300037471 | Bacteria | 253197 |
| 416 | Ga0395905_0002983 | 3300037471 | Bacteria | 18365 |
| 417 | Ga0395905_0004666 | 3300037471 | Bacteria | 14168 |
| 418 | Ga0395905_0015670 | 3300037471 | Bacteria | 7202 |
| 419 | Ga0395905_0156328 | 3300037471 | Bacteria | 2145 |
| 420 | Ga0316581_0072075 | 3300037588 | Bacteria | 1061 |
| 421 | Ga0395901_0016167 | 3300038443 | Bacteria | 7600 |
| 422 | Ga0436361_0304046 | 3300039447 | Bacteria | 18116 |
| 423 | Ga0436361_0433542 | 3300039447 | Bacteria | 1687 |
| 424 | Ga0436361_1122650 | 3300039447 | Bacteria | 2459 |
| 425 | Ga0451789_0419046 | 3300041443 | Bacteria | 1624 |
| 426 | Ga0451793_0385518 | 3300041452 | Bacteria | 3464 |
| 427 | Ga0451797_0601666 | 3300041453 | Bacteria | 1364 |
| 428 | Ga0451795_0964762 | 3300041456 | Bacteria | 769 |
| 429 | Ga0451807_2008794 | 3300041486 | Bacteria | 1172 |
| 430 | Ga0451855_0476580 | 3300041511 | Bacteria | 1454 |
| 431 | Ga0451853_0712802 | 3300041512 | Bacteria | 1884 |
| 432 | Ga0439441_030748 | 3300042001 | Bacteria | 1039 |
| 433 | Ga0450919_002427 | 3300042121 | Bacteria | 2412 |
| 434 | Ga0450920_002499 | 3300042122 | Bacteria | 3131 |
| 435 | Ga0439458_0050383 | 3300042157 | Bacteria | 1027 |
| 436 | Ga0439434_0049587 | 3300042435 | Bacteria | 1300 |
| 437 | Ga0439459_0006559 | 3300042438 | Bacteria | 1941 |
| 438 | Ga0450918_000003 | 3300042531 | Bacteria | 58967 |
| 439 | Ga0451577_0023595 | 3300042876 | Bacteria | 5608 |
| 440 | Ga0451577_0152498 | 3300042876 | Bacteria | 2079 |
| 441 | Ga0451577_0574701 | 3300042876 | Bacteria | 1023 |
| 442 | Ga0466969_0001367 | 3300044656 | Bacteria | 13144 |
| 443 | Ga0466969_0006082 | 3300044656 | Bacteria | 6421 |
| 444 | Ga0466972_0000519 | 3300044658 | Bacteria | 19047 |
| 445 | Ga0453683_0141611 | 3300044673 | Bacteria | 1518 |
| 446 | Ga0466965_0016159 | 3300044683 | Bacteria | 3548 |
| 447 | Ga0466965_0045870 | 3300044683 | Bacteria | 2163 |
| 448 | Ga0466966_0011080 | 3300044684 | Bacteria | 5985 |
| 449 | Ga0466961_0000358 | 3300044693 | Bacteria | 29816 |
| 450 | Ga0466961_0118577 | 3300044693 | Bacteria | 1662 |
| 451 | Ga0466964_0003754 | 3300044706 | Bacteria | 5565 |
| 452 | Ga0453684_0000823 | 3300044712 | Bacteria | 104784 |
| 453 | Ga0453684_0144892 | 3300044712 | Bacteria | 2831 |
| 454 | Ga0453684_0200643 | 3300044712 | Bacteria | 2325 |
| 455 | Ga0453684_0340128 | 3300044712 | Bacteria | 1695 |
| 456 | Ga0466971_0355333 | 3300044719 | Bacteria | 709 |
| 457 | Ga0466968_0275560 | 3300044735 | Bacteria | 804 |
| 458 | Ga0466957_0037013 | 3300044842 | Bacteria | 2936 |
| 459 | Ga0466957_0100369 | 3300044842 | Bacteria | 1824 |
| 460 | Ga0466959_0096895 | 3300045049 | Bacteria | 2114 |
| 461 | Ga0466959_0272722 | 3300045049 | Bacteria | 1162 |
| 462 | Ga0451576_0239549 | 3300045051 | Bacteria | 1895 |
| 463 | Ga0451576_0936342 | 3300045051 | Bacteria | 909 |
| 464 | Ga0466958_0566166 | 3300045836 | Bacteria | 738 |
| 465 | Ga0466967_0113340 | 3300045976 | Bacteria | 2494 |
| 466 | Ga0495590_0001608 | 3300046457 | Bacteria | 9657 |
| 467 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 468 | Ga0495638_0096111 | 3300046460 | Bacteria | 1779 |
| 469 | Ga0495650_0000203 | 3300046471 | Bacteria | 129364 |
| 470 | Ga0495650_0013148 | 3300046471 | Bacteria | 4398 |
| 471 | Ga0495580_0000077 | 3300046472 | Bacteria | 61724 |
| 472 | Ga0495580_0091438 | 3300046472 | Unclassified | 2118 |
| 473 | Ga0495582_0284477 | 3300046473 | Unclassified | 950 |
| 474 | Ga0495605_0043124 | 3300046474 | Bacteria | 2238 |
| 475 | Ga0495605_0080517 | 3300046474 | Bacteria | 1524 |
| 476 | Ga0495639_0038401 | 3300046475 | Bacteria | 2150 |
| 477 | Ga0495584_0033651 | 3300046491 | Bacteria | 2594 |
| 478 | Ga0495583_0000444 | 3300046506 | Bacteria | 62022 |
| 479 | Ga0495583_0000449 | 3300046506 | Bacteria | 61654 |
| 480 | Ga0495583_0202862 | 3300046506 | Bacteria | 805 |
| 481 | Ga0495606_0002487 | 3300046507 | Bacteria | 21331 |
| 482 | Ga0495606_0156435 | 3300046507 | Bacteria | 1333 |
| 483 | Ga0495606_0203732 | 3300046507 | Bacteria | 1126 |
| 484 | Ga0495616_0033452 | 3300046513 | Bacteria | 2678 |
| 485 | Ga0495632_0251699 | 3300046519 | Bacteria | 792 |
| 486 | Ga0495648_0014477 | 3300046524 | Bacteria | 5772 |
| 487 | Ga0495642_0143559 | 3300046528 | Bacteria | 1031 |
| 488 | Ga0495652_0288269 | 3300046529 | Bacteria | 1199 |
| 489 | Ga0495665_0070843 | 3300046531 | Bacteria | 1837 |
| 490 | Ga0495586_0359238 | 3300046535 | Bacteria | 837 |
| 491 | Ga0495597_0004546 | 3300046542 | Bacteria | 7588 |
| 492 | Ga0495597_0190701 | 3300046542 | Bacteria | 825 |
| 493 | Ga0495656_0139697 | 3300046615 | Unclassified | 1161 |
| 494 | Ga0495668_0074729 | 3300046616 | Bacteria | 1861 |
| 495 | Ga0495668_0183596 | 3300046616 | Bacteria | 1146 |
| 496 | Ga0495611_0080171 | 3300046648 | Bacteria | 1500 |
| 497 | Ga0495625_0008948 | 3300046660 | Bacteria | 8458 |
| 498 | Ga0495625_0010840 | 3300046660 | Bacteria | 7495 |
| 499 | Ga0495659_0016257 | 3300046664 | Unclassified | 2453 |
| 500 | Ga0495647_0145203 | 3300046681 | Bacteria | 1014 |
| 501 | Ga0495658_0083733 | 3300046683 | Unclassified | 1877 |
| 502 | Ga0495649_0000211 | 3300046694 | Bacteria | 51291 |
| 503 | Ga0495649_0000298 | 3300046694 | Bacteria | 43334 |
| 504 | Ga0495589_0087591 | 3300046794 | Bacteria | 1512 |
| 505 | Ga0495674_0026722 | 3300047319 | Bacteria | 5279 |
| 506 | Ga0495674_0601977 | 3300047319 | Bacteria | 871 |
| 507 | Ga0495672_0006385 | 3300047320 | Bacteria | 9153 |
| 508 | Ga0495672_0034691 | 3300047320 | Bacteria | 3114 |
| 509 | Ga0495683_0140859 | 3300047323 | Bacteria | 1130 |
| 510 | Ga0495687_000259 | 3300047443 | Bacteria | 71307 |
| 511 | Ga0495677_0054401 | 3300047445 | Bacteria | 1476 |
| 512 | Ga0495673_0006234 | 3300047469 | Bacteria | 7053 |
| 513 | Ga0495686_0003932 | 3300047472 | Bacteria | 12502 |
| 514 | Ga0495626_0034293 | 3300048091 | Bacteria | 2428 |
| 515 | Ga0495626_0056677 | 3300048091 | Bacteria | 1793 |
| 516 | Ga0496100_0001348 | 3300048903 | Bacteria | 12020 |
| 517 | Ga0496100_0149472 | 3300048903 | Bacteria | 1664 |
| 518 | Ga0496100_0229195 | 3300048903 | Bacteria | 1366 |
| 519 | Ga0496101_0001261 | 3300048904 | Bacteria | 15149 |
| 520 | Ga0496102_0006910 | 3300048905 | Bacteria | 9680 |
| 521 | Ga0496103_0001888 | 3300048906 | Bacteria | 13621 |
| 522 | Ga0496103_0093533 | 3300048906 | Bacteria | 1898 |
| 523 | Ga0496104_0073344 | 3300048907 | Bacteria | 3256 |
| 524 | Ga0496105_0023528 | 3300048908 | Bacteria | 4998 |
| 525 | Ga0496105_0048394 | 3300048908 | Bacteria | 3509 |
| 526 | Ga0496105_0766954 | 3300048908 | Bacteria | 735 |
| 527 | Ga0496106_0221667 | 3300048909 | Bacteria | 1508 |
| 528 | Ga0496106_0222647 | 3300048909 | Bacteria | 1505 |
| 529 | Ga0496106_0259801 | 3300048909 | Bacteria | 1389 |
| 530 | Ga0496107_0123045 | 3300048910 | Bacteria | 1911 |
| 531 | Ga0496112_0011547 | 3300048915 | Bacteria | 8072 |
| 532 | Ga0496112_0017817 | 3300048915 | Bacteria | 6684 |
| 533 | Ga0496112_0536782 | 3300048915 | Bacteria | 1104 |
| 534 | Ga0496113_0083113 | 3300048916 | Bacteria | 2456 |
| 535 | Ga0496115_0004797 | 3300048918 | Bacteria | 9812 |
| 536 | Ga0496116_0035675 | 3300048919 | Bacteria | 3490 |
| 537 | Ga0496116_0097322 | 3300048919 | Bacteria | 1770 |
| 538 | Ga0496117_0000067 | 3300048920 | Bacteria | 249348 |
| 539 | Ga0496117_0003940 | 3300048920 | Bacteria | 16796 |
| 540 | Ga0496117_0035005 | 3300048920 | Bacteria | 3776 |
| 541 | Ga0496118_0000021 | 3300048921 | Bacteria | 444988 |
| 542 | Ga0496118_0000574 | 3300048921 | Bacteria | 60884 |
| 543 | Ga0496118_0002726 | 3300048921 | Bacteria | 23282 |
| 544 | Ga0496119_0000362 | 3300048922 | Bacteria | 63745 |
| 545 | Ga0496119_0011134 | 3300048922 | Bacteria | 7491 |
| 546 | Ga0496119_0012940 | 3300048922 | Bacteria | 6712 |
| 547 | Ga0496120_0000042 | 3300048923 | Bacteria | 197055 |
| 548 | Ga0496120_0000341 | 3300048923 | Bacteria | 77155 |
| 549 | Ga0496120_0000744 | 3300048923 | Bacteria | 47495 |
| 550 | Ga0496120_0047130 | 3300048923 | Bacteria | 2486 |
| 551 | Ga0496120_0057999 | 3300048923 | Bacteria | 2176 |
| 552 | Ga0496121_0000169 | 3300048924 | Bacteria | 144577 |
| 553 | Ga0496121_0000877 | 3300048924 | Bacteria | 54435 |
| 554 | Ga0496121_0002108 | 3300048924 | Bacteria | 31297 |
| 555 | Ga0496121_0039264 | 3300048924 | Bacteria | 4175 |
| 556 | Ga0496121_0073244 | 3300048924 | Bacteria | 2746 |
| 557 | Ga0496121_0367222 | 3300048924 | Bacteria | 953 |
| 558 | Ga0496124_0061127 | 3300048927 | Bacteria | 3158 |
| 559 | Ga0496125_0043123 | 3300048928 | Bacteria | 3834 |
| 560 | Ga0496125_0176131 | 3300048928 | Bacteria | 1431 |
| 561 | Ga0496126_0008478 | 3300048929 | Bacteria | 11086 |
| 562 | Ga0496126_0021075 | 3300048929 | Bacteria | 6375 |
| 563 | Ga0501308_001501 | 3300049128 | Bacteria | 1882 |
| 564 | Ga0501310_007891 | 3300049130 | Bacteria | 1145 |
| 565 | Ga0495678_015483 | 3300049459 | Bacteria | 3506 |
| 566 | Ga0495682_0000499 | 3300049460 | Bacteria | 27163 |
| 567 | Ga0495682_0017496 | 3300049460 | Bacteria | 2705 |
| 568 | Ga0501296_002571 | 3300049519 | Bacteria | 1905 |
| 569 | Ga0501297_013438 | 3300049520 | Bacteria | 961 |
| 570 | Ga0501300_005790 | 3300049523 | Bacteria | 1819 |
| 571 | Ga0501031_0051918 | 3300049568 | Bacteria | 2671 |
| 572 | Ga0501032_0025115 | 3300049569 | Bacteria | 4108 |
| 573 | Ga0501033_0111007 | 3300049570 | Bacteria | 1995 |
| 574 | Ga0501034_0020548 | 3300049571 | Bacteria | 6744 |
| 575 | Ga0501036_0018760 | 3300049572 | Bacteria | 5801 |
| 576 | Ga0501037_0002515 | 3300049573 | Bacteria | 13237 |
| 577 | Ga0501037_0010746 | 3300049573 | Bacteria | 6726 |
| 578 | Ga0501038_0115445 | 3300049574 | Bacteria | 2219 |
| 579 | Ga0501039_0148964 | 3300049575 | Bacteria | 1839 |
| 580 | Ga0501040_0015792 | 3300049576 | Bacteria | 4990 |
| 581 | Ga0501040_0375309 | 3300049576 | Unclassified | 1020 |
| 582 | Ga0501041_0008666 | 3300049577 | Bacteria | 5990 |
| 583 | Ga0501041_0334588 | 3300049577 | Unclassified | 956 |
| 584 | Ga0501042_0009104 | 3300049578 | Bacteria | 6599 |
| 585 | Ga0501042_0720115 | 3300049578 | Bacteria | 726 |
| 586 | Ga0501043_0015781 | 3300049579 | Bacteria | 5921 |
| 587 | Ga0501047_0357861 | 3300049581 | Bacteria | 1296 |
| 588 | Ga0501048_0081693 | 3300049582 | Bacteria | 2279 |
| 589 | Ga0501068_0007858 | 3300049584 | Bacteria | 5910 |
| 590 | Ga0501069_0049080 | 3300049585 | Bacteria | 2345 |
| 591 | Ga0501070_0005064 | 3300049586 | Bacteria | 11231 |
| 592 | Ga0501071_0026940 | 3300049587 | Bacteria | 4040 |
| 593 | Ga0501071_0291594 | 3300049587 | Bacteria | 1236 |
| 594 | Ga0501072_0027737 | 3300049588 | Bacteria | 4417 |
| 595 | Ga0501072_0203536 | 3300049588 | Bacteria | 1578 |
| 596 | Ga0501072_0206493 | 3300049588 | Bacteria | 1566 |
| 597 | Ga0501072_0490310 | 3300049588 | Bacteria | 972 |
| 598 | Ga0501073_0003785 | 3300049589 | Bacteria | 11373 |
| 599 | Ga0501073_0196349 | 3300049589 | Bacteria | 1396 |
| 600 | Ga0501074_0011460 | 3300049590 | Bacteria | 6449 |
| 601 | Ga0501075_0006370 | 3300049591 | Bacteria | 8122 |
| 602 | Ga0501075_0016208 | 3300049591 | Bacteria | 5364 |
| 603 | Ga0501075_0559771 | 3300049591 | Bacteria | 872 |
| 604 | Ga0501076_0016177 | 3300049592 | Bacteria | 5649 |
| 605 | Ga0501077_0111672 | 3300049593 | Bacteria | 1732 |
| 606 | Ga0501201_001004 | 3300049651 | Bacteria | 2648 |
| 607 | Ga0501222_004389 | 3300049662 | Bacteria | 1913 |
| 608 | Ga0501233_004320 | 3300049668 | Bacteria | 2598 |
| 609 | Ga0501242_015669 | 3300049674 | Bacteria | 946 |
| 610 | Ga0501249_009741 | 3300049679 | Bacteria | 1999 |
| 611 | Ga0501221_001282 | 3300049704 | Bacteria | 4149 |
| 612 | Ga0501229_005760 | 3300049706 | Bacteria | 1525 |
| 613 | Ga0501080_0001892 | 3300049742 | Bacteria | 18029 |
| 614 | Ga0501080_0083436 | 3300049742 | Bacteria | 2968 |
| 615 | Ga0501081_0044711 | 3300049743 | Bacteria | 3040 |
| 616 | Ga0501081_0252352 | 3300049743 | Bacteria | 1288 |
| 617 | Ga0501266_000425 | 3300049763 | Bacteria | 5612 |
| 618 | Ga0501272_001778 | 3300049769 | Bacteria | 2091 |
| 619 | Ga0501274_003883 | 3300049771 | Bacteria | 1217 |
| 620 | Ga0501035_0013142 | 3300049822 | Bacteria | 7642 |
| 621 | Ga0501044_0004263 | 3300049823 | Bacteria | 16046 |
| 622 | Ga0501045_0076036 | 3300049824 | Bacteria | 2473 |
| 623 | nmdc:mga03683_2478_c1 | 3300050489 | Bacteria | 5741 |
| 624 | nmdc:mga03683_75684_c1 | 3300050489 | Bacteria | 1446 |
| 625 | nmdc:mga03n38_230411_c1 | 3300050490 | Bacteria | 971 |
| 626 | nmdc:mga00v17_209918_c1 | 3300050491 | Bacteria | 1260 |
| 627 | nmdc:mga00v17_48921_c1 | 3300050491 | Bacteria | 2563 |
| 628 | nmdc:mga0yw44_11630_c1 | 3300050492 | Bacteria | 4554 |
| 629 | nmdc:mga0k408_12157_c1 | 3300050493 | Bacteria | 4702 |
| 630 | nmdc:mga0k408_44012_c1 | 3300050493 | Bacteria | 2574 |
| 631 | nmdc:mga0k408_53202_c1 | 3300050493 | Bacteria | 2346 |
| 632 | nmdc:mga0k408_65992_c1 | 3300050493 | Bacteria | 2107 |
| 633 | nmdc:mga06z11_12478_c1 | 3300050494 | Bacteria | 3698 |
| 634 | nmdc:mga06z11_169643_c1 | 3300050494 | Bacteria | 1252 |
| 635 | nmdc:mga04h51_4999_c1 | 3300050495 | Bacteria | 3347 |
| 636 | nmdc:mga07m45_1177_c1 | 3300050496 | Bacteria | 11780 |
| 637 | nmdc:mga07m45_11889_c1 | 3300050496 | Bacteria | 4585 |
| 638 | nmdc:mga07m45_24612_c1 | 3300050496 | Bacteria | 3300 |
| 639 | nmdc:mga07m45_24747_c1 | 3300050496 | Bacteria | 3291 |
| 640 | nmdc:mga07m45_35628_c1 | 3300050496 | Bacteria | 2769 |
| 641 | nmdc:mga07m45_67822_c1 | 3300050496 | Bacteria | 2027 |
| 642 | nmdc:mga05p37_226217_c1 | 3300050507 | Bacteria | 2256 |
| 643 | nmdc:mga05p37_234617_c1 | 3300050507 | Bacteria | 2209 |
| 644 | nmdc:mga05p37_25817_c1 | 3300050507 | Bacteria | 7143 |
| 645 | nmdc:mga05p37_66002_c2 | 3300050507 | Unclassified | 3070 |
| 646 | nmdc:mga05p37_8138_c1 | 3300050507 | Bacteria | 12395 |
| 647 | nmdc:mga09592_296439_c1 | 3300050508 | Bacteria | 1402 |
| 648 | nmdc:mga0qj67_82513_c1 | 3300050509 | Bacteria | 2578 |
| 649 | nmdc:mga06r32_382306_c1 | 3300050510 | Bacteria | 1391 |
| 650 | nmdc:mga06r32_408345_c1 | 3300050510 | Bacteria | 1340 |
| 651 | nmdc:mga08y16_40239_c1 | 3300050511 | Unclassified | 4900 |
| 652 | nmdc:mga0n895_208645_c1 | 3300050512 | Bacteria | 1984 |
| 653 | nmdc:mga0n895_241958_c1 | 3300050512 | Unclassified | 1831 |
| 654 | nmdc:mga08x19_15033_c1 | 3300050514 | Bacteria | 4701 |
| 655 | nmdc:mga0a205_91295_c1 | 3300050515 | Unclassified | 2943 |
| 656 | nmdc:mga0sz30_3643_c1 | 3300050516 | Bacteria | 5242 |
| 657 | Ga0500578_0000025 | 3300053086 | Bacteria | 151485 |
| 658 | Ga0500643_085364 | 3300053087 | Bacteria | 864 |
| 659 | Ga0500646_0019797 | 3300053090 | Bacteria | 1783 |
| 660 | Ga0500562_016708 | 3300053108 | Bacteria | 1888 |
| 661 | Ga0500628_066969 | 3300053129 | Bacteria | 891 |
| 662 | Ga0500658_0056849 | 3300053134 | Bacteria | 1615 |
| 663 | Ga0500559_0015943 | 3300053136 | Bacteria | 3172 |
| 664 | Ga0500564_126533 | 3300053138 | Bacteria | 1109 |
| 665 | Ga0500568_0005699 | 3300053139 | Bacteria | 6388 |
| 666 | Ga0500568_0016467 | 3300053139 | Bacteria | 3286 |
| 667 | Ga0500604_0007009 | 3300053151 | Bacteria | 2984 |
| 668 | Ga0500616_0089221 | 3300053153 | Bacteria | 1531 |
| 669 | Ga0500622_0004094 | 3300053156 | Bacteria | 9339 |
| 670 | Ga0500622_0005022 | 3300053156 | Bacteria | 8063 |
| 671 | Ga0500636_0107404 | 3300053177 | Bacteria | 1580 |
| 672 | Ga0500625_011277 | 3300053729 | Bacteria | 4054 |
| 673 | Ga0590071_002298 | 3300059421 | Bacteria | 4840 |
| 674 | Ga0590075_093321 | 3300059424 | Bacteria | 782 |
| 675 | Ga0501082_0041018 | 3300060353 | Bacteria | 3990 |
| 676 | Ga0501082_0157552 | 3300060353 | Bacteria | 1973 |
| 677 | Ga0466962_0034671 | 3300061719 | Bacteria | 2415 |
| 678 | Ga0530510_0059855 | 3300061734 | Bacteria | 2755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0252352 | Ga0501081_0252352_740_1258 | 171 |
| 2 | 3300012487 | Ga0157321_1008976 | Ga0157321_10089761 | 174 |
| 3 | 3300031507 | Ga0307509_10010341 | Ga0307509_100103415 | 194 |
| 4 | 3300005545 | Ga0070695_100065331 | Ga0070695_1000653313 | 197 |
| 5 | 3300006038 | Ga0075365_10220865 | Ga0075365_102208653 | 197 |
| 6 | 3300006042 | Ga0075368_10002555 | Ga0075368_100025554 | 197 |
| 7 | 3300006048 | Ga0075363_100000257 | Ga0075363_10000025713 | 197 |
| 8 | 3300006051 | Ga0075364_10054342 | Ga0075364_100543422 | 197 |
| 9 | 3300006177 | Ga0075362_10000645 | Ga0075362_100006455 | 197 |
| 10 | 3300006178 | Ga0075367_10001844 | Ga0075367_100018443 | 197 |
| 11 | 3300006178 | Ga0075367_10119232 | Ga0075367_101192323 | 197 |
| 12 | 3300006186 | Ga0075369_10005125 | Ga0075369_100051254 | 197 |
| 13 | 3300006195 | Ga0075366_10109609 | Ga0075366_101096092 | 197 |
| 14 | 3300006353 | Ga0075370_10000235 | Ga0075370_100002354 | 197 |
| 15 | 3300006353 | Ga0075370_10002670 | Ga0075370_100026709 | 197 |
| 16 | 3300006358 | Ga0068871_100718675 | Ga0068871_1007186751 | 197 |
| 17 | 3300006844 | Ga0075428_100310146 | Ga0075428_1003101462 | 197 |
| 18 | 3300006844 | Ga0075428_101066772 | Ga0075428_1010667722 | 197 |
| 19 | 3300006846 | Ga0075430_100066749 | Ga0075430_1000667492 | 197 |
| 20 | 3300006847 | Ga0075431_100064105 | Ga0075431_1000641052 | 197 |
| 21 | 3300006852 | Ga0075433_10076721 | Ga0075433_100767212 | 197 |
| 22 | 3300006871 | Ga0075434_100150286 | Ga0075434_1001502862 | 197 |
| 23 | 3300006871 | Ga0075434_100310067 | Ga0075434_1003100672 | 197 |
| 24 | 3300009147 | Ga0114129_10027695 | Ga0114129_100276953 | 197 |
| 25 | 3300009147 | Ga0114129_10037014 | Ga0114129_100370146 | 197 |
| 26 | 3300012477 | Ga0157336_1001030 | Ga0157336_10010302 | 197 |
| 27 | 3300013297 | Ga0157378_10267713 | Ga0157378_102677132 | 197 |
| 28 | 3300013306 | Ga0163162_11121899 | Ga0163162_111218991 | 197 |
| 29 | 3300026088 | Ga0207641_10572746 | Ga0207641_105727462 | 197 |
| 30 | 3300027695 | Ga0209966_1008929 | Ga0209966_10089293 | 197 |
| 31 | 3300027717 | Ga0209998_10023569 | Ga0209998_100235691 | 197 |
| 32 | 3300027866 | Ga0209813_10001664 | Ga0209813_100016646 | 197 |
| 33 | 3300031730 | Ga0307516_10102606 | Ga0307516_101026063 | 197 |
| 34 | 3300031901 | Ga0307406_10122815 | Ga0307406_101228152 | 197 |
| 35 | 3300035114 | Ga0373939_0085252 | Ga0373939_0085252_83_679 | 197 |
| 36 | 3300035695 | Ga0373927_0302473 | Ga0373927_0302473_412_1008 | 197 |
| 37 | 3300035725 | Ga0373947_0028546 | Ga0373947_0028546_473_1069 | 197 |
| 38 | 3300037068 | Ga0373925_0031306 | Ga0373925_0031306_3069_3665 | 197 |
| 39 | 3300042001 | Ga0439441_030748 | Ga0439441_030748_167_763 | 197 |
| 40 | 3300046472 | Ga0495580_0091438 | Ga0495580_0091438_1468_2064 | 197 |
| 41 | 3300046473 | Ga0495582_0284477 | Ga0495582_0284477_53_649 | 197 |
| 42 | 3300046615 | Ga0495656_0139697 | Ga0495656_0139697_94_690 | 197 |
| 43 | 3300046616 | Ga0495668_0074729 | Ga0495668_0074729_552_1145 | 197 |
| 44 | 3300046664 | Ga0495659_0016257 | Ga0495659_0016257_30_626 | 197 |
| 45 | 3300046683 | Ga0495658_0083733 | Ga0495658_0083733_89_685 | 197 |
| 46 | 3300047319 | Ga0495674_0601977 | Ga0495674_0601977_65_661 | 197 |
| 47 | 3300049568 | Ga0501031_0051918 | Ga0501031_0051918_183_779 | 197 |
| 48 | 3300049569 | Ga0501032_0025115 | Ga0501032_0025115_1054_1650 | 197 |
| 49 | 3300049570 | Ga0501033_0111007 | Ga0501033_0111007_1248_1844 | 197 |
| 50 | 3300049571 | Ga0501034_0020548 | Ga0501034_0020548_375_971 | 197 |
| 51 | 3300049572 | Ga0501036_0018760 | Ga0501036_0018760_4557_5153 | 197 |
| 52 | 3300049573 | Ga0501037_0002515 | Ga0501037_0002515_7627_8223 | 197 |
| 53 | 3300049574 | Ga0501038_0115445 | Ga0501038_0115445_1249_1845 | 197 |
| 54 | 3300049575 | Ga0501039_0148964 | Ga0501039_0148964_1188_1784 | 197 |
| 55 | 3300049576 | Ga0501040_0015792 | Ga0501040_0015792_2026_2622 | 197 |
| 56 | 3300049577 | Ga0501041_0008666 | Ga0501041_0008666_5020_5616 | 197 |
| 57 | 3300049577 | Ga0501041_0334588 | Ga0501041_0334588_270_866 | 197 |
| 58 | 3300049578 | Ga0501042_0009104 | Ga0501042_0009104_989_1585 | 197 |
| 59 | 3300049579 | Ga0501043_0015781 | Ga0501043_0015781_2026_2622 | 197 |
| 60 | 3300049582 | Ga0501048_0081693 | Ga0501048_0081693_1501_2097 | 197 |
| 61 | 3300049584 | Ga0501068_0007858 | Ga0501068_0007858_4800_5396 | 197 |
| 62 | 3300049585 | Ga0501069_0049080 | Ga0501069_0049080_1107_1703 | 197 |
| 63 | 3300049586 | Ga0501070_0005064 | Ga0501070_0005064_2794_3390 | 197 |
| 64 | 3300049588 | Ga0501072_0027737 | Ga0501072_0027737_521_1117 | 197 |
| 65 | 3300049588 | Ga0501072_0490310 | Ga0501072_0490310_64_660 | 197 |
| 66 | 3300049589 | Ga0501073_0003785 | Ga0501073_0003785_6278_6874 | 197 |
| 67 | 3300049590 | Ga0501074_0011460 | Ga0501074_0011460_5408_6004 | 197 |
| 68 | 3300049591 | Ga0501075_0016208 | Ga0501075_0016208_91_687 | 197 |
| 69 | 3300049592 | Ga0501076_0016177 | Ga0501076_0016177_376_972 | 197 |
| 70 | 3300049593 | Ga0501077_0111672 | Ga0501077_0111672_975_1571 | 197 |
| 71 | 3300049742 | Ga0501080_0083436 | Ga0501080_0083436_1230_1826 | 197 |
| 72 | 3300049743 | Ga0501081_0044711 | Ga0501081_0044711_36_632 | 197 |
| 73 | 3300049822 | Ga0501035_0013142 | Ga0501035_0013142_1976_2572 | 197 |
| 74 | 3300049823 | Ga0501044_0004263 | Ga0501044_0004263_10770_11366 | 197 |
| 75 | 3300049824 | Ga0501045_0076036 | Ga0501045_0076036_67_663 | 197 |
| 76 | 3300050507 | nmdc:mga05p37_226217_c1 | nmdc:mga05p37_226217_c1_1175_1771 | 197 |
| 77 | 3300050507 | nmdc:mga05p37_66002_c2 | nmdc:mga05p37_66002_c2_1483_2079 | 197 |
| 78 | 3300050508 | nmdc:mga09592_296439_c1 | nmdc:mga09592_296439_c1_578_1174 | 197 |
| 79 | 3300050510 | nmdc:mga06r32_382306_c1 | nmdc:mga06r32_382306_c1_530_1126 | 197 |
| 80 | 3300050511 | nmdc:mga08y16_40239_c1 | nmdc:mga08y16_40239_c1_1287_1883 | 197 |
| 81 | 3300050512 | nmdc:mga0n895_208645_c1 | nmdc:mga0n895_208645_c1_401_997 | 197 |
| 82 | 3300050512 | nmdc:mga0n895_241958_c1 | nmdc:mga0n895_241958_c1_250_846 | 197 |
| 83 | 3300050515 | nmdc:mga0a205_91295_c1 | nmdc:mga0a205_91295_c1_1325_1921 | 197 |
| 84 | 3300059421 | Ga0590071_002298 | Ga0590071_002298_2971_3567 | 197 |
| 85 | 3300060353 | Ga0501082_0041018 | Ga0501082_0041018_3019_3615 | 197 |
| 86 | 3300061734 | Ga0530510_0059855 | Ga0530510_0059855_1992_2588 | 197 |
| 87 | iso_pu_bacteria | 2585428057 | 2587725643 | 200 |
| 88 | iso_pu_bacteria | 2585428058 | 2587735077 | 200 |
| 89 | iso_pu_bacteria | 2588253510 | 2588290573 | 200 |
| 90 | iso_pu_bacteria | 2643221592 | 2643968288 | 200 |
| 91 | iso_pu_bacteria | 2643221625 | 2644143559 | 200 |
| 92 | iso_pu_bacteria | 2643221648 | 2644272066 | 200 |
| 93 | 3300005336 | Ga0070680_100238870 | Ga0070680_1002388702 | 201 |
| 94 | 3300005458 | Ga0070681_10269399 | Ga0070681_102693992 | 201 |
| 95 | 3300005545 | Ga0070695_100694331 | Ga0070695_1006943311 | 201 |
| 96 | 3300025912 | Ga0207707_10002429 | Ga0207707_100024292 | 201 |
| 97 | iso_pu_bacteria | 2643221639 | 2644219482 | 201 |
| 98 | iso_pu_bacteria | 2643221644 | 2644243258 | 201 |
| 99 | iso_pu_bacteria | 2643221646 | 2644255912 | 201 |
| 100 | iso_pu_bacteria | 2738541337 | 2739054368 | 201 |
| 101 | iso_pu_bacteria | 2831864461 | 2831868765 | 201 |
| 102 | iso_pu_bacteria | 2886848708 | 2886851906 | 201 |
| 103 | 3300003354 | JGI25160J50197_1000120 | JGI25160J50197_100012026 | 202 |
| 104 | 3300005262 | Ga0065165_1000382 | Ga0065165_100038226 | 202 |
| 105 | 3300025302 | Ga0207426_1000004 | Ga0207426_1000004454 | 202 |
| 106 | 3300037471 | Ga0395905_0000039 | Ga0395905_0000039_195334_195942 | 202 |
| 107 | 3300037471 | Ga0395905_0015670 | Ga0395905_0015670_2731_3339 | 202 |
| 108 | 3300046457 | Ga0495590_0001608 | Ga0495590_0001608_4449_5057 | 202 |
| 109 | 3300046474 | Ga0495605_0043124 | Ga0495605_0043124_1186_1794 | 202 |
| 110 | 3300046474 | Ga0495605_0080517 | Ga0495605_0080517_34_642 | 202 |
| 111 | 3300046506 | Ga0495583_0000449 | Ga0495583_0000449_3748_4356 | 202 |
| 112 | 3300046524 | Ga0495648_0014477 | Ga0495648_0014477_2642_3250 | 202 |
| 113 | 3300046542 | Ga0495597_0190701 | Ga0495597_0190701_75_683 | 202 |
| 114 | 3300046694 | Ga0495649_0000211 | Ga0495649_0000211_46963_47571 | 202 |
| 115 | 3300047320 | Ga0495672_0006385 | Ga0495672_0006385_7977_8585 | 202 |
| 116 | 3300047323 | Ga0495683_0140859 | Ga0495683_0140859_365_973 | 202 |
| 117 | 3300047445 | Ga0495677_0054401 | Ga0495677_0054401_846_1454 | 202 |
| 118 | 3300047469 | Ga0495673_0006234 | Ga0495673_0006234_3102_3710 | 202 |
| 119 | 3300048903 | Ga0496100_0001348 | Ga0496100_0001348_5295_5903 | 202 |
| 120 | 3300048904 | Ga0496101_0001261 | Ga0496101_0001261_13239_13847 | 202 |
| 121 | 3300048905 | Ga0496102_0006910 | Ga0496102_0006910_5228_5836 | 202 |
| 122 | 3300048906 | Ga0496103_0001888 | Ga0496103_0001888_11083_11691 | 202 |
| 123 | 3300048908 | Ga0496105_0048394 | Ga0496105_0048394_557_1165 | 202 |
| 124 | 3300048908 | Ga0496105_0766954 | Ga0496105_0766954_99_707 | 202 |
| 125 | 3300048909 | Ga0496106_0221667 | Ga0496106_0221667_737_1345 | 202 |
| 126 | 3300048915 | Ga0496112_0536782 | Ga0496112_0536782_376_984 | 202 |
| 127 | 3300048920 | Ga0496117_0003940 | Ga0496117_0003940_13220_13828 | 202 |
| 128 | 3300048921 | Ga0496118_0000574 | Ga0496118_0000574_13219_13827 | 202 |
| 129 | 3300048924 | Ga0496121_0000877 | Ga0496121_0000877_40589_41197 | 202 |
| 130 | 3300049460 | Ga0495682_0000499 | Ga0495682_0000499_22808_23416 | 202 |
| 131 | iso_pu_bacteria | 2894023352 | 2894027469 | 202 |
| 132 | 3300005548 | Ga0070665_100000179 | Ga0070665_10000017915 | 203 |
| 133 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012350 | 203 |
| 134 | 3300049587 | Ga0501071_0026940 | Ga0501071_0026940_631_1245 | 203 |
| 135 | 3300049588 | Ga0501072_0206493 | Ga0501072_0206493_418_1032 | 203 |
| 136 | 3300049589 | Ga0501073_0196349 | Ga0501073_0196349_631_1245 | 203 |
| 137 | 3300049591 | Ga0501075_0006370 | Ga0501075_0006370_3017_3631 | 203 |
| 138 | 3300049742 | Ga0501080_0001892 | Ga0501080_0001892_11412_12026 | 203 |
| 139 | iso_pu_bacteria | 2842718218 | 2842720463 | 203 |
| 140 | iso_pu_bacteria | 2974320154 | 2974321355 | 203 |
| 141 | 3300002773 | JGI25152J39213_1001436 | JGI25152J39213_10014365 | 204 |
| 142 | 3300003320 | rootH2_10000113 | rootH2_1000011324 | 204 |
| 143 | 3300003771 | Ga0055526_1001497 | Ga0055526_100149714 | 204 |
| 144 | 3300005262 | Ga0065165_1001129 | Ga0065165_100112913 | 204 |
| 145 | 3300005327 | Ga0070658_10012913 | Ga0070658_100129135 | 204 |
| 146 | 3300005335 | Ga0070666_10000010 | Ga0070666_1000001043 | 204 |
| 147 | 3300005344 | Ga0070661_100096203 | Ga0070661_1000962033 | 204 |
| 148 | 3300005367 | Ga0070667_100136741 | Ga0070667_1001367413 | 204 |
| 149 | 3300005548 | Ga0070665_100067913 | Ga0070665_1000679133 | 204 |
| 150 | 3300005577 | Ga0068857_100105739 | Ga0068857_1001057392 | 204 |
| 151 | 3300005843 | Ga0068860_100032799 | Ga0068860_1000327993 | 204 |
| 152 | 3300009093 | Ga0105240_10030798 | Ga0105240_100307984 | 204 |
| 153 | 3300009551 | Ga0105238_10001392 | Ga0105238_100013923 | 204 |
| 154 | 3300010375 | Ga0105239_10000056 | Ga0105239_1000005644 | 204 |
| 155 | 3300013306 | Ga0163162_10010624 | Ga0163162_100106247 | 204 |
| 156 | 3300014325 | Ga0163163_10764277 | Ga0163163_107642771 | 204 |
| 157 | 3300025245 | Ga0207425_1000407 | Ga0207425_100040710 | 204 |
| 158 | 3300025258 | Ga0209129_1000175 | Ga0209129_100017580 | 204 |
| 159 | 3300025273 | Ga0209673_1005494 | Ga0209673_10054944 | 204 |
| 160 | 3300025273 | Ga0209673_1010530 | Ga0209673_10105302 | 204 |
| 161 | 3300025295 | Ga0209564_1000136 | Ga0209564_100013686 | 204 |
| 162 | 3300025297 | Ga0209758_1000275 | Ga0209758_100027535 | 204 |
| 163 | 3300025297 | Ga0209758_1000902 | Ga0209758_100090211 | 204 |
| 164 | 3300025298 | Ga0209050_1001381 | Ga0209050_100138122 | 204 |
| 165 | 3300025304 | Ga0209257_1018869 | Ga0209257_10188692 | 204 |
| 166 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002347 | 204 |
| 167 | 3300025913 | Ga0207695_10000243 | Ga0207695_100002436 | 204 |
| 168 | 3300025913 | Ga0207695_10000663 | Ga0207695_1000066338 | 204 |
| 169 | 3300025920 | Ga0207649_10057883 | Ga0207649_100578833 | 204 |
| 170 | 3300025924 | Ga0207694_10001367 | Ga0207694_100013673 | 204 |
| 171 | 3300025972 | Ga0207668_10139877 | Ga0207668_101398772 | 204 |
| 172 | 3300026116 | Ga0207674_10089333 | Ga0207674_100893332 | 204 |
| 173 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004341 | 204 |
| 174 | 3300028381 | Ga0268264_10063733 | Ga0268264_100637332 | 204 |
| 175 | 3300031456 | Ga0307513_10100596 | Ga0307513_101005962 | 204 |
| 176 | 3300031691 | Ga0316579_10000135 | Ga0316579_1000013510 | 204 |
| 177 | 3300031691 | Ga0316579_10157055 | Ga0316579_101570551 | 204 |
| 178 | 3300031728 | Ga0316578_10105087 | Ga0316578_101050872 | 204 |
| 179 | 3300031728 | Ga0316578_10427264 | Ga0316578_104272641 | 204 |
| 180 | 3300031733 | Ga0316577_10186726 | Ga0316577_101867261 | 204 |
| 181 | 3300032133 | Ga0316583_10005122 | Ga0316583_100051225 | 204 |
| 182 | 3300032133 | Ga0316583_10041673 | Ga0316583_100416732 | 204 |
| 183 | 3300032139 | Ga0316580_10115248 | Ga0316580_101152481 | 204 |
| 184 | 3300033180 | Ga0307510_10032571 | Ga0307510_100325713 | 204 |
| 185 | 3300035691 | Ga0373931_0022281 | Ga0373931_0022281_2345_2959 | 204 |
| 186 | 3300036647 | Ga0316582_0000046 | Ga0316582_0000046_4442_5059 | 204 |
| 187 | 3300036647 | Ga0316582_0030887 | Ga0316582_0030887_665_1282 | 204 |
| 188 | 3300036712 | Ga0316584_0019859 | Ga0316584_0019859_1691_2308 | 204 |
| 189 | 3300037588 | Ga0316581_0072075 | Ga0316581_0072075_289_906 | 204 |
| 190 | 3300044712 | Ga0453684_0144892 | Ga0453684_0144892_460_1074 | 204 |
| 191 | 3300046471 | Ga0495650_0000203 | Ga0495650_0000203_108928_109545 | 204 |
| 192 | 3300046507 | Ga0495606_0156435 | Ga0495606_0156435_204_821 | 204 |
| 193 | 3300046519 | Ga0495632_0251699 | Ga0495632_0251699_113_730 | 204 |
| 194 | 3300046660 | Ga0495625_0008948 | Ga0495625_0008948_188_805 | 204 |
| 195 | 3300048903 | Ga0496100_0149472 | Ga0496100_0149472_346_963 | 204 |
| 196 | 3300048903 | Ga0496100_0229195 | Ga0496100_0229195_383_1000 | 204 |
| 197 | 3300048908 | Ga0496105_0023528 | Ga0496105_0023528_4368_4985 | 204 |
| 198 | 3300048909 | Ga0496106_0259801 | Ga0496106_0259801_638_1255 | 204 |
| 199 | 3300048910 | Ga0496107_0123045 | Ga0496107_0123045_249_866 | 204 |
| 200 | 3300048918 | Ga0496115_0004797 | Ga0496115_0004797_6760_7377 | 204 |
| 201 | 3300048919 | Ga0496116_0097322 | Ga0496116_0097322_292_909 | 204 |
| 202 | 3300048920 | Ga0496117_0035005 | Ga0496117_0035005_2395_3012 | 204 |
| 203 | 3300048921 | Ga0496118_0002726 | Ga0496118_0002726_14638_15255 | 204 |
| 204 | 3300048922 | Ga0496119_0000362 | Ga0496119_0000362_12812_13429 | 204 |
| 205 | 3300048922 | Ga0496119_0011134 | Ga0496119_0011134_773_1414 | 204 |
| 206 | 3300048923 | Ga0496120_0000341 | Ga0496120_0000341_26237_26854 | 204 |
| 207 | 3300048923 | Ga0496120_0000744 | Ga0496120_0000744_3014_3655 | 204 |
| 208 | 3300048924 | Ga0496121_0000169 | Ga0496121_0000169_118494_119111 | 204 |
| 209 | 3300048924 | Ga0496121_0002108 | Ga0496121_0002108_16351_16968 | 204 |
| 210 | 3300048924 | Ga0496121_0073244 | Ga0496121_0073244_760_1377 | 204 |
| 211 | 3300048924 | Ga0496121_0367222 | Ga0496121_0367222_117_734 | 204 |
| 212 | 3300048929 | Ga0496126_0008478 | Ga0496126_0008478_2454_3071 | 204 |
| 213 | 3300048929 | Ga0496126_0021075 | Ga0496126_0021075_3928_4569 | 204 |
| 214 | 3300053090 | Ga0500646_0019797 | Ga0500646_0019797_712_1329 | 204 |
| 215 | 3300053129 | Ga0500628_066969 | Ga0500628_066969_245_859 | 204 |
| 216 | iso_pu_bacteria | 2547132374 | 2548500804 | 204 |
| 217 | iso_pu_bacteria | 2643221570 | 2643864229 | 204 |
| 218 | iso_pu_bacteria | 2643221596 | 2643992526 | 204 |
| 219 | iso_pu_bacteria | 2643221652 | 2644292074 | 204 |
| 220 | iso_pu_bacteria | 2643221717 | 2644646645 | 204 |
| 221 | iso_pu_bacteria | 2990710928 | 2990714833 | 204 |
| 222 | 3300002705 | JGI25156J39149_1009299 | JGI25156J39149_10092993 | 205 |
| 223 | 3300002705 | JGI25156J39149_1016439 | JGI25156J39149_10164392 | 205 |
| 224 | 3300002771 | JGI25163J39215_1002977 | JGI25163J39215_10029771 | 205 |
| 225 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001531 | 205 |
| 226 | 3300003323 | rootH1_10078733 | rootH1_100787333 | 205 |
| 227 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001503 | 205 |
| 228 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001503 | 205 |
| 229 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003531 | 205 |
| 230 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003531 | 205 |
| 231 | 3300003761 | Ga0055535_1000097 | Ga0055535_100009718 | 205 |
| 232 | 3300003763 | Ga0055529_1000202 | Ga0055529_100020268 | 205 |
| 233 | 3300003791 | Ga0055530_10000764 | Ga0055530_100007646 | 205 |
| 234 | 3300003791 | Ga0055530_10001161 | Ga0055530_100011619 | 205 |
| 235 | 3300003792 | Ga0055540_1000357 | Ga0055540_100035715 | 205 |
| 236 | 3300003794 | Ga0055531_10016737 | Ga0055531_100167373 | 205 |
| 237 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001531 | 205 |
| 238 | 3300005327 | Ga0070658_10060818 | Ga0070658_100608182 | 205 |
| 239 | 3300005327 | Ga0070658_10428196 | Ga0070658_104281962 | 205 |
| 240 | 3300005331 | Ga0070670_100019957 | Ga0070670_1000199574 | 205 |
| 241 | 3300005334 | Ga0068869_100244373 | Ga0068869_1002443732 | 205 |
| 242 | 3300005338 | Ga0068868_100113107 | Ga0068868_1001131073 | 205 |
| 243 | 3300005364 | Ga0070673_100104622 | Ga0070673_1001046224 | 205 |
| 244 | 3300005366 | Ga0070659_100333978 | Ga0070659_1003339782 | 205 |
| 245 | 3300005367 | Ga0070667_100248445 | Ga0070667_1002484452 | 205 |
| 246 | 3300005445 | Ga0070708_100703490 | Ga0070708_1007034901 | 205 |
| 247 | 3300005457 | Ga0070662_100001459 | Ga0070662_1000014598 | 205 |
| 248 | 3300005457 | Ga0070662_100029344 | Ga0070662_1000293442 | 205 |
| 249 | 3300005459 | Ga0068867_100690295 | Ga0068867_1006902951 | 205 |
| 250 | 3300005543 | Ga0070672_100046459 | Ga0070672_1000464593 | 205 |
| 251 | 3300005563 | Ga0068855_100204845 | Ga0068855_1002048453 | 205 |
| 252 | 3300005616 | Ga0068852_100649096 | Ga0068852_1006490963 | 205 |
| 253 | 3300005840 | Ga0068870_10020325 | Ga0068870_100203251 | 205 |
| 254 | 3300006195 | Ga0075366_10015454 | Ga0075366_100154543 | 205 |
| 255 | 3300006195 | Ga0075366_10059182 | Ga0075366_100591823 | 205 |
| 256 | 3300006195 | Ga0075366_10130409 | Ga0075366_101304093 | 205 |
| 257 | 3300006353 | Ga0075370_10098264 | Ga0075370_100982642 | 205 |
| 258 | 3300006881 | Ga0068865_100013094 | Ga0068865_1000130941 | 205 |
| 259 | 3300006946 | Ga0079104_1000019 | Ga0079104_1000019178 | 205 |
| 260 | 3300009093 | Ga0105240_10087409 | Ga0105240_100874095 | 205 |
| 261 | 3300009093 | Ga0105240_10188392 | Ga0105240_101883922 | 205 |
| 262 | 3300009098 | Ga0105245_10020472 | Ga0105245_100204724 | 205 |
| 263 | 3300009098 | Ga0105245_10383253 | Ga0105245_103832531 | 205 |
| 264 | 3300009148 | Ga0105243_10038186 | Ga0105243_100381864 | 205 |
| 265 | 3300009148 | Ga0105243_10134017 | Ga0105243_101340172 | 205 |
| 266 | 3300009148 | Ga0105243_10163766 | Ga0105243_101637663 | 205 |
| 267 | 3300009148 | Ga0105243_10165374 | Ga0105243_101653743 | 205 |
| 268 | 3300009148 | Ga0105243_10890233 | Ga0105243_108902331 | 205 |
| 269 | 3300009545 | Ga0105237_10026812 | Ga0105237_100268125 | 205 |
| 270 | 3300009545 | Ga0105237_10028608 | Ga0105237_100286084 | 205 |
| 271 | 3300009545 | Ga0105237_10140032 | Ga0105237_101400321 | 205 |
| 272 | 3300010375 | Ga0105239_10006811 | Ga0105239_1000681112 | 205 |
| 273 | 3300011119 | Ga0105246_10174907 | Ga0105246_101749072 | 205 |
| 274 | 3300012497 | Ga0157319_1000002 | Ga0157319_1000002342 | 205 |
| 275 | 3300013100 | Ga0157373_10003612 | Ga0157373_1000361211 | 205 |
| 276 | 3300013105 | Ga0157369_10025778 | Ga0157369_100257784 | 205 |
| 277 | 3300013307 | Ga0157372_10006487 | Ga0157372_1000648711 | 205 |
| 278 | 3300013308 | Ga0157375_11232721 | Ga0157375_112327212 | 205 |
| 279 | 3300014968 | Ga0157379_10501267 | Ga0157379_105012671 | 205 |
| 280 | 3300017792 | Ga0163161_10302456 | Ga0163161_103024562 | 205 |
| 281 | 3300021361 | Ga0213872_10026966 | Ga0213872_100269662 | 205 |
| 282 | 3300025224 | Ga0209784_100004 | Ga0209784_100004525 | 205 |
| 283 | 3300025225 | Ga0209566_100004 | Ga0209566_100004682 | 205 |
| 284 | 3300025226 | Ga0209674_100006 | Ga0209674_100006682 | 205 |
| 285 | 3300025228 | Ga0209672_107976 | Ga0209672_1079762 | 205 |
| 286 | 3300025230 | Ga0209563_100009 | Ga0209563_100009525 | 205 |
| 287 | 3300025233 | Ga0209437_100004 | Ga0209437_100004525 | 205 |
| 288 | 3300025242 | Ga0209258_100162 | Ga0209258_10016270 | 205 |
| 289 | 3300025253 | Ga0209677_100005 | Ga0209677_100005525 | 205 |
| 290 | 3300025253 | Ga0209677_102833 | Ga0209677_1028334 | 205 |
| 291 | 3300025256 | Ga0209759_1000662 | Ga0209759_100066210 | 205 |
| 292 | 3300025256 | Ga0209759_1001643 | Ga0209759_100164311 | 205 |
| 293 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005682 | 205 |
| 294 | 3300025261 | Ga0209233_1006680 | Ga0209233_10066802 | 205 |
| 295 | 3300025272 | Ga0209455_1000128 | Ga0209455_100012877 | 205 |
| 296 | 3300025273 | Ga0209673_1036513 | Ga0209673_10365131 | 205 |
| 297 | 3300025298 | Ga0209050_1000703 | Ga0209050_100070324 | 205 |
| 298 | 3300025298 | Ga0209050_1012767 | Ga0209050_10127672 | 205 |
| 299 | 3300025299 | Ga0209256_1000024 | Ga0209256_1000024152 | 205 |
| 300 | 3300025303 | Ga0209051_1000063 | Ga0209051_100006397 | 205 |
| 301 | 3300025303 | Ga0209051_1002331 | Ga0209051_100233115 | 205 |
| 302 | 3300025304 | Ga0209257_1000118 | Ga0209257_1000118110 | 205 |
| 303 | 3300025304 | Ga0209257_1017132 | Ga0209257_10171323 | 205 |
| 304 | 3300025907 | Ga0207645_10005973 | Ga0207645_100059733 | 205 |
| 305 | 3300025907 | Ga0207645_10144391 | Ga0207645_101443912 | 205 |
| 306 | 3300025909 | Ga0207705_10067122 | Ga0207705_100671224 | 205 |
| 307 | 3300025909 | Ga0207705_10528996 | Ga0207705_105289961 | 205 |
| 308 | 3300025913 | Ga0207695_10109938 | Ga0207695_101099383 | 205 |
| 309 | 3300025913 | Ga0207695_10851117 | Ga0207695_108511172 | 205 |
| 310 | 3300025920 | Ga0207649_10002485 | Ga0207649_100024859 | 205 |
| 311 | 3300025921 | Ga0207652_10052348 | Ga0207652_100523483 | 205 |
| 312 | 3300025931 | Ga0207644_10320433 | Ga0207644_103204332 | 205 |
| 313 | 3300025932 | Ga0207690_10000359 | Ga0207690_1000035910 | 205 |
| 314 | 3300025932 | Ga0207690_10153884 | Ga0207690_101538841 | 205 |
| 315 | 3300025933 | Ga0207706_10237794 | Ga0207706_102377942 | 205 |
| 316 | 3300025935 | Ga0207709_10184489 | Ga0207709_101844891 | 205 |
| 317 | 3300025935 | Ga0207709_10264928 | Ga0207709_102649282 | 205 |
| 318 | 3300025938 | Ga0207704_10085078 | Ga0207704_100850782 | 205 |
| 319 | 3300025942 | Ga0207689_10014268 | Ga0207689_100142684 | 205 |
| 320 | 3300025945 | Ga0207679_10000220 | Ga0207679_1000022033 | 205 |
| 321 | 3300025949 | Ga0207667_10283917 | Ga0207667_102839171 | 205 |
| 322 | 3300025949 | Ga0207667_10365468 | Ga0207667_103654682 | 205 |
| 323 | 3300025949 | Ga0207667_10732850 | Ga0207667_107328502 | 205 |
| 324 | 3300025960 | Ga0207651_10041564 | Ga0207651_100415643 | 205 |
| 325 | 3300025960 | Ga0207651_10070670 | Ga0207651_100706704 | 205 |
| 326 | 3300025981 | Ga0207640_10447630 | Ga0207640_104476302 | 205 |
| 327 | 3300025986 | Ga0207658_10293960 | Ga0207658_102939602 | 205 |
| 328 | 3300026023 | Ga0207677_10059083 | Ga0207677_100590831 | 205 |
| 329 | 3300026023 | Ga0207677_10881646 | Ga0207677_108816462 | 205 |
| 330 | 3300026089 | Ga0207648_10003244 | Ga0207648_1000324416 | 205 |
| 331 | 3300026089 | Ga0207648_10066865 | Ga0207648_100668652 | 205 |
| 332 | 3300026089 | Ga0207648_10545945 | Ga0207648_105459452 | 205 |
| 333 | 3300026142 | Ga0207698_11355747 | Ga0207698_113557471 | 205 |
| 334 | 3300027111 | Ga0209281_1000149 | Ga0209281_1000149116 | 205 |
| 335 | 3300028573 | Ga0265334_10074335 | Ga0265334_100743352 | 205 |
| 336 | 3300028666 | Ga0265336_10000008 | Ga0265336_10000008158 | 205 |
| 337 | 3300028794 | Ga0307515_10075287 | Ga0307515_100752875 | 205 |
| 338 | 3300028794 | Ga0307515_10162385 | Ga0307515_101623854 | 205 |
| 339 | 3300029957 | Ga0265324_10003914 | Ga0265324_100039147 | 205 |
| 340 | 3300031507 | Ga0307509_10081638 | Ga0307509_100816383 | 205 |
| 341 | 3300031507 | Ga0307509_10123933 | Ga0307509_101239334 | 205 |
| 342 | 3300031616 | Ga0307508_10213039 | Ga0307508_102130393 | 205 |
| 343 | 3300031730 | Ga0307516_10000114 | Ga0307516_1000011465 | 205 |
| 344 | 3300031730 | Ga0307516_10000361 | Ga0307516_1000036146 | 205 |
| 345 | 3300033180 | Ga0307510_10088490 | Ga0307510_100884903 | 205 |
| 346 | 3300037471 | Ga0395905_0002983 | Ga0395905_0002983_1047_1664 | 205 |
| 347 | 3300039447 | Ga0436361_0304046 | Ga0436361_0304046_9232_9861 | 205 |
| 348 | 3300039447 | Ga0436361_0433542 | Ga0436361_0433542_308_925 | 205 |
| 349 | 3300039447 | Ga0436361_1122650 | Ga0436361_1122650_759_1376 | 205 |
| 350 | 3300041443 | Ga0451789_0419046 | Ga0451789_0419046_143_775 | 205 |
| 351 | 3300041453 | Ga0451797_0601666 | Ga0451797_0601666_434_1054 | 205 |
| 352 | 3300041486 | Ga0451807_2008794 | Ga0451807_2008794_348_965 | 205 |
| 353 | 3300041511 | Ga0451855_0476580 | Ga0451855_0476580_170_799 | 205 |
| 354 | 3300041512 | Ga0451853_0712802 | Ga0451853_0712802_1126_1758 | 205 |
| 355 | 3300042121 | Ga0450919_002427 | Ga0450919_002427_1738_2355 | 205 |
| 356 | 3300042122 | Ga0450920_002499 | Ga0450920_002499_1749_2366 | 205 |
| 357 | 3300042157 | Ga0439458_0050383 | Ga0439458_0050383_362_979 | 205 |
| 358 | 3300042531 | Ga0450918_000003 | Ga0450918_000003_7233_7850 | 205 |
| 359 | 3300044656 | Ga0466969_0001367 | Ga0466969_0001367_1292_1909 | 205 |
| 360 | 3300044683 | Ga0466965_0016159 | Ga0466965_0016159_2030_2647 | 205 |
| 361 | 3300044693 | Ga0466961_0000358 | Ga0466961_0000358_21345_21962 | 205 |
| 362 | 3300045049 | Ga0466959_0272722 | Ga0466959_0272722_470_1087 | 205 |
| 363 | 3300046460 | Ga0495638_0096111 | Ga0495638_0096111_246_902 | 205 |
| 364 | 3300046475 | Ga0495639_0038401 | Ga0495639_0038401_1345_1962 | 205 |
| 365 | 3300046528 | Ga0495642_0143559 | Ga0495642_0143559_346_963 | 205 |
| 366 | 3300046529 | Ga0495652_0288269 | Ga0495652_0288269_495_1112 | 205 |
| 367 | 3300046542 | Ga0495597_0004546 | Ga0495597_0004546_6665_7282 | 205 |
| 368 | 3300046648 | Ga0495611_0080171 | Ga0495611_0080171_368_985 | 205 |
| 369 | 3300046660 | Ga0495625_0010840 | Ga0495625_0010840_6161_6778 | 205 |
| 370 | 3300047443 | Ga0495687_000259 | Ga0495687_000259_62667_63284 | 205 |
| 371 | 3300047472 | Ga0495686_0003932 | Ga0495686_0003932_11098_11715 | 205 |
| 372 | 3300048091 | Ga0495626_0034293 | Ga0495626_0034293_861_1478 | 205 |
| 373 | 3300048091 | Ga0495626_0056677 | Ga0495626_0056677_1098_1715 | 205 |
| 374 | 3300048915 | Ga0496112_0011547 | Ga0496112_0011547_6988_7605 | 205 |
| 375 | 3300048928 | Ga0496125_0176131 | Ga0496125_0176131_574_1191 | 205 |
| 376 | 3300049128 | Ga0501308_001501 | Ga0501308_001501_1102_1719 | 205 |
| 377 | 3300049130 | Ga0501310_007891 | Ga0501310_007891_21_638 | 205 |
| 378 | 3300049519 | Ga0501296_002571 | Ga0501296_002571_224_841 | 205 |
| 379 | 3300049520 | Ga0501297_013438 | Ga0501297_013438_139_756 | 205 |
| 380 | 3300049523 | Ga0501300_005790 | Ga0501300_005790_448_1065 | 205 |
| 381 | 3300049587 | Ga0501071_0291594 | Ga0501071_0291594_128_751 | 205 |
| 382 | 3300049651 | Ga0501201_001004 | Ga0501201_001004_1640_2257 | 205 |
| 383 | 3300049662 | Ga0501222_004389 | Ga0501222_004389_956_1573 | 205 |
| 384 | 3300049668 | Ga0501233_004320 | Ga0501233_004320_1459_2076 | 205 |
| 385 | 3300049674 | Ga0501242_015669 | Ga0501242_015669_17_634 | 205 |
| 386 | 3300049679 | Ga0501249_009741 | Ga0501249_009741_788_1405 | 205 |
| 387 | 3300049704 | Ga0501221_001282 | Ga0501221_001282_628_1245 | 205 |
| 388 | 3300049706 | Ga0501229_005760 | Ga0501229_005760_385_1002 | 205 |
| 389 | 3300049769 | Ga0501272_001778 | Ga0501272_001778_1340_1957 | 205 |
| 390 | 3300049771 | Ga0501274_003883 | Ga0501274_003883_236_853 | 205 |
| 391 | 3300050489 | nmdc:mga03683_2478_c1 | nmdc:mga03683_2478_c1_3723_4340 | 205 |
| 392 | 3300050489 | nmdc:mga03683_75684_c1 | nmdc:mga03683_75684_c1_361_1038 | 205 |
| 393 | 3300050490 | nmdc:mga03n38_230411_c1 | nmdc:mga03n38_230411_c1_216_833 | 205 |
| 394 | 3300050491 | nmdc:mga00v17_209918_c1 | nmdc:mga00v17_209918_c1_493_1110 | 205 |
| 395 | 3300050491 | nmdc:mga00v17_48921_c1 | nmdc:mga00v17_48921_c1_446_1063 | 205 |
| 396 | 3300050492 | nmdc:mga0yw44_11630_c1 | nmdc:mga0yw44_11630_c1_965_1582 | 205 |
| 397 | 3300050493 | nmdc:mga0k408_12157_c1 | nmdc:mga0k408_12157_c1_2225_2842 | 205 |
| 398 | 3300050493 | nmdc:mga0k408_44012_c1 | nmdc:mga0k408_44012_c1_1495_2112 | 205 |
| 399 | 3300050493 | nmdc:mga0k408_53202_c1 | nmdc:mga0k408_53202_c1_788_1465 | 205 |
| 400 | 3300050493 | nmdc:mga0k408_65992_c1 | nmdc:mga0k408_65992_c1_1145_1762 | 205 |
| 401 | 3300050494 | nmdc:mga06z11_12478_c1 | nmdc:mga06z11_12478_c1_1416_2033 | 205 |
| 402 | 3300050494 | nmdc:mga06z11_169643_c1 | nmdc:mga06z11_169643_c1_521_1138 | 205 |
| 403 | 3300050495 | nmdc:mga04h51_4999_c1 | nmdc:mga04h51_4999_c1_1279_1896 | 205 |
| 404 | 3300050496 | nmdc:mga07m45_1177_c1 | nmdc:mga07m45_1177_c1_6352_6969 | 205 |
| 405 | 3300050496 | nmdc:mga07m45_24612_c1 | nmdc:mga07m45_24612_c1_2492_3109 | 205 |
| 406 | 3300050496 | nmdc:mga07m45_24747_c1 | nmdc:mga07m45_24747_c1_1655_2272 | 205 |
| 407 | 3300050496 | nmdc:mga07m45_35628_c1 | nmdc:mga07m45_35628_c1_779_1456 | 205 |
| 408 | 3300050496 | nmdc:mga07m45_67822_c1 | nmdc:mga07m45_67822_c1_944_1561 | 205 |
| 409 | 3300050516 | nmdc:mga0sz30_3643_c1 | nmdc:mga0sz30_3643_c1_1943_2560 | 205 |
| 410 | 3300053134 | Ga0500658_0056849 | Ga0500658_0056849_812_1429 | 205 |
| 411 | 3300053136 | Ga0500559_0015943 | Ga0500559_0015943_211_828 | 205 |
| 412 | 3300053139 | Ga0500568_0005699 | Ga0500568_0005699_3307_3924 | 205 |
| 413 | 3300053156 | Ga0500622_0004094 | Ga0500622_0004094_50_667 | 205 |
| 414 | 3300059424 | Ga0590075_093321 | Ga0590075_093321_62_691 | 205 |
| 415 | iso_pu_bacteria | 2643221609 | 2644057869 | 205 |
| 416 | iso_pu_bacteria | 2643221611 | 2644072905 | 205 |
| 417 | iso_pu_bacteria | 2738543012 | 2739242141 | 205 |
| 418 | iso_pu_bacteria | 2816332133 | 2816470242 | 205 |
| 419 | 3300005548 | Ga0070665_100001343 | Ga0070665_10000134311 | 206 |
| 420 | 3300006358 | Ga0068871_100545966 | Ga0068871_1005459662 | 206 |
| 421 | 3300014969 | Ga0157376_10396388 | Ga0157376_103963882 | 206 |
| 422 | 3300028379 | Ga0268266_10023539 | Ga0268266_100235394 | 206 |
| 423 | 3300042876 | Ga0451577_0574701 | Ga0451577_0574701_357_983 | 206 |
| 424 | 3300044658 | Ga0466972_0000519 | Ga0466972_0000519_8297_8929 | 206 |
| 425 | 3300044673 | Ga0453683_0141611 | Ga0453683_0141611_270_890 | 206 |
| 426 | 3300044683 | Ga0466965_0045870 | Ga0466965_0045870_920_1552 | 206 |
| 427 | 3300046506 | Ga0495583_0000444 | Ga0495583_0000444_20522_21142 | 206 |
| 428 | 3300046507 | Ga0495606_0002487 | Ga0495606_0002487_6014_6634 | 206 |
| 429 | 3300046616 | Ga0495668_0183596 | Ga0495668_0183596_407_1027 | 206 |
| 430 | 3300046694 | Ga0495649_0000298 | Ga0495649_0000298_22247_22867 | 206 |
| 431 | 3300046794 | Ga0495589_0087591 | Ga0495589_0087591_178_798 | 206 |
| 432 | 3300049573 | Ga0501037_0010746 | Ga0501037_0010746_516_1136 | 206 |
| 433 | 3300053138 | Ga0500564_126533 | Ga0500564_126533_325_945 | 206 |
| 434 | 3300053177 | Ga0500636_0107404 | Ga0500636_0107404_932_1552 | 206 |
| 435 | 3300005289 | Ga0065704_10449773 | Ga0065704_104497731 | 207 |
| 436 | 3300005335 | Ga0070666_10129752 | Ga0070666_101297523 | 207 |
| 437 | 3300005536 | Ga0070697_100607481 | Ga0070697_1006074812 | 207 |
| 438 | 3300005841 | Ga0068863_100474568 | Ga0068863_1004745682 | 207 |
| 439 | 3300009036 | Ga0105244_10111065 | Ga0105244_101110652 | 207 |
| 440 | 3300009176 | Ga0105242_10000868 | Ga0105242_1000086813 | 207 |
| 441 | 3300009176 | Ga0105242_10190911 | Ga0105242_101909112 | 207 |
| 442 | 3300011119 | Ga0105246_10988172 | Ga0105246_109881721 | 207 |
| 443 | 3300013297 | Ga0157378_10021317 | Ga0157378_100213175 | 207 |
| 444 | 3300025250 | Ga0209026_1009984 | Ga0209026_10099841 | 207 |
| 445 | 3300025256 | Ga0209759_1005424 | Ga0209759_10054244 | 207 |
| 446 | 3300025728 | Ga0207655_1100610 | Ga0207655_11006102 | 207 |
| 447 | 3300025910 | Ga0207684_10484286 | Ga0207684_104842862 | 207 |
| 448 | 3300025934 | Ga0207686_10001655 | Ga0207686_100016552 | 207 |
| 449 | 3300026088 | Ga0207641_10450216 | Ga0207641_104502161 | 207 |
| 450 | 3300027876 | Ga0209974_10014134 | Ga0209974_100141342 | 207 |
| 451 | 3300031911 | Ga0307412_10234665 | Ga0307412_102346651 | 207 |
| 452 | 3300036401 | Ga0373937_0094584 | Ga0373937_0094584_540_1163 | 207 |
| 453 | 3300037471 | Ga0395905_0004666 | Ga0395905_0004666_503_1126 | 207 |
| 454 | 3300044656 | Ga0466969_0006082 | Ga0466969_0006082_5249_5872 | 207 |
| 455 | 3300044684 | Ga0466966_0011080 | Ga0466966_0011080_1220_1843 | 207 |
| 456 | 3300044693 | Ga0466961_0118577 | Ga0466961_0118577_1021_1644 | 207 |
| 457 | 3300044706 | Ga0466964_0003754 | Ga0466964_0003754_3904_4527 | 207 |
| 458 | 3300044719 | Ga0466971_0355333 | Ga0466971_0355333_43_666 | 207 |
| 459 | 3300044735 | Ga0466968_0275560 | Ga0466968_0275560_41_664 | 207 |
| 460 | 3300044842 | Ga0466957_0037013 | Ga0466957_0037013_644_1267 | 207 |
| 461 | 3300044842 | Ga0466957_0100369 | Ga0466957_0100369_805_1428 | 207 |
| 462 | 3300045049 | Ga0466959_0096895 | Ga0466959_0096895_1122_1745 | 207 |
| 463 | 3300045836 | Ga0466958_0566166 | Ga0466958_0566166_62_685 | 207 |
| 464 | 3300045976 | Ga0466967_0113340 | Ga0466967_0113340_1066_1689 | 207 |
| 465 | 3300049588 | Ga0501072_0203536 | Ga0501072_0203536_232_864 | 207 |
| 466 | 3300049591 | Ga0501075_0559771 | Ga0501075_0559771_182_814 | 207 |
| 467 | 3300050496 | nmdc:mga07m45_11889_c1 | nmdc:mga07m45_11889_c1_470_1093 | 207 |
| 468 | 3300060353 | Ga0501082_0157552 | Ga0501082_0157552_675_1307 | 207 |
| 469 | 3300061719 | Ga0466962_0034671 | Ga0466962_0034671_129_752 | 207 |
| 470 | 3300005353 | Ga0070669_100023434 | Ga0070669_1000234344 | 208 |
| 471 | 3300005356 | Ga0070674_100054606 | Ga0070674_1000546063 | 208 |
| 472 | 3300005367 | Ga0070667_100028205 | Ga0070667_1000282054 | 208 |
| 473 | 3300005444 | Ga0070694_100011360 | Ga0070694_1000113602 | 208 |
| 474 | 3300005459 | Ga0068867_100007205 | Ga0068867_10000720510 | 208 |
| 475 | 3300005539 | Ga0068853_100815855 | Ga0068853_1008158551 | 208 |
| 476 | 3300005543 | Ga0070672_100275709 | Ga0070672_1002757092 | 208 |
| 477 | 3300005545 | Ga0070695_100014906 | Ga0070695_1000149062 | 208 |
| 478 | 3300005563 | Ga0068855_100130777 | Ga0068855_1001307774 | 208 |
| 479 | 3300005614 | Ga0068856_100037225 | Ga0068856_1000372252 | 208 |
| 480 | 3300005616 | Ga0068852_100772266 | Ga0068852_1007722662 | 208 |
| 481 | 3300005618 | Ga0068864_100102994 | Ga0068864_1001029944 | 208 |
| 482 | 3300005718 | Ga0068866_10116826 | Ga0068866_101168262 | 208 |
| 483 | 3300005719 | Ga0068861_100005361 | Ga0068861_1000053617 | 208 |
| 484 | 3300005841 | Ga0068863_100004114 | Ga0068863_1000041149 | 208 |
| 485 | 3300005842 | Ga0068858_100097882 | Ga0068858_1000978823 | 208 |
| 486 | 3300005842 | Ga0068858_100386115 | Ga0068858_1003861152 | 208 |
| 487 | 3300005843 | Ga0068860_100001386 | Ga0068860_1000013867 | 208 |
| 488 | 3300005843 | Ga0068860_100047929 | Ga0068860_1000479295 | 208 |
| 489 | 3300005937 | Ga0081455_10119463 | Ga0081455_101194632 | 208 |
| 490 | 3300006881 | Ga0068865_100004561 | Ga0068865_10000456110 | 208 |
| 491 | 3300009093 | Ga0105240_10122896 | Ga0105240_101228962 | 208 |
| 492 | 3300009093 | Ga0105240_10181221 | Ga0105240_101812213 | 208 |
| 493 | 3300009147 | Ga0114129_10004078 | Ga0114129_1000407815 | 208 |
| 494 | 3300009148 | Ga0105243_10035142 | Ga0105243_100351422 | 208 |
| 495 | 3300009174 | Ga0105241_10007758 | Ga0105241_1000775815 | 208 |
| 496 | 3300009174 | Ga0105241_10115366 | Ga0105241_101153662 | 208 |
| 497 | 3300009174 | Ga0105241_10148456 | Ga0105241_101484562 | 208 |
| 498 | 3300009545 | Ga0105237_10010756 | Ga0105237_1001075615 | 208 |
| 499 | 3300009545 | Ga0105237_10157977 | Ga0105237_101579772 | 208 |
| 500 | 3300009551 | Ga0105238_10006478 | Ga0105238_100064784 | 208 |
| 501 | 3300009551 | Ga0105238_10007601 | Ga0105238_100076015 | 208 |
| 502 | 3300009551 | Ga0105238_10139564 | Ga0105238_101395642 | 208 |
| 503 | 3300009553 | Ga0105249_10150677 | Ga0105249_101506771 | 208 |
| 504 | 3300009553 | Ga0105249_10335296 | Ga0105249_103352962 | 208 |
| 505 | 3300010375 | Ga0105239_10007170 | Ga0105239_1000717018 | 208 |
| 506 | 3300010375 | Ga0105239_10044898 | Ga0105239_100448982 | 208 |
| 507 | 3300013105 | Ga0157369_10316790 | Ga0157369_103167902 | 208 |
| 508 | 3300013297 | Ga0157378_10004305 | Ga0157378_100043053 | 208 |
| 509 | 3300013306 | Ga0163162_10004215 | Ga0163162_100042159 | 208 |
| 510 | 3300013306 | Ga0163162_10041433 | Ga0163162_100414332 | 208 |
| 511 | 3300013308 | Ga0157375_10102471 | Ga0157375_101024714 | 208 |
| 512 | 3300014325 | Ga0163163_10208556 | Ga0163163_102085563 | 208 |
| 513 | 3300014968 | Ga0157379_10098367 | Ga0157379_100983673 | 208 |
| 514 | 3300017792 | Ga0163161_10274457 | Ga0163161_102744572 | 208 |
| 515 | 3300025899 | Ga0207642_10065352 | Ga0207642_100653522 | 208 |
| 516 | 3300025903 | Ga0207680_10008080 | Ga0207680_100080803 | 208 |
| 517 | 3300025907 | Ga0207645_10052192 | Ga0207645_100521922 | 208 |
| 518 | 3300025911 | Ga0207654_10043012 | Ga0207654_100430123 | 208 |
| 519 | 3300025913 | Ga0207695_10113680 | Ga0207695_101136802 | 208 |
| 520 | 3300025914 | Ga0207671_10031954 | Ga0207671_100319546 | 208 |
| 521 | 3300025914 | Ga0207671_10041737 | Ga0207671_100417373 | 208 |
| 522 | 3300025920 | Ga0207649_10132241 | Ga0207649_101322412 | 208 |
| 523 | 3300025920 | Ga0207649_10478867 | Ga0207649_104788671 | 208 |
| 524 | 3300025923 | Ga0207681_10028578 | Ga0207681_100285784 | 208 |
| 525 | 3300025924 | Ga0207694_10356850 | Ga0207694_103568501 | 208 |
| 526 | 3300025961 | Ga0207712_10288624 | Ga0207712_102886242 | 208 |
| 527 | 3300025972 | Ga0207668_10865161 | Ga0207668_108651611 | 208 |
| 528 | 3300025986 | Ga0207658_10065783 | Ga0207658_100657832 | 208 |
| 529 | 3300026035 | Ga0207703_10082199 | Ga0207703_100821994 | 208 |
| 530 | 3300026035 | Ga0207703_11017509 | Ga0207703_110175091 | 208 |
| 531 | 3300026041 | Ga0207639_10412274 | Ga0207639_104122742 | 208 |
| 532 | 3300026067 | Ga0207678_10023119 | Ga0207678_100231195 | 208 |
| 533 | 3300026078 | Ga0207702_10196453 | Ga0207702_101964532 | 208 |
| 534 | 3300026088 | Ga0207641_10002934 | Ga0207641_1000293418 | 208 |
| 535 | 3300026088 | Ga0207641_10217289 | Ga0207641_102172892 | 208 |
| 536 | 3300026089 | Ga0207648_10001237 | Ga0207648_100012372 | 208 |
| 537 | 3300026118 | Ga0207675_100001346 | Ga0207675_10000134618 | 208 |
| 538 | 3300026121 | Ga0207683_10281086 | Ga0207683_102810861 | 208 |
| 539 | 3300027471 | Ga0209995_1024043 | Ga0209995_10240432 | 208 |
| 540 | 3300027665 | Ga0209983_1009900 | Ga0209983_10099002 | 208 |
| 541 | 3300027682 | Ga0209971_1000923 | Ga0209971_10009235 | 208 |
| 542 | 3300027876 | Ga0209974_10008910 | Ga0209974_100089105 | 208 |
| 543 | 3300028380 | Ga0268265_10018728 | Ga0268265_100187286 | 208 |
| 544 | 3300028380 | Ga0268265_10477202 | Ga0268265_104772022 | 208 |
| 545 | 3300028381 | Ga0268264_10323489 | Ga0268264_103234892 | 208 |
| 546 | 3300028573 | Ga0265334_10084620 | Ga0265334_100846202 | 208 |
| 547 | 3300028577 | Ga0265318_10085693 | Ga0265318_100856932 | 208 |
| 548 | 3300028794 | Ga0307515_10326248 | Ga0307515_103262482 | 208 |
| 549 | 3300031235 | Ga0265330_10000368 | Ga0265330_100003684 | 208 |
| 550 | 3300031238 | Ga0265332_10000394 | Ga0265332_1000039421 | 208 |
| 551 | 3300031240 | Ga0265320_10035790 | Ga0265320_100357901 | 208 |
| 552 | 3300031241 | Ga0265325_10011672 | Ga0265325_100116724 | 208 |
| 553 | 3300031241 | Ga0265325_10060517 | Ga0265325_100605172 | 208 |
| 554 | 3300031247 | Ga0265340_10034341 | Ga0265340_100343412 | 208 |
| 555 | 3300031250 | Ga0265331_10023713 | Ga0265331_100237133 | 208 |
| 556 | 3300031548 | Ga0307408_100000136 | Ga0307408_10000013626 | 208 |
| 557 | 3300031548 | Ga0307408_100058895 | Ga0307408_1000588952 | 208 |
| 558 | 3300031665 | Ga0316575_10047969 | Ga0316575_100479693 | 208 |
| 559 | 3300031711 | Ga0265314_10000292 | Ga0265314_1000029221 | 208 |
| 560 | 3300031901 | Ga0307406_10000105 | Ga0307406_100001057 | 208 |
| 561 | 3300033180 | Ga0307510_10000018 | Ga0307510_1000001830 | 208 |
| 562 | 3300035116 | Ga0373945_0188362 | Ga0373945_0188362_124_750 | 208 |
| 563 | 3300035695 | Ga0373927_0024670 | Ga0373927_0024670_3070_3696 | 208 |
| 564 | 3300035695 | Ga0373927_0300818 | Ga0373927_0300818_164_805 | 208 |
| 565 | 3300037068 | Ga0373925_0001876 | Ga0373925_0001876_1943_2569 | 208 |
| 566 | 3300041456 | Ga0451795_0964762 | Ga0451795_0964762_94_726 | 208 |
| 567 | 3300042876 | Ga0451577_0023595 | Ga0451577_0023595_3462_4088 | 208 |
| 568 | 3300042876 | Ga0451577_0152498 | Ga0451577_0152498_740_1366 | 208 |
| 569 | 3300044712 | Ga0453684_0000823 | Ga0453684_0000823_67506_68132 | 208 |
| 570 | 3300044712 | Ga0453684_0200643 | Ga0453684_0200643_1644_2270 | 208 |
| 571 | 3300045051 | Ga0451576_0239549 | Ga0451576_0239549_991_1617 | 208 |
| 572 | 3300045051 | Ga0451576_0936342 | Ga0451576_0936342_188_814 | 208 |
| 573 | 3300046471 | Ga0495650_0013148 | Ga0495650_0013148_3553_4179 | 208 |
| 574 | 3300046506 | Ga0495583_0202862 | Ga0495583_0202862_124_756 | 208 |
| 575 | 3300046681 | Ga0495647_0145203 | Ga0495647_0145203_15_641 | 208 |
| 576 | 3300048906 | Ga0496103_0093533 | Ga0496103_0093533_809_1474 | 208 |
| 577 | 3300048919 | Ga0496116_0035675 | Ga0496116_0035675_1686_2351 | 208 |
| 578 | 3300048920 | Ga0496117_0000067 | Ga0496117_0000067_140183_140848 | 208 |
| 579 | 3300048921 | Ga0496118_0000021 | Ga0496118_0000021_190905_191570 | 208 |
| 580 | 3300048922 | Ga0496119_0012940 | Ga0496119_0012940_6059_6688 | 208 |
| 581 | 3300048923 | Ga0496120_0000042 | Ga0496120_0000042_177367_178029 | 208 |
| 582 | 3300048923 | Ga0496120_0047130 | Ga0496120_0047130_1121_1786 | 208 |
| 583 | 3300048923 | Ga0496120_0057999 | Ga0496120_0057999_1331_1996 | 208 |
| 584 | 3300048927 | Ga0496124_0061127 | Ga0496124_0061127_571_1236 | 208 |
| 585 | 3300048928 | Ga0496125_0043123 | Ga0496125_0043123_863_1528 | 208 |
| 586 | 3300049578 | Ga0501042_0720115 | Ga0501042_0720115_78_707 | 208 |
| 587 | 3300049581 | Ga0501047_0357861 | Ga0501047_0357861_376_1002 | 208 |
| 588 | 3300049763 | Ga0501266_000425 | Ga0501266_000425_1517_2143 | 208 |
| 589 | 3300050507 | nmdc:mga05p37_8138_c1 | nmdc:mga05p37_8138_c1_8401_9033 | 208 |
| 590 | 3300053087 | Ga0500643_085364 | Ga0500643_085364_114_740 | 208 |
| 591 | 3300053139 | Ga0500568_0016467 | Ga0500568_0016467_1470_2096 | 208 |
| 592 | 3300053153 | Ga0500616_0089221 | Ga0500616_0089221_280_906 | 208 |
| 593 | 3300053156 | Ga0500622_0005022 | Ga0500622_0005022_1329_1955 | 208 |
| 594 | 3300053729 | Ga0500625_011277 | Ga0500625_011277_2539_3165 | 208 |
| 595 | 3300002705 | JGI25156J39149_1000419 | JGI25156J39149_100041924 | 209 |
| 596 | 3300002741 | JGI25157J39369_1000174 | JGI25157J39369_10001748 | 209 |
| 597 | 3300002772 | JGI25164J39214_1012596 | JGI25164J39214_10125961 | 209 |
| 598 | 3300003320 | rootH2_10034065 | rootH2_100340653 | 209 |
| 599 | 3300003752 | Ga0055539_1000365 | Ga0055539_100036517 | 209 |
| 600 | 3300003752 | Ga0055539_1001538 | Ga0055539_10015385 | 209 |
| 601 | 3300003756 | Ga0055533_1000011 | Ga0055533_1000011247 | 209 |
| 602 | 3300003759 | Ga0055525_1000989 | Ga0055525_100098910 | 209 |
| 603 | 3300005329 | Ga0070683_100331849 | Ga0070683_1003318491 | 209 |
| 604 | 3300005330 | Ga0070690_100021105 | Ga0070690_1000211054 | 209 |
| 605 | 3300005334 | Ga0068869_100006181 | Ga0068869_1000061817 | 209 |
| 606 | 3300005339 | Ga0070660_100197829 | Ga0070660_1001978291 | 209 |
| 607 | 3300005366 | Ga0070659_100447996 | Ga0070659_1004479961 | 209 |
| 608 | 3300005441 | Ga0070700_100888108 | Ga0070700_1008881081 | 209 |
| 609 | 3300005457 | Ga0070662_100570032 | Ga0070662_1005700322 | 209 |
| 610 | 3300005539 | Ga0068853_100904758 | Ga0068853_1009047581 | 209 |
| 611 | 3300005563 | Ga0068855_100000971 | Ga0068855_10000097111 | 209 |
| 612 | 3300005563 | Ga0068855_100560002 | Ga0068855_1005600022 | 209 |
| 613 | 3300005577 | Ga0068857_100001909 | Ga0068857_10000190913 | 209 |
| 614 | 3300005614 | Ga0068856_100000951 | Ga0068856_1000009518 | 209 |
| 615 | 3300005616 | Ga0068852_100284628 | Ga0068852_1002846281 | 209 |
| 616 | 3300005617 | Ga0068859_100076958 | Ga0068859_1000769585 | 209 |
| 617 | 3300005617 | Ga0068859_100597680 | Ga0068859_1005976802 | 209 |
| 618 | 3300005719 | Ga0068861_100178854 | Ga0068861_1001788543 | 209 |
| 619 | 3300005844 | Ga0068862_100085310 | Ga0068862_1000853102 | 209 |
| 620 | 3300006195 | Ga0075366_10166527 | Ga0075366_101665271 | 209 |
| 621 | 3300006237 | Ga0097621_100542356 | Ga0097621_1005423562 | 209 |
| 622 | 3300006844 | Ga0075428_101101231 | Ga0075428_1011012311 | 209 |
| 623 | 3300006847 | Ga0075431_100013608 | Ga0075431_1000136089 | 209 |
| 624 | 3300006847 | Ga0075431_100101045 | Ga0075431_1001010452 | 209 |
| 625 | 3300006847 | Ga0075431_100608669 | Ga0075431_1006086692 | 209 |
| 626 | 3300006880 | Ga0075429_100482086 | Ga0075429_1004820861 | 209 |
| 627 | 3300006914 | Ga0075436_100036963 | Ga0075436_1000369632 | 209 |
| 628 | 3300006931 | Ga0097620_100076957 | Ga0097620_1000769575 | 209 |
| 629 | 3300006931 | Ga0097620_100597691 | Ga0097620_1005976912 | 209 |
| 630 | 3300009098 | Ga0105245_10080032 | Ga0105245_100800322 | 209 |
| 631 | 3300009098 | Ga0105245_10305379 | Ga0105245_103053792 | 209 |
| 632 | 3300009147 | Ga0114129_10080685 | Ga0114129_100806852 | 209 |
| 633 | 3300009147 | Ga0114129_10894858 | Ga0114129_108948581 | 209 |
| 634 | 3300009176 | Ga0105242_10035264 | Ga0105242_100352644 | 209 |
| 635 | 3300009176 | Ga0105242_10156513 | Ga0105242_101565132 | 209 |
| 636 | 3300009545 | Ga0105237_10716269 | Ga0105237_107162691 | 209 |
| 637 | 3300009551 | Ga0105238_10031258 | Ga0105238_100312585 | 209 |
| 638 | 3300010375 | Ga0105239_10196071 | Ga0105239_101960714 | 209 |
| 639 | 3300013105 | Ga0157369_10060633 | Ga0157369_100606335 | 209 |
| 640 | 3300014969 | Ga0157376_10267125 | Ga0157376_102671251 | 209 |
| 641 | 3300025226 | Ga0209674_100003 | Ga0209674_100003546 | 209 |
| 642 | 3300025230 | Ga0209563_100010 | Ga0209563_100010276 | 209 |
| 643 | 3300025231 | Ga0207427_100307 | Ga0207427_10030735 | 209 |
| 644 | 3300025242 | Ga0209258_101918 | Ga0209258_1019185 | 209 |
| 645 | 3300025246 | Ga0209646_1000066 | Ga0209646_1000066162 | 209 |
| 646 | 3300025250 | Ga0209026_1000027 | Ga0209026_1000027167 | 209 |
| 647 | 3300025253 | Ga0209677_100178 | Ga0209677_10017815 | 209 |
| 648 | 3300025253 | Ga0209677_100183 | Ga0209677_10018318 | 209 |
| 649 | 3300025256 | Ga0209759_1000131 | Ga0209759_100013113 | 209 |
| 650 | 3300025295 | Ga0209564_1002533 | Ga0209564_10025332 | 209 |
| 651 | 3300025911 | Ga0207654_10111096 | Ga0207654_101110963 | 209 |
| 652 | 3300025919 | Ga0207657_10239272 | Ga0207657_102392721 | 209 |
| 653 | 3300025924 | Ga0207694_10027167 | Ga0207694_100271674 | 209 |
| 654 | 3300025933 | Ga0207706_10203108 | Ga0207706_102031081 | 209 |
| 655 | 3300025934 | Ga0207686_10063305 | Ga0207686_100633053 | 209 |
| 656 | 3300025942 | Ga0207689_10094740 | Ga0207689_100947403 | 209 |
| 657 | 3300025944 | Ga0207661_10403508 | Ga0207661_104035082 | 209 |
| 658 | 3300025949 | Ga0207667_10002057 | Ga0207667_1000205713 | 209 |
| 659 | 3300025949 | Ga0207667_10164768 | Ga0207667_101647683 | 209 |
| 660 | 3300025981 | Ga0207640_10164555 | Ga0207640_101645551 | 209 |
| 661 | 3300026041 | Ga0207639_10133013 | Ga0207639_101330133 | 209 |
| 662 | 3300026075 | Ga0207708_10798104 | Ga0207708_107981041 | 209 |
| 663 | 3300026078 | Ga0207702_10000220 | Ga0207702_1000022031 | 209 |
| 664 | 3300026089 | Ga0207648_10576125 | Ga0207648_105761252 | 209 |
| 665 | 3300026116 | Ga0207674_10011271 | Ga0207674_100112712 | 209 |
| 666 | 3300026118 | Ga0207675_100347874 | Ga0207675_1003478742 | 209 |
| 667 | 3300026118 | Ga0207675_100683657 | Ga0207675_1006836572 | 209 |
| 668 | 3300026142 | Ga0207698_10511565 | Ga0207698_105115651 | 209 |
| 669 | 3300028380 | Ga0268265_10728971 | Ga0268265_107289712 | 209 |
| 670 | 3300034820 | Ga0373959_0066074 | Ga0373959_0066074_66_695 | 209 |
| 671 | 3300037466 | Ga0395898_0039705 | Ga0395898_0039705_2702_3331 | 209 |
| 672 | 3300037471 | Ga0395905_0156328 | Ga0395905_0156328_530_1159 | 209 |
| 673 | 3300038443 | Ga0395901_0016167 | Ga0395901_0016167_2333_2962 | 209 |
| 674 | 3300041452 | Ga0451793_0385518 | Ga0451793_0385518_32_664 | 209 |
| 675 | 3300042435 | Ga0439434_0049587 | Ga0439434_0049587_360_1004 | 209 |
| 676 | 3300042438 | Ga0439459_0006559 | Ga0439459_0006559_377_1012 | 209 |
| 677 | 3300044712 | Ga0453684_0340128 | Ga0453684_0340128_1014_1658 | 209 |
| 678 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_568897_569529 | 209 |
| 679 | 3300046472 | Ga0495580_0000077 | Ga0495580_0000077_5139_5876 | 209 |
| 680 | 3300046491 | Ga0495584_0033651 | Ga0495584_0033651_1766_2503 | 209 |
| 681 | 3300046507 | Ga0495606_0203732 | Ga0495606_0203732_217_846 | 209 |
| 682 | 3300046513 | Ga0495616_0033452 | Ga0495616_0033452_980_1609 | 209 |
| 683 | 3300046531 | Ga0495665_0070843 | Ga0495665_0070843_87_824 | 209 |
| 684 | 3300046535 | Ga0495586_0359238 | Ga0495586_0359238_57_794 | 209 |
| 685 | 3300047319 | Ga0495674_0026722 | Ga0495674_0026722_1548_2285 | 209 |
| 686 | 3300047320 | Ga0495672_0034691 | Ga0495672_0034691_900_1637 | 209 |
| 687 | 3300048907 | Ga0496104_0073344 | Ga0496104_0073344_1107_1844 | 209 |
| 688 | 3300048909 | Ga0496106_0222647 | Ga0496106_0222647_252_989 | 209 |
| 689 | 3300048915 | Ga0496112_0017817 | Ga0496112_0017817_5338_5967 | 209 |
| 690 | 3300048916 | Ga0496113_0083113 | Ga0496113_0083113_1481_2218 | 209 |
| 691 | 3300048924 | Ga0496121_0039264 | Ga0496121_0039264_781_1518 | 209 |
| 692 | 3300049459 | Ga0495678_015483 | Ga0495678_015483_474_1211 | 209 |
| 693 | 3300049460 | Ga0495682_0017496 | Ga0495682_0017496_836_1573 | 209 |
| 694 | 3300049576 | Ga0501040_0375309 | Ga0501040_0375309_58_735 | 209 |
| 695 | 3300050507 | nmdc:mga05p37_234617_c1 | nmdc:mga05p37_234617_c1_651_1289 | 209 |
| 696 | 3300050507 | nmdc:mga05p37_25817_c1 | nmdc:mga05p37_25817_c1_5225_5869 | 209 |
| 697 | 3300050509 | nmdc:mga0qj67_82513_c1 | nmdc:mga0qj67_82513_c1_977_1621 | 209 |
| 698 | 3300050510 | nmdc:mga06r32_408345_c1 | nmdc:mga06r32_408345_c1_12_656 | 209 |
| 699 | 3300050514 | nmdc:mga08x19_15033_c1 | nmdc:mga08x19_15033_c1_1529_2167 | 209 |
| 700 | 3300053086 | Ga0500578_0000025 | Ga0500578_0000025_119119_119748 | 209 |
| 701 | 3300053108 | Ga0500562_016708 | Ga0500562_016708_704_1333 | 209 |
| 702 | 3300053151 | Ga0500604_0007009 | Ga0500604_0007009_1432_2061 | 209 |
| 703 | iso_pu_bacteria | 2791355137 | 2792835397 | 209 |
| 704 | iso_pu_bacteria | 2904615490 | 2904620077 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.7962 | 11 | 209 |
| 4mnd-assembly1.cif.gz_A-2 | crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein | 0.7449 | 20 | 203 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.705 | 20 | 200 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.7005 | 20 | 200 |
| 6wmv-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.6632 | 12 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9521 | 6 | 206 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9241 | 11 | 196 | 1.20.120.1760 |
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9123 | 6 | 206 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9007 | 11 | 196 | 1.20.120.1760 |
| af_Q58609_4_200_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8411 | 19 | 209 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H9BH28-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9582 | 4 | 209 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A0P0RLU5-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9578 | 6 | 208 |
GO:0003882
GO:0008444 GO:0008654 GO:0016020 |
| AF-A0A1K2H3J2-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9561 | 4 | 209 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-Q5H0P8-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9561 | 5 | 209 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-U9TLP1-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9559 | 6 | 209 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar