F476330

General Info

Members Datasets Scaffolds Average Seq Length
704 421 678 208

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10012913|Ga0070658_100129135
Length 205
Sequence MQQPRRVFSMIREFHLADWFTLGNAVSGVSALFSTMSYLQYGERWHLYLACALVALALIFDVLDGRVARWRQKSSAMGRELDSLADVISFGVVPAVIGYGCGMQGSLDRVVLAFFVACGVSRLARYNVTAEANSQDGKVKFFEGTPIPTSLVLVAVLAWAAWAGALGDALWFGSVAFGPLELHPLVLMFAVSGSFMISRIRIPKI

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221652 Acidovorax sp. Root402 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
20 2816332133 Acidovorax radicis 2721A Isolate Unclassified
21 2831864461 Roseateles noduli HZ7 Isolate Nodule
22 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
23 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
24 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
25 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
26 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
27 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
43 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
124 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
125 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
204 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
219 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
230 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
256 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
257 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
263 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
264 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
265 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
266 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
267 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
268 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
345 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
346 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
362 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
372 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
373 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
374 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
375 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
376 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
377 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
381 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
382 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
404 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
405 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
406 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
407 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
408 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
409 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
410 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
415 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
416 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
417 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
421 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0.28
Isolates 3.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.05
Nodule 0.57
Rhizoplane 3.55
Rhizosphere 68.89
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000419 3300002705 Bacteria 26375
2 JGI25156J39149_1009299 3300002705 Bacteria 2401
3 JGI25156J39149_1016439 3300002705 Bacteria 1438
4 JGI25157J39369_1000174 3300002741 Bacteria 54162
5 JGI25163J39215_1002977 3300002771 Bacteria 1486
6 JGI25164J39214_1012596 3300002772 Bacteria 801
7 JGI25152J39213_1001436 3300002773 Bacteria 10273
8 JGI25165J46597_1000001 3300003214 Bacteria 1111887
9 rootH2_10000113 3300003320 Bacteria 75503
10 rootH2_10034065 3300003320 Bacteria 4008
11 rootH1_10078733 3300003316 Bacteria 1995
12 rootH1_10078733 3300003323 Bacteria 3046
13 JGI25160J50197_1000120 3300003354 Bacteria 71260
14 Ga0055538_1000001 3300003751 Bacteria 1111887
15 Ga0055539_1000001 3300003752 Bacteria 1111887
16 Ga0055539_1000365 3300003752 Bacteria 19247
17 Ga0055539_1001538 3300003752 Bacteria 4196
18 Ga0055533_1000003 3300003756 Bacteria 1111887
19 Ga0055533_1000011 3300003756 Bacteria 467893
20 Ga0055525_1000003 3300003759 Bacteria 962094
21 Ga0055525_1000989 3300003759 Bacteria 7651
22 Ga0055535_1000097 3300003761 Bacteria 95927
23 Ga0055529_1000202 3300003763 Bacteria 79179
24 Ga0055526_1001497 3300003771 Bacteria 16540
25 Ga0055530_10000764 3300003791 Bacteria 26787
26 Ga0055530_10001161 3300003791 Bacteria 20415
27 Ga0055540_1000357 3300003792 Bacteria 38830
28 Ga0055531_10016737 3300003794 Bacteria 3143
29 Ga0055541_1000001 3300003841 Bacteria 1111887
30 Ga0065165_1000382 3300005262 Bacteria 71834
31 Ga0065165_1001129 3300005262 Bacteria 31369
32 Ga0065704_10449773 3300005289 Bacteria 698
33 Ga0070658_10012913 3300005327 Bacteria 6705
34 Ga0070658_10060818 3300005327 Bacteria 3076
35 Ga0070658_10428196 3300005327 Bacteria 1139
36 Ga0070683_100331849 3300005329 Bacteria 1448
37 Ga0070690_100021105 3300005330 Bacteria 3974
38 Ga0070670_100019957 3300005331 Bacteria 5754
39 Ga0068869_100006181 3300005334 Bacteria 7580
40 Ga0068869_100244373 3300005334 Bacteria 1431
41 Ga0070666_10000010 3300005335 Bacteria 264789
42 Ga0070666_10129752 3300005335 Bacteria 1751
43 Ga0070680_100238870 3300005336 Bacteria 1535
44 Ga0068868_100113107 3300005338 Bacteria 2207
45 Ga0070660_100197829 3300005339 Bacteria 1630
46 Ga0070661_100096203 3300005344 Bacteria 2197
47 Ga0070669_100023434 3300005353 Bacteria 4421
48 Ga0070674_100054606 3300005356 Bacteria 2764
49 Ga0070673_100104622 3300005364 Bacteria 2338
50 Ga0070659_100333978 3300005366 Bacteria 1269
51 Ga0070659_100447996 3300005366 Bacteria 1095
52 Ga0070667_100028205 3300005367 Bacteria 4673
53 Ga0070667_100136741 3300005367 Bacteria 2143
54 Ga0070667_100248445 3300005367 Bacteria 1590
55 Ga0070700_100888108 3300005441 Bacteria 725
56 Ga0070694_100011360 3300005444 Bacteria 5513
57 Ga0070708_100703490 3300005445 Bacteria 951
58 Ga0070662_100001459 3300005457 Bacteria 14573
59 Ga0070662_100029344 3300005457 Bacteria 3839
60 Ga0070662_100570032 3300005457 Unclassified 950
61 Ga0070681_10269399 3300005458 Bacteria 1614
62 Ga0068867_100007205 3300005459 Bacteria 7862
63 Ga0068867_100690295 3300005459 Bacteria 900
64 Ga0070697_100607481 3300005536 Bacteria 962
65 Ga0068853_100815855 3300005539 Bacteria 894
66 Ga0068853_100904758 3300005539 Bacteria 848
67 Ga0070672_100046459 3300005543 Bacteria 3364
68 Ga0070672_100275709 3300005543 Bacteria 1421
69 Ga0070695_100014906 3300005545 Bacteria 4688
70 Ga0070695_100065331 3300005545 Bacteria 2369
71 Ga0070695_100694331 3300005545 Bacteria 807
72 Ga0070665_100000179 3300005548 Bacteria 112608
73 Ga0070665_100001343 3300005548 Bacteria 29249
74 Ga0070665_100067913 3300005548 Bacteria 3574
75 Ga0068855_100000971 3300005563 Bacteria 35725
76 Ga0068855_100130777 3300005563 Bacteria 2867
77 Ga0068855_100204845 3300005563 Bacteria 2220
78 Ga0068855_100560002 3300005563 Bacteria 1237
79 Ga0068857_100001909 3300005577 Bacteria 16794
80 Ga0068857_100105739 3300005577 Bacteria 2527
81 Ga0068856_100000951 3300005614 Bacteria 31014
82 Ga0068856_100037225 3300005614 Bacteria 4774
83 Ga0068852_100284628 3300005616 Bacteria 1595
84 Ga0068852_100649096 3300005616 Bacteria 1063
85 Ga0068852_100772266 3300005616 Bacteria 974
86 Ga0068859_100076958 3300005617 Bacteria 3377
87 Ga0068859_100597680 3300005617 Bacteria 1196
88 Ga0068864_100102994 3300005618 Bacteria 2534
89 Ga0068866_10116826 3300005718 Bacteria 1497
90 Ga0068861_100005361 3300005719 Bacteria 8671
91 Ga0068861_100178854 3300005719 Bacteria 1764
92 Ga0068870_10020325 3300005840 Bacteria 3232
93 Ga0068863_100004114 3300005841 Bacteria 14377
94 Ga0068863_100474568 3300005841 Bacteria 1229
95 Ga0068858_100097882 3300005842 Bacteria 2735
96 Ga0068858_100386115 3300005842 Bacteria 1344
97 Ga0068860_100001386 3300005843 Bacteria 26300
98 Ga0068860_100032799 3300005843 Bacteria 4989
99 Ga0068860_100047929 3300005843 Bacteria 4072
100 Ga0068862_100085310 3300005844 Bacteria 2744
101 Ga0081455_10119463 3300005937 Bacteria 2078
102 Ga0075365_10220865 3300006038 Bacteria 1329
103 Ga0075368_10002555 3300006042 Bacteria 5961
104 Ga0075363_100000257 3300006048 Bacteria 15188
105 Ga0075364_10054342 3300006051 Bacteria 2619
106 Ga0075362_10000645 3300006177 Bacteria 10238
107 Ga0075367_10001844 3300006178 Bacteria 9354
108 Ga0075367_10119232 3300006178 Bacteria 1625
109 Ga0075369_10005125 3300006186 Bacteria 4880
110 Ga0075366_10015454 3300006195 Bacteria 4375
111 Ga0075366_10059182 3300006195 Bacteria 2276
112 Ga0075366_10109609 3300006195 Bacteria 1660
113 Ga0075366_10130409 3300006195 Bacteria 1517
114 Ga0075366_10166527 3300006195 Bacteria 1337
115 Ga0097621_100542356 3300006237 Bacteria 1058
116 Ga0075370_10000235 3300006353 Bacteria 19837
117 Ga0075370_10002670 3300006353 Bacteria 8337
118 Ga0075370_10098264 3300006353 Bacteria 1693
119 Ga0068871_100545966 3300006358 Bacteria 1049
120 Ga0068871_100718675 3300006358 Unclassified 916
121 Ga0075428_100310146 3300006844 Bacteria 1696
122 Ga0075428_101066772 3300006844 Eukaryota 854
123 Ga0075428_101101231 3300006844 Bacteria 839
124 Ga0075430_100066749 3300006846 Bacteria 3021
125 Ga0075431_100013608 3300006847 Bacteria 8220
126 Ga0075431_100064105 3300006847 Bacteria 3793
127 Ga0075431_100101045 3300006847 Unclassified 2976
128 Ga0075431_100608669 3300006847 Bacteria 1076
129 Ga0075433_10076721 3300006852 Unclassified 2943
130 Ga0075434_100150286 3300006871 Bacteria 2349
131 Ga0075434_100310067 3300006871 Bacteria 1598
132 Ga0075429_100482086 3300006880 Unclassified 1087
133 Ga0068865_100004561 3300006881 Bacteria 8358
134 Ga0068865_100013094 3300006881 Bacteria 5233
135 Ga0075436_100036963 3300006914 Unclassified 3371
136 Ga0097620_100076957 3300006931 Bacteria 3377
137 Ga0097620_100597691 3300006931 Bacteria 1196
138 Ga0079104_1000019 3300006946 Bacteria 269313
139 Ga0105244_10111065 3300009036 Bacteria 1333
140 Ga0105240_10030798 3300009093 Bacteria 6970
141 Ga0105240_10087409 3300009093 Bacteria 3818
142 Ga0105240_10122896 3300009093 Bacteria 3124
143 Ga0105240_10181221 3300009093 Bacteria 2485
144 Ga0105240_10188392 3300009093 Bacteria 2428
145 Ga0105245_10020472 3300009098 Bacteria 5802
146 Ga0105245_10080032 3300009098 Bacteria 2984
147 Ga0105245_10305379 3300009098 Bacteria 1563
148 Ga0105245_10383253 3300009098 Bacteria 1401
149 Ga0114129_10004078 3300009147 Bacteria 20633
150 Ga0114129_10027695 3300009147 Bacteria 8023
151 Ga0114129_10037014 3300009147 Bacteria 6889
152 Ga0114129_10080685 3300009147 Bacteria 4522
153 Ga0114129_10894858 3300009147 Bacteria 1125
154 Ga0105243_10035142 3300009148 Bacteria 3884
155 Ga0105243_10038186 3300009148 Bacteria 3739
156 Ga0105243_10134017 3300009148 Bacteria 2105
157 Ga0105243_10163766 3300009148 Bacteria 1920
158 Ga0105243_10165374 3300009148 Bacteria 1911
159 Ga0105243_10890233 3300009148 Bacteria 885
160 Ga0105241_10007758 3300009174 Bacteria 7890
161 Ga0105241_10115366 3300009174 Bacteria 2156
162 Ga0105241_10148456 3300009174 Bacteria 1915
163 Ga0105242_10000868 3300009176 Bacteria 23481
164 Ga0105242_10035264 3300009176 Bacteria 4012
165 Ga0105242_10156513 3300009176 Bacteria 1991
166 Ga0105242_10190911 3300009176 Bacteria 1813
167 Ga0105237_10010756 3300009545 Bacteria 9710
168 Ga0105237_10026812 3300009545 Bacteria 5889
169 Ga0105237_10028608 3300009545 Bacteria 5674
170 Ga0105237_10140032 3300009545 Bacteria 2413
171 Ga0105237_10157977 3300009545 Bacteria 2265
172 Ga0105237_10716269 3300009545 Bacteria 1007
173 Ga0105238_10001392 3300009551 Bacteria 24268
174 Ga0105238_10006478 3300009551 Bacteria 11644
175 Ga0105238_10007601 3300009551 Bacteria 10861
176 Ga0105238_10031258 3300009551 Bacteria 5420
177 Ga0105238_10139564 3300009551 Bacteria 2401
178 Ga0105249_10150677 3300009553 Bacteria 2239
179 Ga0105249_10335296 3300009553 Bacteria 1527
180 Ga0105239_10000056 3300010375 Bacteria 157615
181 Ga0105239_10006811 3300010375 Bacteria 13183
182 Ga0105239_10007170 3300010375 Bacteria 12822
183 Ga0105239_10044898 3300010375 Unclassified 4844
184 Ga0105239_10196071 3300010375 Bacteria 2262
185 Ga0105246_10174907 3300011119 Bacteria 1648
186 Ga0105246_10988172 3300011119 Bacteria 761
187 Ga0157336_1001030 3300012477 Unclassified 1379
188 Ga0157321_1008976 3300012487 Bacteria 736
189 Ga0157319_1000002 3300012497 Bacteria 410803
190 Ga0157373_10003612 3300013100 Bacteria 11682
191 Ga0157369_10025778 3300013105 Bacteria 6522
192 Ga0157369_10060633 3300013105 Bacteria 4079
193 Ga0157369_10316790 3300013105 Unclassified 1622
194 Ga0157378_10004305 3300013297 Bacteria 12535
195 Ga0157378_10021317 3300013297 Bacteria 5697
196 Ga0157378_10267713 3300013297 Unclassified 1642
197 Ga0163162_10004215 3300013306 Bacteria 13822
198 Ga0163162_10010624 3300013306 Bacteria 8952
199 Ga0163162_10041433 3300013306 Bacteria 4607
200 Ga0163162_11121899 3300013306 Unclassified 891
201 Ga0157372_10006487 3300013307 Bacteria 12450
202 Ga0157375_10102471 3300013308 Bacteria 2947
203 Ga0157375_11232721 3300013308 Bacteria 878
204 Ga0163163_10208556 3300014325 Unclassified 2002
205 Ga0163163_10764277 3300014325 Bacteria 1030
206 Ga0157379_10098367 3300014968 Bacteria 2627
207 Ga0157379_10501267 3300014968 Bacteria 1125
208 Ga0157376_10267125 3300014969 Bacteria 1605
209 Ga0157376_10396388 3300014969 Bacteria 1333
210 Ga0163161_10274457 3300017792 Bacteria 1320
211 Ga0163161_10302456 3300017792 Bacteria 1260
212 Ga0213872_10026966 3300021361 Bacteria 2639
213 Ga0209784_100004 3300025224 Bacteria 1378156
214 Ga0209566_100004 3300025225 Bacteria 1531866
215 Ga0209674_100003 3300025226 Bacteria 2196646
216 Ga0209674_100006 3300025226 Bacteria 1531866
217 Ga0209672_107976 3300025228 Bacteria 1598
218 Ga0209563_100009 3300025230 Bacteria 1378156
219 Ga0209563_100010 3300025230 Bacteria 1337457
220 Ga0207427_100307 3300025231 Bacteria 34034
221 Ga0209437_100004 3300025233 Bacteria 1378156
222 Ga0209258_100162 3300025242 Bacteria 151725
223 Ga0209258_101918 3300025242 Bacteria 6129
224 Ga0207425_1000407 3300025245 Bacteria 28974
225 Ga0209646_1000066 3300025246 Bacteria 244823
226 Ga0209026_1000027 3300025250 Bacteria 351282
227 Ga0209026_1009984 3300025250 Bacteria 1808
228 Ga0209677_100005 3300025253 Bacteria 1378156
229 Ga0209677_100178 3300025253 Bacteria 53699
230 Ga0209677_100183 3300025253 Bacteria 51950
231 Ga0209677_102833 3300025253 Bacteria 6133
232 Ga0209759_1000131 3300025256 Bacteria 130014
233 Ga0209759_1000662 3300025256 Bacteria 31972
234 Ga0209759_1001643 3300025256 Bacteria 11800
235 Ga0209759_1005424 3300025256 Bacteria 4471
236 Ga0209129_1000175 3300025258 Bacteria 93817
237 Ga0209233_1000005 3300025261 Bacteria 1531866
238 Ga0209233_1006680 3300025261 Bacteria 3700
239 Ga0209455_1000128 3300025272 Bacteria 162413
240 Ga0209673_1005494 3300025273 Bacteria 6353
241 Ga0209673_1010530 3300025273 Bacteria 3891
242 Ga0209673_1036513 3300025273 Bacteria 1457
243 Ga0209564_1000136 3300025295 Bacteria 185198
244 Ga0209564_1002533 3300025295 Bacteria 14100
245 Ga0209758_1000275 3300025297 Bacteria 102404
246 Ga0209758_1000902 3300025297 Bacteria 40345
247 Ga0209050_1000703 3300025298 Bacteria 49694
248 Ga0209050_1001381 3300025298 Bacteria 26455
249 Ga0209050_1012767 3300025298 Bacteria 3813
250 Ga0209256_1000024 3300025299 Bacteria 448909
251 Ga0207426_1000004 3300025302 Bacteria 1047900
252 Ga0209051_1000063 3300025303 Bacteria 249739
253 Ga0209051_1002331 3300025303 Bacteria 13787
254 Ga0209257_1000118 3300025304 Bacteria 225963
255 Ga0209257_1017132 3300025304 Bacteria 2876
256 Ga0209257_1018869 3300025304 Bacteria 2628
257 Ga0207655_1100610 3300025728 Bacteria 996
258 Ga0207642_10065352 3300025899 Bacteria 1709
259 Ga0207680_10000002 3300025903 Bacteria 1018646
260 Ga0207680_10008080 3300025903 Bacteria 5155
261 Ga0207645_10005973 3300025907 Bacteria 8767
262 Ga0207645_10052192 3300025907 Bacteria 2613
263 Ga0207645_10144391 3300025907 Bacteria 1551
264 Ga0207705_10067122 3300025909 Bacteria 2595
265 Ga0207705_10528996 3300025909 Bacteria 916
266 Ga0207684_10484286 3300025910 Bacteria 1061
267 Ga0207654_10043012 3300025911 Bacteria 2558
268 Ga0207654_10111096 3300025911 Bacteria 1706
269 Ga0207707_10002429 3300025912 Bacteria 16761
270 Ga0207695_10000243 3300025913 Bacteria 141682
271 Ga0207695_10000663 3300025913 Bacteria 67900
272 Ga0207695_10109938 3300025913 Bacteria 2737
273 Ga0207695_10113680 3300025913 Bacteria 2683
274 Ga0207695_10851117 3300025913 Bacteria 792
275 Ga0207671_10031954 3300025914 Bacteria 3919
276 Ga0207671_10041737 3300025914 Bacteria 3396
277 Ga0207657_10239272 3300025919 Bacteria 1450
278 Ga0207649_10002485 3300025920 Bacteria 10301
279 Ga0207649_10057883 3300025920 Bacteria 2425
280 Ga0207649_10132241 3300025920 Bacteria 1696
281 Ga0207649_10478867 3300025920 Bacteria 944
282 Ga0207652_10052348 3300025921 Bacteria 3503
283 Ga0207681_10028578 3300025923 Bacteria 3613
284 Ga0207694_10001367 3300025924 Bacteria 21012
285 Ga0207694_10027167 3300025924 Bacteria 4358
286 Ga0207694_10356850 3300025924 Unclassified 1211
287 Ga0207644_10320433 3300025931 Bacteria 1253
288 Ga0207690_10000359 3300025932 Bacteria 30319
289 Ga0207690_10153884 3300025932 Bacteria 1707
290 Ga0207706_10203108 3300025933 Unclassified 1738
291 Ga0207706_10237794 3300025933 Bacteria 1592
292 Ga0207686_10001655 3300025934 Bacteria 12411
293 Ga0207686_10063305 3300025934 Bacteria 2352
294 Ga0207709_10184489 3300025935 Bacteria 1476
295 Ga0207709_10264928 3300025935 Bacteria 1262
296 Ga0207704_10085078 3300025938 Bacteria 2057
297 Ga0207689_10014268 3300025942 Bacteria 6761
298 Ga0207689_10094740 3300025942 Bacteria 2452
299 Ga0207661_10403508 3300025944 Bacteria 1240
300 Ga0207679_10000220 3300025945 Bacteria 45059
301 Ga0207667_10002057 3300025949 Bacteria 25223
302 Ga0207667_10164768 3300025949 Bacteria 2279
303 Ga0207667_10283917 3300025949 Bacteria 1691
304 Ga0207667_10365468 3300025949 Bacteria 1471
305 Ga0207667_10732850 3300025949 Bacteria 989
306 Ga0207651_10041564 3300025960 Bacteria 3053
307 Ga0207651_10070670 3300025960 Bacteria 2470
308 Ga0207712_10288624 3300025961 Bacteria 1342
309 Ga0207668_10139877 3300025972 Bacteria 1860
310 Ga0207668_10865161 3300025972 Bacteria 803
311 Ga0207640_10164555 3300025981 Bacteria 1645
312 Ga0207640_10447630 3300025981 Bacteria 1063
313 Ga0207658_10065783 3300025986 Bacteria 2724
314 Ga0207658_10293960 3300025986 Bacteria 1397
315 Ga0207677_10059083 3300026023 Bacteria 2643
316 Ga0207677_10881646 3300026023 Bacteria 806
317 Ga0207703_10082199 3300026035 Bacteria 2687
318 Ga0207703_11017509 3300026035 Bacteria 795
319 Ga0207639_10133013 3300026041 Bacteria 2062
320 Ga0207639_10412274 3300026041 Bacteria 1220
321 Ga0207678_10023119 3300026067 Bacteria 5440
322 Ga0207708_10798104 3300026075 Bacteria 812
323 Ga0207702_10000220 3300026078 Bacteria 66634
324 Ga0207702_10196453 3300026078 Unclassified 1868
325 Ga0207641_10002934 3300026088 Bacteria 15421
326 Ga0207641_10217289 3300026088 Bacteria 1771
327 Ga0207641_10450216 3300026088 Bacteria 1244
328 Ga0207641_10572746 3300026088 Bacteria 1103
329 Ga0207648_10001237 3300026089 Bacteria 28700
330 Ga0207648_10003244 3300026089 Bacteria 17114
331 Ga0207648_10066865 3300026089 Bacteria 3134
332 Ga0207648_10545945 3300026089 Bacteria 1064
333 Ga0207648_10576125 3300026089 Bacteria 1036
334 Ga0207674_10011271 3300026116 Bacteria 10049
335 Ga0207674_10089333 3300026116 Bacteria 3074
336 Ga0207675_100001346 3300026118 Bacteria 24652
337 Ga0207675_100347874 3300026118 Bacteria 1452
338 Ga0207675_100683657 3300026118 Bacteria 1034
339 Ga0207683_10281086 3300026121 Bacteria 1521
340 Ga0207698_10511565 3300026142 Bacteria 1170
341 Ga0207698_11355747 3300026142 Bacteria 726
342 Ga0209281_1000149 3300027111 Bacteria 167880
343 Ga0209995_1024043 3300027471 Bacteria 1014
344 Ga0209983_1009900 3300027665 Bacteria 1948
345 Ga0209971_1000923 3300027682 Bacteria 7569
346 Ga0209966_1008929 3300027695 Bacteria 1785
347 Ga0209998_10023569 3300027717 Bacteria 1331
348 Ga0209813_10001664 3300027866 Bacteria 4997
349 Ga0209974_10008910 3300027876 Bacteria 3416
350 Ga0209974_10014134 3300027876 Bacteria 2660
351 Ga0268266_10000001 3300028379 Bacteria 4040580
352 Ga0268266_10000004 3300028379 Bacteria 1495817
353 Ga0268266_10023539 3300028379 Bacteria 5242
354 Ga0268265_10018728 3300028380 Bacteria 4802
355 Ga0268265_10477202 3300028380 Unclassified 1170
356 Ga0268265_10728971 3300028380 Bacteria 960
357 Ga0268264_10063733 3300028381 Bacteria 3100
358 Ga0268264_10323489 3300028381 Bacteria 1459
359 Ga0265334_10074335 3300028573 Bacteria 1261
360 Ga0265334_10084620 3300028573 Bacteria 1164
361 Ga0265318_10085693 3300028577 Bacteria 1161
362 Ga0265336_10000008 3300028666 Bacteria 336082
363 Ga0307515_10075287 3300028794 Bacteria 4499
364 Ga0307515_10162385 3300028794 Bacteria 2271
365 Ga0307515_10326248 3300028794 Bacteria 1197
366 Ga0265324_10003914 3300029957 Bacteria 6927
367 Ga0265330_10000368 3300031235 Bacteria 31833
368 Ga0265332_10000394 3300031238 Bacteria 31776
369 Ga0265320_10035790 3300031240 Bacteria 2514
370 Ga0265325_10011672 3300031241 Bacteria 5042
371 Ga0265325_10060517 3300031241 Bacteria 1923
372 Ga0265340_10034341 3300031247 Bacteria 2523
373 Ga0265331_10023713 3300031250 Bacteria 3113
374 Ga0307513_10100596 3300031456 Bacteria 2916
375 Ga0307509_10010341 3300031507 Bacteria 11456
376 Ga0307509_10081638 3300031507 Bacteria 3338
377 Ga0307509_10123933 3300031507 Bacteria 2555
378 Ga0307408_100000136 3300031548 Bacteria 81550
379 Ga0307408_100058895 3300031548 Bacteria 2794
380 Ga0307508_10213039 3300031616 Bacteria 1532
381 Ga0316575_10047969 3300031665 Bacteria 1698
382 Ga0316579_10000135 3300031691 Bacteria 20446
383 Ga0316579_10157055 3300031691 Bacteria 1098
384 Ga0265314_10000292 3300031711 Bacteria 71982
385 Ga0316578_10105087 3300031728 Bacteria 1694
386 Ga0316578_10427264 3300031728 Bacteria 784
387 Ga0307516_10000114 3300031730 Bacteria 93691
388 Ga0307516_10000361 3300031730 Bacteria 59122
389 Ga0307516_10102606 3300031730 Bacteria 2675
390 Ga0316577_10186726 3300031733 Bacteria 1171
391 Ga0307406_10000105 3300031901 Bacteria 48938
392 Ga0307406_10122815 3300031901 Bacteria 1809
393 Ga0307412_10234665 3300031911 Bacteria 1415
394 Ga0316583_10005122 3300032133 Bacteria 4696
395 Ga0316583_10041673 3300032133 Bacteria 1624
396 Ga0316580_10115248 3300032139 Bacteria 822
397 Ga0307510_10000018 3300033180 Bacteria 192986
398 Ga0307510_10032571 3300033180 Bacteria 5869
399 Ga0307510_10088490 3300033180 Bacteria 2956
400 Ga0373959_0066074 3300034820 Bacteria 809
401 Ga0373939_0085252 3300035114 Unclassified 1058
402 Ga0373945_0188362 3300035116 Bacteria 852
403 Ga0373931_0022281 3300035691 Bacteria 3187
404 Ga0373927_0024670 3300035695 Bacteria 3930
405 Ga0373927_0300818 3300035695 Bacteria 1056
406 Ga0373927_0302473 3300035695 Bacteria 1053
407 Ga0373947_0028546 3300035725 Unclassified 3272
408 Ga0373937_0094584 3300036401 Bacteria 2771
409 Ga0316582_0000046 3300036647 Bacteria 29572
410 Ga0316582_0030887 3300036647 Bacteria 3269
411 Ga0316584_0019859 3300036712 Bacteria 4861
412 Ga0373925_0001876 3300037068 Bacteria 17464
413 Ga0373925_0031306 3300037068 Unclassified 3908
414 Ga0395898_0039705 3300037466 Bacteria 4657
415 Ga0395905_0000039 3300037471 Bacteria 253197
416 Ga0395905_0002983 3300037471 Bacteria 18365
417 Ga0395905_0004666 3300037471 Bacteria 14168
418 Ga0395905_0015670 3300037471 Bacteria 7202
419 Ga0395905_0156328 3300037471 Bacteria 2145
420 Ga0316581_0072075 3300037588 Bacteria 1061
421 Ga0395901_0016167 3300038443 Bacteria 7600
422 Ga0436361_0304046 3300039447 Bacteria 18116
423 Ga0436361_0433542 3300039447 Bacteria 1687
424 Ga0436361_1122650 3300039447 Bacteria 2459
425 Ga0451789_0419046 3300041443 Bacteria 1624
426 Ga0451793_0385518 3300041452 Bacteria 3464
427 Ga0451797_0601666 3300041453 Bacteria 1364
428 Ga0451795_0964762 3300041456 Bacteria 769
429 Ga0451807_2008794 3300041486 Bacteria 1172
430 Ga0451855_0476580 3300041511 Bacteria 1454
431 Ga0451853_0712802 3300041512 Bacteria 1884
432 Ga0439441_030748 3300042001 Bacteria 1039
433 Ga0450919_002427 3300042121 Bacteria 2412
434 Ga0450920_002499 3300042122 Bacteria 3131
435 Ga0439458_0050383 3300042157 Bacteria 1027
436 Ga0439434_0049587 3300042435 Bacteria 1300
437 Ga0439459_0006559 3300042438 Bacteria 1941
438 Ga0450918_000003 3300042531 Bacteria 58967
439 Ga0451577_0023595 3300042876 Bacteria 5608
440 Ga0451577_0152498 3300042876 Bacteria 2079
441 Ga0451577_0574701 3300042876 Bacteria 1023
442 Ga0466969_0001367 3300044656 Bacteria 13144
443 Ga0466969_0006082 3300044656 Bacteria 6421
444 Ga0466972_0000519 3300044658 Bacteria 19047
445 Ga0453683_0141611 3300044673 Bacteria 1518
446 Ga0466965_0016159 3300044683 Bacteria 3548
447 Ga0466965_0045870 3300044683 Bacteria 2163
448 Ga0466966_0011080 3300044684 Bacteria 5985
449 Ga0466961_0000358 3300044693 Bacteria 29816
450 Ga0466961_0118577 3300044693 Bacteria 1662
451 Ga0466964_0003754 3300044706 Bacteria 5565
452 Ga0453684_0000823 3300044712 Bacteria 104784
453 Ga0453684_0144892 3300044712 Bacteria 2831
454 Ga0453684_0200643 3300044712 Bacteria 2325
455 Ga0453684_0340128 3300044712 Bacteria 1695
456 Ga0466971_0355333 3300044719 Bacteria 709
457 Ga0466968_0275560 3300044735 Bacteria 804
458 Ga0466957_0037013 3300044842 Bacteria 2936
459 Ga0466957_0100369 3300044842 Bacteria 1824
460 Ga0466959_0096895 3300045049 Bacteria 2114
461 Ga0466959_0272722 3300045049 Bacteria 1162
462 Ga0451576_0239549 3300045051 Bacteria 1895
463 Ga0451576_0936342 3300045051 Bacteria 909
464 Ga0466958_0566166 3300045836 Bacteria 738
465 Ga0466967_0113340 3300045976 Bacteria 2494
466 Ga0495590_0001608 3300046457 Bacteria 9657
467 Ga0495638_0000007 3300046460 Bacteria 602783
468 Ga0495638_0096111 3300046460 Bacteria 1779
469 Ga0495650_0000203 3300046471 Bacteria 129364
470 Ga0495650_0013148 3300046471 Bacteria 4398
471 Ga0495580_0000077 3300046472 Bacteria 61724
472 Ga0495580_0091438 3300046472 Unclassified 2118
473 Ga0495582_0284477 3300046473 Unclassified 950
474 Ga0495605_0043124 3300046474 Bacteria 2238
475 Ga0495605_0080517 3300046474 Bacteria 1524
476 Ga0495639_0038401 3300046475 Bacteria 2150
477 Ga0495584_0033651 3300046491 Bacteria 2594
478 Ga0495583_0000444 3300046506 Bacteria 62022
479 Ga0495583_0000449 3300046506 Bacteria 61654
480 Ga0495583_0202862 3300046506 Bacteria 805
481 Ga0495606_0002487 3300046507 Bacteria 21331
482 Ga0495606_0156435 3300046507 Bacteria 1333
483 Ga0495606_0203732 3300046507 Bacteria 1126
484 Ga0495616_0033452 3300046513 Bacteria 2678
485 Ga0495632_0251699 3300046519 Bacteria 792
486 Ga0495648_0014477 3300046524 Bacteria 5772
487 Ga0495642_0143559 3300046528 Bacteria 1031
488 Ga0495652_0288269 3300046529 Bacteria 1199
489 Ga0495665_0070843 3300046531 Bacteria 1837
490 Ga0495586_0359238 3300046535 Bacteria 837
491 Ga0495597_0004546 3300046542 Bacteria 7588
492 Ga0495597_0190701 3300046542 Bacteria 825
493 Ga0495656_0139697 3300046615 Unclassified 1161
494 Ga0495668_0074729 3300046616 Bacteria 1861
495 Ga0495668_0183596 3300046616 Bacteria 1146
496 Ga0495611_0080171 3300046648 Bacteria 1500
497 Ga0495625_0008948 3300046660 Bacteria 8458
498 Ga0495625_0010840 3300046660 Bacteria 7495
499 Ga0495659_0016257 3300046664 Unclassified 2453
500 Ga0495647_0145203 3300046681 Bacteria 1014
501 Ga0495658_0083733 3300046683 Unclassified 1877
502 Ga0495649_0000211 3300046694 Bacteria 51291
503 Ga0495649_0000298 3300046694 Bacteria 43334
504 Ga0495589_0087591 3300046794 Bacteria 1512
505 Ga0495674_0026722 3300047319 Bacteria 5279
506 Ga0495674_0601977 3300047319 Bacteria 871
507 Ga0495672_0006385 3300047320 Bacteria 9153
508 Ga0495672_0034691 3300047320 Bacteria 3114
509 Ga0495683_0140859 3300047323 Bacteria 1130
510 Ga0495687_000259 3300047443 Bacteria 71307
511 Ga0495677_0054401 3300047445 Bacteria 1476
512 Ga0495673_0006234 3300047469 Bacteria 7053
513 Ga0495686_0003932 3300047472 Bacteria 12502
514 Ga0495626_0034293 3300048091 Bacteria 2428
515 Ga0495626_0056677 3300048091 Bacteria 1793
516 Ga0496100_0001348 3300048903 Bacteria 12020
517 Ga0496100_0149472 3300048903 Bacteria 1664
518 Ga0496100_0229195 3300048903 Bacteria 1366
519 Ga0496101_0001261 3300048904 Bacteria 15149
520 Ga0496102_0006910 3300048905 Bacteria 9680
521 Ga0496103_0001888 3300048906 Bacteria 13621
522 Ga0496103_0093533 3300048906 Bacteria 1898
523 Ga0496104_0073344 3300048907 Bacteria 3256
524 Ga0496105_0023528 3300048908 Bacteria 4998
525 Ga0496105_0048394 3300048908 Bacteria 3509
526 Ga0496105_0766954 3300048908 Bacteria 735
527 Ga0496106_0221667 3300048909 Bacteria 1508
528 Ga0496106_0222647 3300048909 Bacteria 1505
529 Ga0496106_0259801 3300048909 Bacteria 1389
530 Ga0496107_0123045 3300048910 Bacteria 1911
531 Ga0496112_0011547 3300048915 Bacteria 8072
532 Ga0496112_0017817 3300048915 Bacteria 6684
533 Ga0496112_0536782 3300048915 Bacteria 1104
534 Ga0496113_0083113 3300048916 Bacteria 2456
535 Ga0496115_0004797 3300048918 Bacteria 9812
536 Ga0496116_0035675 3300048919 Bacteria 3490
537 Ga0496116_0097322 3300048919 Bacteria 1770
538 Ga0496117_0000067 3300048920 Bacteria 249348
539 Ga0496117_0003940 3300048920 Bacteria 16796
540 Ga0496117_0035005 3300048920 Bacteria 3776
541 Ga0496118_0000021 3300048921 Bacteria 444988
542 Ga0496118_0000574 3300048921 Bacteria 60884
543 Ga0496118_0002726 3300048921 Bacteria 23282
544 Ga0496119_0000362 3300048922 Bacteria 63745
545 Ga0496119_0011134 3300048922 Bacteria 7491
546 Ga0496119_0012940 3300048922 Bacteria 6712
547 Ga0496120_0000042 3300048923 Bacteria 197055
548 Ga0496120_0000341 3300048923 Bacteria 77155
549 Ga0496120_0000744 3300048923 Bacteria 47495
550 Ga0496120_0047130 3300048923 Bacteria 2486
551 Ga0496120_0057999 3300048923 Bacteria 2176
552 Ga0496121_0000169 3300048924 Bacteria 144577
553 Ga0496121_0000877 3300048924 Bacteria 54435
554 Ga0496121_0002108 3300048924 Bacteria 31297
555 Ga0496121_0039264 3300048924 Bacteria 4175
556 Ga0496121_0073244 3300048924 Bacteria 2746
557 Ga0496121_0367222 3300048924 Bacteria 953
558 Ga0496124_0061127 3300048927 Bacteria 3158
559 Ga0496125_0043123 3300048928 Bacteria 3834
560 Ga0496125_0176131 3300048928 Bacteria 1431
561 Ga0496126_0008478 3300048929 Bacteria 11086
562 Ga0496126_0021075 3300048929 Bacteria 6375
563 Ga0501308_001501 3300049128 Bacteria 1882
564 Ga0501310_007891 3300049130 Bacteria 1145
565 Ga0495678_015483 3300049459 Bacteria 3506
566 Ga0495682_0000499 3300049460 Bacteria 27163
567 Ga0495682_0017496 3300049460 Bacteria 2705
568 Ga0501296_002571 3300049519 Bacteria 1905
569 Ga0501297_013438 3300049520 Bacteria 961
570 Ga0501300_005790 3300049523 Bacteria 1819
571 Ga0501031_0051918 3300049568 Bacteria 2671
572 Ga0501032_0025115 3300049569 Bacteria 4108
573 Ga0501033_0111007 3300049570 Bacteria 1995
574 Ga0501034_0020548 3300049571 Bacteria 6744
575 Ga0501036_0018760 3300049572 Bacteria 5801
576 Ga0501037_0002515 3300049573 Bacteria 13237
577 Ga0501037_0010746 3300049573 Bacteria 6726
578 Ga0501038_0115445 3300049574 Bacteria 2219
579 Ga0501039_0148964 3300049575 Bacteria 1839
580 Ga0501040_0015792 3300049576 Bacteria 4990
581 Ga0501040_0375309 3300049576 Unclassified 1020
582 Ga0501041_0008666 3300049577 Bacteria 5990
583 Ga0501041_0334588 3300049577 Unclassified 956
584 Ga0501042_0009104 3300049578 Bacteria 6599
585 Ga0501042_0720115 3300049578 Bacteria 726
586 Ga0501043_0015781 3300049579 Bacteria 5921
587 Ga0501047_0357861 3300049581 Bacteria 1296
588 Ga0501048_0081693 3300049582 Bacteria 2279
589 Ga0501068_0007858 3300049584 Bacteria 5910
590 Ga0501069_0049080 3300049585 Bacteria 2345
591 Ga0501070_0005064 3300049586 Bacteria 11231
592 Ga0501071_0026940 3300049587 Bacteria 4040
593 Ga0501071_0291594 3300049587 Bacteria 1236
594 Ga0501072_0027737 3300049588 Bacteria 4417
595 Ga0501072_0203536 3300049588 Bacteria 1578
596 Ga0501072_0206493 3300049588 Bacteria 1566
597 Ga0501072_0490310 3300049588 Bacteria 972
598 Ga0501073_0003785 3300049589 Bacteria 11373
599 Ga0501073_0196349 3300049589 Bacteria 1396
600 Ga0501074_0011460 3300049590 Bacteria 6449
601 Ga0501075_0006370 3300049591 Bacteria 8122
602 Ga0501075_0016208 3300049591 Bacteria 5364
603 Ga0501075_0559771 3300049591 Bacteria 872
604 Ga0501076_0016177 3300049592 Bacteria 5649
605 Ga0501077_0111672 3300049593 Bacteria 1732
606 Ga0501201_001004 3300049651 Bacteria 2648
607 Ga0501222_004389 3300049662 Bacteria 1913
608 Ga0501233_004320 3300049668 Bacteria 2598
609 Ga0501242_015669 3300049674 Bacteria 946
610 Ga0501249_009741 3300049679 Bacteria 1999
611 Ga0501221_001282 3300049704 Bacteria 4149
612 Ga0501229_005760 3300049706 Bacteria 1525
613 Ga0501080_0001892 3300049742 Bacteria 18029
614 Ga0501080_0083436 3300049742 Bacteria 2968
615 Ga0501081_0044711 3300049743 Bacteria 3040
616 Ga0501081_0252352 3300049743 Bacteria 1288
617 Ga0501266_000425 3300049763 Bacteria 5612
618 Ga0501272_001778 3300049769 Bacteria 2091
619 Ga0501274_003883 3300049771 Bacteria 1217
620 Ga0501035_0013142 3300049822 Bacteria 7642
621 Ga0501044_0004263 3300049823 Bacteria 16046
622 Ga0501045_0076036 3300049824 Bacteria 2473
623 nmdc:mga03683_2478_c1 3300050489 Bacteria 5741
624 nmdc:mga03683_75684_c1 3300050489 Bacteria 1446
625 nmdc:mga03n38_230411_c1 3300050490 Bacteria 971
626 nmdc:mga00v17_209918_c1 3300050491 Bacteria 1260
627 nmdc:mga00v17_48921_c1 3300050491 Bacteria 2563
628 nmdc:mga0yw44_11630_c1 3300050492 Bacteria 4554
629 nmdc:mga0k408_12157_c1 3300050493 Bacteria 4702
630 nmdc:mga0k408_44012_c1 3300050493 Bacteria 2574
631 nmdc:mga0k408_53202_c1 3300050493 Bacteria 2346
632 nmdc:mga0k408_65992_c1 3300050493 Bacteria 2107
633 nmdc:mga06z11_12478_c1 3300050494 Bacteria 3698
634 nmdc:mga06z11_169643_c1 3300050494 Bacteria 1252
635 nmdc:mga04h51_4999_c1 3300050495 Bacteria 3347
636 nmdc:mga07m45_1177_c1 3300050496 Bacteria 11780
637 nmdc:mga07m45_11889_c1 3300050496 Bacteria 4585
638 nmdc:mga07m45_24612_c1 3300050496 Bacteria 3300
639 nmdc:mga07m45_24747_c1 3300050496 Bacteria 3291
640 nmdc:mga07m45_35628_c1 3300050496 Bacteria 2769
641 nmdc:mga07m45_67822_c1 3300050496 Bacteria 2027
642 nmdc:mga05p37_226217_c1 3300050507 Bacteria 2256
643 nmdc:mga05p37_234617_c1 3300050507 Bacteria 2209
644 nmdc:mga05p37_25817_c1 3300050507 Bacteria 7143
645 nmdc:mga05p37_66002_c2 3300050507 Unclassified 3070
646 nmdc:mga05p37_8138_c1 3300050507 Bacteria 12395
647 nmdc:mga09592_296439_c1 3300050508 Bacteria 1402
648 nmdc:mga0qj67_82513_c1 3300050509 Bacteria 2578
649 nmdc:mga06r32_382306_c1 3300050510 Bacteria 1391
650 nmdc:mga06r32_408345_c1 3300050510 Bacteria 1340
651 nmdc:mga08y16_40239_c1 3300050511 Unclassified 4900
652 nmdc:mga0n895_208645_c1 3300050512 Bacteria 1984
653 nmdc:mga0n895_241958_c1 3300050512 Unclassified 1831
654 nmdc:mga08x19_15033_c1 3300050514 Bacteria 4701
655 nmdc:mga0a205_91295_c1 3300050515 Unclassified 2943
656 nmdc:mga0sz30_3643_c1 3300050516 Bacteria 5242
657 Ga0500578_0000025 3300053086 Bacteria 151485
658 Ga0500643_085364 3300053087 Bacteria 864
659 Ga0500646_0019797 3300053090 Bacteria 1783
660 Ga0500562_016708 3300053108 Bacteria 1888
661 Ga0500628_066969 3300053129 Bacteria 891
662 Ga0500658_0056849 3300053134 Bacteria 1615
663 Ga0500559_0015943 3300053136 Bacteria 3172
664 Ga0500564_126533 3300053138 Bacteria 1109
665 Ga0500568_0005699 3300053139 Bacteria 6388
666 Ga0500568_0016467 3300053139 Bacteria 3286
667 Ga0500604_0007009 3300053151 Bacteria 2984
668 Ga0500616_0089221 3300053153 Bacteria 1531
669 Ga0500622_0004094 3300053156 Bacteria 9339
670 Ga0500622_0005022 3300053156 Bacteria 8063
671 Ga0500636_0107404 3300053177 Bacteria 1580
672 Ga0500625_011277 3300053729 Bacteria 4054
673 Ga0590071_002298 3300059421 Bacteria 4840
674 Ga0590075_093321 3300059424 Bacteria 782
675 Ga0501082_0041018 3300060353 Bacteria 3990
676 Ga0501082_0157552 3300060353 Bacteria 1973
677 Ga0466962_0034671 3300061719 Bacteria 2415
678 Ga0530510_0059855 3300061734 Bacteria 2755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0252352 Ga0501081_0252352_740_1258 171
2 3300012487 Ga0157321_1008976 Ga0157321_10089761 174
3 3300031507 Ga0307509_10010341 Ga0307509_100103415 194
4 3300005545 Ga0070695_100065331 Ga0070695_1000653313 197
5 3300006038 Ga0075365_10220865 Ga0075365_102208653 197
6 3300006042 Ga0075368_10002555 Ga0075368_100025554 197
7 3300006048 Ga0075363_100000257 Ga0075363_10000025713 197
8 3300006051 Ga0075364_10054342 Ga0075364_100543422 197
9 3300006177 Ga0075362_10000645 Ga0075362_100006455 197
10 3300006178 Ga0075367_10001844 Ga0075367_100018443 197
11 3300006178 Ga0075367_10119232 Ga0075367_101192323 197
12 3300006186 Ga0075369_10005125 Ga0075369_100051254 197
13 3300006195 Ga0075366_10109609 Ga0075366_101096092 197
14 3300006353 Ga0075370_10000235 Ga0075370_100002354 197
15 3300006353 Ga0075370_10002670 Ga0075370_100026709 197
16 3300006358 Ga0068871_100718675 Ga0068871_1007186751 197
17 3300006844 Ga0075428_100310146 Ga0075428_1003101462 197
18 3300006844 Ga0075428_101066772 Ga0075428_1010667722 197
19 3300006846 Ga0075430_100066749 Ga0075430_1000667492 197
20 3300006847 Ga0075431_100064105 Ga0075431_1000641052 197
21 3300006852 Ga0075433_10076721 Ga0075433_100767212 197
22 3300006871 Ga0075434_100150286 Ga0075434_1001502862 197
23 3300006871 Ga0075434_100310067 Ga0075434_1003100672 197
24 3300009147 Ga0114129_10027695 Ga0114129_100276953 197
25 3300009147 Ga0114129_10037014 Ga0114129_100370146 197
26 3300012477 Ga0157336_1001030 Ga0157336_10010302 197
27 3300013297 Ga0157378_10267713 Ga0157378_102677132 197
28 3300013306 Ga0163162_11121899 Ga0163162_111218991 197
29 3300026088 Ga0207641_10572746 Ga0207641_105727462 197
30 3300027695 Ga0209966_1008929 Ga0209966_10089293 197
31 3300027717 Ga0209998_10023569 Ga0209998_100235691 197
32 3300027866 Ga0209813_10001664 Ga0209813_100016646 197
33 3300031730 Ga0307516_10102606 Ga0307516_101026063 197
34 3300031901 Ga0307406_10122815 Ga0307406_101228152 197
35 3300035114 Ga0373939_0085252 Ga0373939_0085252_83_679 197
36 3300035695 Ga0373927_0302473 Ga0373927_0302473_412_1008 197
37 3300035725 Ga0373947_0028546 Ga0373947_0028546_473_1069 197
38 3300037068 Ga0373925_0031306 Ga0373925_0031306_3069_3665 197
39 3300042001 Ga0439441_030748 Ga0439441_030748_167_763 197
40 3300046472 Ga0495580_0091438 Ga0495580_0091438_1468_2064 197
41 3300046473 Ga0495582_0284477 Ga0495582_0284477_53_649 197
42 3300046615 Ga0495656_0139697 Ga0495656_0139697_94_690 197
43 3300046616 Ga0495668_0074729 Ga0495668_0074729_552_1145 197
44 3300046664 Ga0495659_0016257 Ga0495659_0016257_30_626 197
45 3300046683 Ga0495658_0083733 Ga0495658_0083733_89_685 197
46 3300047319 Ga0495674_0601977 Ga0495674_0601977_65_661 197
47 3300049568 Ga0501031_0051918 Ga0501031_0051918_183_779 197
48 3300049569 Ga0501032_0025115 Ga0501032_0025115_1054_1650 197
49 3300049570 Ga0501033_0111007 Ga0501033_0111007_1248_1844 197
50 3300049571 Ga0501034_0020548 Ga0501034_0020548_375_971 197
51 3300049572 Ga0501036_0018760 Ga0501036_0018760_4557_5153 197
52 3300049573 Ga0501037_0002515 Ga0501037_0002515_7627_8223 197
53 3300049574 Ga0501038_0115445 Ga0501038_0115445_1249_1845 197
54 3300049575 Ga0501039_0148964 Ga0501039_0148964_1188_1784 197
55 3300049576 Ga0501040_0015792 Ga0501040_0015792_2026_2622 197
56 3300049577 Ga0501041_0008666 Ga0501041_0008666_5020_5616 197
57 3300049577 Ga0501041_0334588 Ga0501041_0334588_270_866 197
58 3300049578 Ga0501042_0009104 Ga0501042_0009104_989_1585 197
59 3300049579 Ga0501043_0015781 Ga0501043_0015781_2026_2622 197
60 3300049582 Ga0501048_0081693 Ga0501048_0081693_1501_2097 197
61 3300049584 Ga0501068_0007858 Ga0501068_0007858_4800_5396 197
62 3300049585 Ga0501069_0049080 Ga0501069_0049080_1107_1703 197
63 3300049586 Ga0501070_0005064 Ga0501070_0005064_2794_3390 197
64 3300049588 Ga0501072_0027737 Ga0501072_0027737_521_1117 197
65 3300049588 Ga0501072_0490310 Ga0501072_0490310_64_660 197
66 3300049589 Ga0501073_0003785 Ga0501073_0003785_6278_6874 197
67 3300049590 Ga0501074_0011460 Ga0501074_0011460_5408_6004 197
68 3300049591 Ga0501075_0016208 Ga0501075_0016208_91_687 197
69 3300049592 Ga0501076_0016177 Ga0501076_0016177_376_972 197
70 3300049593 Ga0501077_0111672 Ga0501077_0111672_975_1571 197
71 3300049742 Ga0501080_0083436 Ga0501080_0083436_1230_1826 197
72 3300049743 Ga0501081_0044711 Ga0501081_0044711_36_632 197
73 3300049822 Ga0501035_0013142 Ga0501035_0013142_1976_2572 197
74 3300049823 Ga0501044_0004263 Ga0501044_0004263_10770_11366 197
75 3300049824 Ga0501045_0076036 Ga0501045_0076036_67_663 197
76 3300050507 nmdc:mga05p37_226217_c1 nmdc:mga05p37_226217_c1_1175_1771 197
77 3300050507 nmdc:mga05p37_66002_c2 nmdc:mga05p37_66002_c2_1483_2079 197
78 3300050508 nmdc:mga09592_296439_c1 nmdc:mga09592_296439_c1_578_1174 197
79 3300050510 nmdc:mga06r32_382306_c1 nmdc:mga06r32_382306_c1_530_1126 197
80 3300050511 nmdc:mga08y16_40239_c1 nmdc:mga08y16_40239_c1_1287_1883 197
81 3300050512 nmdc:mga0n895_208645_c1 nmdc:mga0n895_208645_c1_401_997 197
82 3300050512 nmdc:mga0n895_241958_c1 nmdc:mga0n895_241958_c1_250_846 197
83 3300050515 nmdc:mga0a205_91295_c1 nmdc:mga0a205_91295_c1_1325_1921 197
84 3300059421 Ga0590071_002298 Ga0590071_002298_2971_3567 197
85 3300060353 Ga0501082_0041018 Ga0501082_0041018_3019_3615 197
86 3300061734 Ga0530510_0059855 Ga0530510_0059855_1992_2588 197
87 iso_pu_bacteria 2585428057 2587725643 200
88 iso_pu_bacteria 2585428058 2587735077 200
89 iso_pu_bacteria 2588253510 2588290573 200
90 iso_pu_bacteria 2643221592 2643968288 200
91 iso_pu_bacteria 2643221625 2644143559 200
92 iso_pu_bacteria 2643221648 2644272066 200
93 3300005336 Ga0070680_100238870 Ga0070680_1002388702 201
94 3300005458 Ga0070681_10269399 Ga0070681_102693992 201
95 3300005545 Ga0070695_100694331 Ga0070695_1006943311 201
96 3300025912 Ga0207707_10002429 Ga0207707_100024292 201
97 iso_pu_bacteria 2643221639 2644219482 201
98 iso_pu_bacteria 2643221644 2644243258 201
99 iso_pu_bacteria 2643221646 2644255912 201
100 iso_pu_bacteria 2738541337 2739054368 201
101 iso_pu_bacteria 2831864461 2831868765 201
102 iso_pu_bacteria 2886848708 2886851906 201
103 3300003354 JGI25160J50197_1000120 JGI25160J50197_100012026 202
104 3300005262 Ga0065165_1000382 Ga0065165_100038226 202
105 3300025302 Ga0207426_1000004 Ga0207426_1000004454 202
106 3300037471 Ga0395905_0000039 Ga0395905_0000039_195334_195942 202
107 3300037471 Ga0395905_0015670 Ga0395905_0015670_2731_3339 202
108 3300046457 Ga0495590_0001608 Ga0495590_0001608_4449_5057 202
109 3300046474 Ga0495605_0043124 Ga0495605_0043124_1186_1794 202
110 3300046474 Ga0495605_0080517 Ga0495605_0080517_34_642 202
111 3300046506 Ga0495583_0000449 Ga0495583_0000449_3748_4356 202
112 3300046524 Ga0495648_0014477 Ga0495648_0014477_2642_3250 202
113 3300046542 Ga0495597_0190701 Ga0495597_0190701_75_683 202
114 3300046694 Ga0495649_0000211 Ga0495649_0000211_46963_47571 202
115 3300047320 Ga0495672_0006385 Ga0495672_0006385_7977_8585 202
116 3300047323 Ga0495683_0140859 Ga0495683_0140859_365_973 202
117 3300047445 Ga0495677_0054401 Ga0495677_0054401_846_1454 202
118 3300047469 Ga0495673_0006234 Ga0495673_0006234_3102_3710 202
119 3300048903 Ga0496100_0001348 Ga0496100_0001348_5295_5903 202
120 3300048904 Ga0496101_0001261 Ga0496101_0001261_13239_13847 202
121 3300048905 Ga0496102_0006910 Ga0496102_0006910_5228_5836 202
122 3300048906 Ga0496103_0001888 Ga0496103_0001888_11083_11691 202
123 3300048908 Ga0496105_0048394 Ga0496105_0048394_557_1165 202
124 3300048908 Ga0496105_0766954 Ga0496105_0766954_99_707 202
125 3300048909 Ga0496106_0221667 Ga0496106_0221667_737_1345 202
126 3300048915 Ga0496112_0536782 Ga0496112_0536782_376_984 202
127 3300048920 Ga0496117_0003940 Ga0496117_0003940_13220_13828 202
128 3300048921 Ga0496118_0000574 Ga0496118_0000574_13219_13827 202
129 3300048924 Ga0496121_0000877 Ga0496121_0000877_40589_41197 202
130 3300049460 Ga0495682_0000499 Ga0495682_0000499_22808_23416 202
131 iso_pu_bacteria 2894023352 2894027469 202
132 3300005548 Ga0070665_100000179 Ga0070665_10000017915 203
133 3300028379 Ga0268266_10000001 Ga0268266_100000012350 203
134 3300049587 Ga0501071_0026940 Ga0501071_0026940_631_1245 203
135 3300049588 Ga0501072_0206493 Ga0501072_0206493_418_1032 203
136 3300049589 Ga0501073_0196349 Ga0501073_0196349_631_1245 203
137 3300049591 Ga0501075_0006370 Ga0501075_0006370_3017_3631 203
138 3300049742 Ga0501080_0001892 Ga0501080_0001892_11412_12026 203
139 iso_pu_bacteria 2842718218 2842720463 203
140 iso_pu_bacteria 2974320154 2974321355 203
141 3300002773 JGI25152J39213_1001436 JGI25152J39213_10014365 204
142 3300003320 rootH2_10000113 rootH2_1000011324 204
143 3300003771 Ga0055526_1001497 Ga0055526_100149714 204
144 3300005262 Ga0065165_1001129 Ga0065165_100112913 204
145 3300005327 Ga0070658_10012913 Ga0070658_100129135 204
146 3300005335 Ga0070666_10000010 Ga0070666_1000001043 204
147 3300005344 Ga0070661_100096203 Ga0070661_1000962033 204
148 3300005367 Ga0070667_100136741 Ga0070667_1001367413 204
149 3300005548 Ga0070665_100067913 Ga0070665_1000679133 204
150 3300005577 Ga0068857_100105739 Ga0068857_1001057392 204
151 3300005843 Ga0068860_100032799 Ga0068860_1000327993 204
152 3300009093 Ga0105240_10030798 Ga0105240_100307984 204
153 3300009551 Ga0105238_10001392 Ga0105238_100013923 204
154 3300010375 Ga0105239_10000056 Ga0105239_1000005644 204
155 3300013306 Ga0163162_10010624 Ga0163162_100106247 204
156 3300014325 Ga0163163_10764277 Ga0163163_107642771 204
157 3300025245 Ga0207425_1000407 Ga0207425_100040710 204
158 3300025258 Ga0209129_1000175 Ga0209129_100017580 204
159 3300025273 Ga0209673_1005494 Ga0209673_10054944 204
160 3300025273 Ga0209673_1010530 Ga0209673_10105302 204
161 3300025295 Ga0209564_1000136 Ga0209564_100013686 204
162 3300025297 Ga0209758_1000275 Ga0209758_100027535 204
163 3300025297 Ga0209758_1000902 Ga0209758_100090211 204
164 3300025298 Ga0209050_1001381 Ga0209050_100138122 204
165 3300025304 Ga0209257_1018869 Ga0209257_10188692 204
166 3300025903 Ga0207680_10000002 Ga0207680_10000002347 204
167 3300025913 Ga0207695_10000243 Ga0207695_100002436 204
168 3300025913 Ga0207695_10000663 Ga0207695_1000066338 204
169 3300025920 Ga0207649_10057883 Ga0207649_100578833 204
170 3300025924 Ga0207694_10001367 Ga0207694_100013673 204
171 3300025972 Ga0207668_10139877 Ga0207668_101398772 204
172 3300026116 Ga0207674_10089333 Ga0207674_100893332 204
173 3300028379 Ga0268266_10000004 Ga0268266_10000004341 204
174 3300028381 Ga0268264_10063733 Ga0268264_100637332 204
175 3300031456 Ga0307513_10100596 Ga0307513_101005962 204
176 3300031691 Ga0316579_10000135 Ga0316579_1000013510 204
177 3300031691 Ga0316579_10157055 Ga0316579_101570551 204
178 3300031728 Ga0316578_10105087 Ga0316578_101050872 204
179 3300031728 Ga0316578_10427264 Ga0316578_104272641 204
180 3300031733 Ga0316577_10186726 Ga0316577_101867261 204
181 3300032133 Ga0316583_10005122 Ga0316583_100051225 204
182 3300032133 Ga0316583_10041673 Ga0316583_100416732 204
183 3300032139 Ga0316580_10115248 Ga0316580_101152481 204
184 3300033180 Ga0307510_10032571 Ga0307510_100325713 204
185 3300035691 Ga0373931_0022281 Ga0373931_0022281_2345_2959 204
186 3300036647 Ga0316582_0000046 Ga0316582_0000046_4442_5059 204
187 3300036647 Ga0316582_0030887 Ga0316582_0030887_665_1282 204
188 3300036712 Ga0316584_0019859 Ga0316584_0019859_1691_2308 204
189 3300037588 Ga0316581_0072075 Ga0316581_0072075_289_906 204
190 3300044712 Ga0453684_0144892 Ga0453684_0144892_460_1074 204
191 3300046471 Ga0495650_0000203 Ga0495650_0000203_108928_109545 204
192 3300046507 Ga0495606_0156435 Ga0495606_0156435_204_821 204
193 3300046519 Ga0495632_0251699 Ga0495632_0251699_113_730 204
194 3300046660 Ga0495625_0008948 Ga0495625_0008948_188_805 204
195 3300048903 Ga0496100_0149472 Ga0496100_0149472_346_963 204
196 3300048903 Ga0496100_0229195 Ga0496100_0229195_383_1000 204
197 3300048908 Ga0496105_0023528 Ga0496105_0023528_4368_4985 204
198 3300048909 Ga0496106_0259801 Ga0496106_0259801_638_1255 204
199 3300048910 Ga0496107_0123045 Ga0496107_0123045_249_866 204
200 3300048918 Ga0496115_0004797 Ga0496115_0004797_6760_7377 204
201 3300048919 Ga0496116_0097322 Ga0496116_0097322_292_909 204
202 3300048920 Ga0496117_0035005 Ga0496117_0035005_2395_3012 204
203 3300048921 Ga0496118_0002726 Ga0496118_0002726_14638_15255 204
204 3300048922 Ga0496119_0000362 Ga0496119_0000362_12812_13429 204
205 3300048922 Ga0496119_0011134 Ga0496119_0011134_773_1414 204
206 3300048923 Ga0496120_0000341 Ga0496120_0000341_26237_26854 204
207 3300048923 Ga0496120_0000744 Ga0496120_0000744_3014_3655 204
208 3300048924 Ga0496121_0000169 Ga0496121_0000169_118494_119111 204
209 3300048924 Ga0496121_0002108 Ga0496121_0002108_16351_16968 204
210 3300048924 Ga0496121_0073244 Ga0496121_0073244_760_1377 204
211 3300048924 Ga0496121_0367222 Ga0496121_0367222_117_734 204
212 3300048929 Ga0496126_0008478 Ga0496126_0008478_2454_3071 204
213 3300048929 Ga0496126_0021075 Ga0496126_0021075_3928_4569 204
214 3300053090 Ga0500646_0019797 Ga0500646_0019797_712_1329 204
215 3300053129 Ga0500628_066969 Ga0500628_066969_245_859 204
216 iso_pu_bacteria 2547132374 2548500804 204
217 iso_pu_bacteria 2643221570 2643864229 204
218 iso_pu_bacteria 2643221596 2643992526 204
219 iso_pu_bacteria 2643221652 2644292074 204
220 iso_pu_bacteria 2643221717 2644646645 204
221 iso_pu_bacteria 2990710928 2990714833 204
222 3300002705 JGI25156J39149_1009299 JGI25156J39149_10092993 205
223 3300002705 JGI25156J39149_1016439 JGI25156J39149_10164392 205
224 3300002771 JGI25163J39215_1002977 JGI25163J39215_10029771 205
225 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001531 205
226 3300003323 rootH1_10078733 rootH1_100787333 205
227 3300003751 Ga0055538_1000001 Ga0055538_1000001503 205
228 3300003752 Ga0055539_1000001 Ga0055539_1000001503 205
229 3300003756 Ga0055533_1000003 Ga0055533_1000003531 205
230 3300003759 Ga0055525_1000003 Ga0055525_1000003531 205
231 3300003761 Ga0055535_1000097 Ga0055535_100009718 205
232 3300003763 Ga0055529_1000202 Ga0055529_100020268 205
233 3300003791 Ga0055530_10000764 Ga0055530_100007646 205
234 3300003791 Ga0055530_10001161 Ga0055530_100011619 205
235 3300003792 Ga0055540_1000357 Ga0055540_100035715 205
236 3300003794 Ga0055531_10016737 Ga0055531_100167373 205
237 3300003841 Ga0055541_1000001 Ga0055541_1000001531 205
238 3300005327 Ga0070658_10060818 Ga0070658_100608182 205
239 3300005327 Ga0070658_10428196 Ga0070658_104281962 205
240 3300005331 Ga0070670_100019957 Ga0070670_1000199574 205
241 3300005334 Ga0068869_100244373 Ga0068869_1002443732 205
242 3300005338 Ga0068868_100113107 Ga0068868_1001131073 205
243 3300005364 Ga0070673_100104622 Ga0070673_1001046224 205
244 3300005366 Ga0070659_100333978 Ga0070659_1003339782 205
245 3300005367 Ga0070667_100248445 Ga0070667_1002484452 205
246 3300005445 Ga0070708_100703490 Ga0070708_1007034901 205
247 3300005457 Ga0070662_100001459 Ga0070662_1000014598 205
248 3300005457 Ga0070662_100029344 Ga0070662_1000293442 205
249 3300005459 Ga0068867_100690295 Ga0068867_1006902951 205
250 3300005543 Ga0070672_100046459 Ga0070672_1000464593 205
251 3300005563 Ga0068855_100204845 Ga0068855_1002048453 205
252 3300005616 Ga0068852_100649096 Ga0068852_1006490963 205
253 3300005840 Ga0068870_10020325 Ga0068870_100203251 205
254 3300006195 Ga0075366_10015454 Ga0075366_100154543 205
255 3300006195 Ga0075366_10059182 Ga0075366_100591823 205
256 3300006195 Ga0075366_10130409 Ga0075366_101304093 205
257 3300006353 Ga0075370_10098264 Ga0075370_100982642 205
258 3300006881 Ga0068865_100013094 Ga0068865_1000130941 205
259 3300006946 Ga0079104_1000019 Ga0079104_1000019178 205
260 3300009093 Ga0105240_10087409 Ga0105240_100874095 205
261 3300009093 Ga0105240_10188392 Ga0105240_101883922 205
262 3300009098 Ga0105245_10020472 Ga0105245_100204724 205
263 3300009098 Ga0105245_10383253 Ga0105245_103832531 205
264 3300009148 Ga0105243_10038186 Ga0105243_100381864 205
265 3300009148 Ga0105243_10134017 Ga0105243_101340172 205
266 3300009148 Ga0105243_10163766 Ga0105243_101637663 205
267 3300009148 Ga0105243_10165374 Ga0105243_101653743 205
268 3300009148 Ga0105243_10890233 Ga0105243_108902331 205
269 3300009545 Ga0105237_10026812 Ga0105237_100268125 205
270 3300009545 Ga0105237_10028608 Ga0105237_100286084 205
271 3300009545 Ga0105237_10140032 Ga0105237_101400321 205
272 3300010375 Ga0105239_10006811 Ga0105239_1000681112 205
273 3300011119 Ga0105246_10174907 Ga0105246_101749072 205
274 3300012497 Ga0157319_1000002 Ga0157319_1000002342 205
275 3300013100 Ga0157373_10003612 Ga0157373_1000361211 205
276 3300013105 Ga0157369_10025778 Ga0157369_100257784 205
277 3300013307 Ga0157372_10006487 Ga0157372_1000648711 205
278 3300013308 Ga0157375_11232721 Ga0157375_112327212 205
279 3300014968 Ga0157379_10501267 Ga0157379_105012671 205
280 3300017792 Ga0163161_10302456 Ga0163161_103024562 205
281 3300021361 Ga0213872_10026966 Ga0213872_100269662 205
282 3300025224 Ga0209784_100004 Ga0209784_100004525 205
283 3300025225 Ga0209566_100004 Ga0209566_100004682 205
284 3300025226 Ga0209674_100006 Ga0209674_100006682 205
285 3300025228 Ga0209672_107976 Ga0209672_1079762 205
286 3300025230 Ga0209563_100009 Ga0209563_100009525 205
287 3300025233 Ga0209437_100004 Ga0209437_100004525 205
288 3300025242 Ga0209258_100162 Ga0209258_10016270 205
289 3300025253 Ga0209677_100005 Ga0209677_100005525 205
290 3300025253 Ga0209677_102833 Ga0209677_1028334 205
291 3300025256 Ga0209759_1000662 Ga0209759_100066210 205
292 3300025256 Ga0209759_1001643 Ga0209759_100164311 205
293 3300025261 Ga0209233_1000005 Ga0209233_1000005682 205
294 3300025261 Ga0209233_1006680 Ga0209233_10066802 205
295 3300025272 Ga0209455_1000128 Ga0209455_100012877 205
296 3300025273 Ga0209673_1036513 Ga0209673_10365131 205
297 3300025298 Ga0209050_1000703 Ga0209050_100070324 205
298 3300025298 Ga0209050_1012767 Ga0209050_10127672 205
299 3300025299 Ga0209256_1000024 Ga0209256_1000024152 205
300 3300025303 Ga0209051_1000063 Ga0209051_100006397 205
301 3300025303 Ga0209051_1002331 Ga0209051_100233115 205
302 3300025304 Ga0209257_1000118 Ga0209257_1000118110 205
303 3300025304 Ga0209257_1017132 Ga0209257_10171323 205
304 3300025907 Ga0207645_10005973 Ga0207645_100059733 205
305 3300025907 Ga0207645_10144391 Ga0207645_101443912 205
306 3300025909 Ga0207705_10067122 Ga0207705_100671224 205
307 3300025909 Ga0207705_10528996 Ga0207705_105289961 205
308 3300025913 Ga0207695_10109938 Ga0207695_101099383 205
309 3300025913 Ga0207695_10851117 Ga0207695_108511172 205
310 3300025920 Ga0207649_10002485 Ga0207649_100024859 205
311 3300025921 Ga0207652_10052348 Ga0207652_100523483 205
312 3300025931 Ga0207644_10320433 Ga0207644_103204332 205
313 3300025932 Ga0207690_10000359 Ga0207690_1000035910 205
314 3300025932 Ga0207690_10153884 Ga0207690_101538841 205
315 3300025933 Ga0207706_10237794 Ga0207706_102377942 205
316 3300025935 Ga0207709_10184489 Ga0207709_101844891 205
317 3300025935 Ga0207709_10264928 Ga0207709_102649282 205
318 3300025938 Ga0207704_10085078 Ga0207704_100850782 205
319 3300025942 Ga0207689_10014268 Ga0207689_100142684 205
320 3300025945 Ga0207679_10000220 Ga0207679_1000022033 205
321 3300025949 Ga0207667_10283917 Ga0207667_102839171 205
322 3300025949 Ga0207667_10365468 Ga0207667_103654682 205
323 3300025949 Ga0207667_10732850 Ga0207667_107328502 205
324 3300025960 Ga0207651_10041564 Ga0207651_100415643 205
325 3300025960 Ga0207651_10070670 Ga0207651_100706704 205
326 3300025981 Ga0207640_10447630 Ga0207640_104476302 205
327 3300025986 Ga0207658_10293960 Ga0207658_102939602 205
328 3300026023 Ga0207677_10059083 Ga0207677_100590831 205
329 3300026023 Ga0207677_10881646 Ga0207677_108816462 205
330 3300026089 Ga0207648_10003244 Ga0207648_1000324416 205
331 3300026089 Ga0207648_10066865 Ga0207648_100668652 205
332 3300026089 Ga0207648_10545945 Ga0207648_105459452 205
333 3300026142 Ga0207698_11355747 Ga0207698_113557471 205
334 3300027111 Ga0209281_1000149 Ga0209281_1000149116 205
335 3300028573 Ga0265334_10074335 Ga0265334_100743352 205
336 3300028666 Ga0265336_10000008 Ga0265336_10000008158 205
337 3300028794 Ga0307515_10075287 Ga0307515_100752875 205
338 3300028794 Ga0307515_10162385 Ga0307515_101623854 205
339 3300029957 Ga0265324_10003914 Ga0265324_100039147 205
340 3300031507 Ga0307509_10081638 Ga0307509_100816383 205
341 3300031507 Ga0307509_10123933 Ga0307509_101239334 205
342 3300031616 Ga0307508_10213039 Ga0307508_102130393 205
343 3300031730 Ga0307516_10000114 Ga0307516_1000011465 205
344 3300031730 Ga0307516_10000361 Ga0307516_1000036146 205
345 3300033180 Ga0307510_10088490 Ga0307510_100884903 205
346 3300037471 Ga0395905_0002983 Ga0395905_0002983_1047_1664 205
347 3300039447 Ga0436361_0304046 Ga0436361_0304046_9232_9861 205
348 3300039447 Ga0436361_0433542 Ga0436361_0433542_308_925 205
349 3300039447 Ga0436361_1122650 Ga0436361_1122650_759_1376 205
350 3300041443 Ga0451789_0419046 Ga0451789_0419046_143_775 205
351 3300041453 Ga0451797_0601666 Ga0451797_0601666_434_1054 205
352 3300041486 Ga0451807_2008794 Ga0451807_2008794_348_965 205
353 3300041511 Ga0451855_0476580 Ga0451855_0476580_170_799 205
354 3300041512 Ga0451853_0712802 Ga0451853_0712802_1126_1758 205
355 3300042121 Ga0450919_002427 Ga0450919_002427_1738_2355 205
356 3300042122 Ga0450920_002499 Ga0450920_002499_1749_2366 205
357 3300042157 Ga0439458_0050383 Ga0439458_0050383_362_979 205
358 3300042531 Ga0450918_000003 Ga0450918_000003_7233_7850 205
359 3300044656 Ga0466969_0001367 Ga0466969_0001367_1292_1909 205
360 3300044683 Ga0466965_0016159 Ga0466965_0016159_2030_2647 205
361 3300044693 Ga0466961_0000358 Ga0466961_0000358_21345_21962 205
362 3300045049 Ga0466959_0272722 Ga0466959_0272722_470_1087 205
363 3300046460 Ga0495638_0096111 Ga0495638_0096111_246_902 205
364 3300046475 Ga0495639_0038401 Ga0495639_0038401_1345_1962 205
365 3300046528 Ga0495642_0143559 Ga0495642_0143559_346_963 205
366 3300046529 Ga0495652_0288269 Ga0495652_0288269_495_1112 205
367 3300046542 Ga0495597_0004546 Ga0495597_0004546_6665_7282 205
368 3300046648 Ga0495611_0080171 Ga0495611_0080171_368_985 205
369 3300046660 Ga0495625_0010840 Ga0495625_0010840_6161_6778 205
370 3300047443 Ga0495687_000259 Ga0495687_000259_62667_63284 205
371 3300047472 Ga0495686_0003932 Ga0495686_0003932_11098_11715 205
372 3300048091 Ga0495626_0034293 Ga0495626_0034293_861_1478 205
373 3300048091 Ga0495626_0056677 Ga0495626_0056677_1098_1715 205
374 3300048915 Ga0496112_0011547 Ga0496112_0011547_6988_7605 205
375 3300048928 Ga0496125_0176131 Ga0496125_0176131_574_1191 205
376 3300049128 Ga0501308_001501 Ga0501308_001501_1102_1719 205
377 3300049130 Ga0501310_007891 Ga0501310_007891_21_638 205
378 3300049519 Ga0501296_002571 Ga0501296_002571_224_841 205
379 3300049520 Ga0501297_013438 Ga0501297_013438_139_756 205
380 3300049523 Ga0501300_005790 Ga0501300_005790_448_1065 205
381 3300049587 Ga0501071_0291594 Ga0501071_0291594_128_751 205
382 3300049651 Ga0501201_001004 Ga0501201_001004_1640_2257 205
383 3300049662 Ga0501222_004389 Ga0501222_004389_956_1573 205
384 3300049668 Ga0501233_004320 Ga0501233_004320_1459_2076 205
385 3300049674 Ga0501242_015669 Ga0501242_015669_17_634 205
386 3300049679 Ga0501249_009741 Ga0501249_009741_788_1405 205
387 3300049704 Ga0501221_001282 Ga0501221_001282_628_1245 205
388 3300049706 Ga0501229_005760 Ga0501229_005760_385_1002 205
389 3300049769 Ga0501272_001778 Ga0501272_001778_1340_1957 205
390 3300049771 Ga0501274_003883 Ga0501274_003883_236_853 205
391 3300050489 nmdc:mga03683_2478_c1 nmdc:mga03683_2478_c1_3723_4340 205
392 3300050489 nmdc:mga03683_75684_c1 nmdc:mga03683_75684_c1_361_1038 205
393 3300050490 nmdc:mga03n38_230411_c1 nmdc:mga03n38_230411_c1_216_833 205
394 3300050491 nmdc:mga00v17_209918_c1 nmdc:mga00v17_209918_c1_493_1110 205
395 3300050491 nmdc:mga00v17_48921_c1 nmdc:mga00v17_48921_c1_446_1063 205
396 3300050492 nmdc:mga0yw44_11630_c1 nmdc:mga0yw44_11630_c1_965_1582 205
397 3300050493 nmdc:mga0k408_12157_c1 nmdc:mga0k408_12157_c1_2225_2842 205
398 3300050493 nmdc:mga0k408_44012_c1 nmdc:mga0k408_44012_c1_1495_2112 205
399 3300050493 nmdc:mga0k408_53202_c1 nmdc:mga0k408_53202_c1_788_1465 205
400 3300050493 nmdc:mga0k408_65992_c1 nmdc:mga0k408_65992_c1_1145_1762 205
401 3300050494 nmdc:mga06z11_12478_c1 nmdc:mga06z11_12478_c1_1416_2033 205
402 3300050494 nmdc:mga06z11_169643_c1 nmdc:mga06z11_169643_c1_521_1138 205
403 3300050495 nmdc:mga04h51_4999_c1 nmdc:mga04h51_4999_c1_1279_1896 205
404 3300050496 nmdc:mga07m45_1177_c1 nmdc:mga07m45_1177_c1_6352_6969 205
405 3300050496 nmdc:mga07m45_24612_c1 nmdc:mga07m45_24612_c1_2492_3109 205
406 3300050496 nmdc:mga07m45_24747_c1 nmdc:mga07m45_24747_c1_1655_2272 205
407 3300050496 nmdc:mga07m45_35628_c1 nmdc:mga07m45_35628_c1_779_1456 205
408 3300050496 nmdc:mga07m45_67822_c1 nmdc:mga07m45_67822_c1_944_1561 205
409 3300050516 nmdc:mga0sz30_3643_c1 nmdc:mga0sz30_3643_c1_1943_2560 205
410 3300053134 Ga0500658_0056849 Ga0500658_0056849_812_1429 205
411 3300053136 Ga0500559_0015943 Ga0500559_0015943_211_828 205
412 3300053139 Ga0500568_0005699 Ga0500568_0005699_3307_3924 205
413 3300053156 Ga0500622_0004094 Ga0500622_0004094_50_667 205
414 3300059424 Ga0590075_093321 Ga0590075_093321_62_691 205
415 iso_pu_bacteria 2643221609 2644057869 205
416 iso_pu_bacteria 2643221611 2644072905 205
417 iso_pu_bacteria 2738543012 2739242141 205
418 iso_pu_bacteria 2816332133 2816470242 205
419 3300005548 Ga0070665_100001343 Ga0070665_10000134311 206
420 3300006358 Ga0068871_100545966 Ga0068871_1005459662 206
421 3300014969 Ga0157376_10396388 Ga0157376_103963882 206
422 3300028379 Ga0268266_10023539 Ga0268266_100235394 206
423 3300042876 Ga0451577_0574701 Ga0451577_0574701_357_983 206
424 3300044658 Ga0466972_0000519 Ga0466972_0000519_8297_8929 206
425 3300044673 Ga0453683_0141611 Ga0453683_0141611_270_890 206
426 3300044683 Ga0466965_0045870 Ga0466965_0045870_920_1552 206
427 3300046506 Ga0495583_0000444 Ga0495583_0000444_20522_21142 206
428 3300046507 Ga0495606_0002487 Ga0495606_0002487_6014_6634 206
429 3300046616 Ga0495668_0183596 Ga0495668_0183596_407_1027 206
430 3300046694 Ga0495649_0000298 Ga0495649_0000298_22247_22867 206
431 3300046794 Ga0495589_0087591 Ga0495589_0087591_178_798 206
432 3300049573 Ga0501037_0010746 Ga0501037_0010746_516_1136 206
433 3300053138 Ga0500564_126533 Ga0500564_126533_325_945 206
434 3300053177 Ga0500636_0107404 Ga0500636_0107404_932_1552 206
435 3300005289 Ga0065704_10449773 Ga0065704_104497731 207
436 3300005335 Ga0070666_10129752 Ga0070666_101297523 207
437 3300005536 Ga0070697_100607481 Ga0070697_1006074812 207
438 3300005841 Ga0068863_100474568 Ga0068863_1004745682 207
439 3300009036 Ga0105244_10111065 Ga0105244_101110652 207
440 3300009176 Ga0105242_10000868 Ga0105242_1000086813 207
441 3300009176 Ga0105242_10190911 Ga0105242_101909112 207
442 3300011119 Ga0105246_10988172 Ga0105246_109881721 207
443 3300013297 Ga0157378_10021317 Ga0157378_100213175 207
444 3300025250 Ga0209026_1009984 Ga0209026_10099841 207
445 3300025256 Ga0209759_1005424 Ga0209759_10054244 207
446 3300025728 Ga0207655_1100610 Ga0207655_11006102 207
447 3300025910 Ga0207684_10484286 Ga0207684_104842862 207
448 3300025934 Ga0207686_10001655 Ga0207686_100016552 207
449 3300026088 Ga0207641_10450216 Ga0207641_104502161 207
450 3300027876 Ga0209974_10014134 Ga0209974_100141342 207
451 3300031911 Ga0307412_10234665 Ga0307412_102346651 207
452 3300036401 Ga0373937_0094584 Ga0373937_0094584_540_1163 207
453 3300037471 Ga0395905_0004666 Ga0395905_0004666_503_1126 207
454 3300044656 Ga0466969_0006082 Ga0466969_0006082_5249_5872 207
455 3300044684 Ga0466966_0011080 Ga0466966_0011080_1220_1843 207
456 3300044693 Ga0466961_0118577 Ga0466961_0118577_1021_1644 207
457 3300044706 Ga0466964_0003754 Ga0466964_0003754_3904_4527 207
458 3300044719 Ga0466971_0355333 Ga0466971_0355333_43_666 207
459 3300044735 Ga0466968_0275560 Ga0466968_0275560_41_664 207
460 3300044842 Ga0466957_0037013 Ga0466957_0037013_644_1267 207
461 3300044842 Ga0466957_0100369 Ga0466957_0100369_805_1428 207
462 3300045049 Ga0466959_0096895 Ga0466959_0096895_1122_1745 207
463 3300045836 Ga0466958_0566166 Ga0466958_0566166_62_685 207
464 3300045976 Ga0466967_0113340 Ga0466967_0113340_1066_1689 207
465 3300049588 Ga0501072_0203536 Ga0501072_0203536_232_864 207
466 3300049591 Ga0501075_0559771 Ga0501075_0559771_182_814 207
467 3300050496 nmdc:mga07m45_11889_c1 nmdc:mga07m45_11889_c1_470_1093 207
468 3300060353 Ga0501082_0157552 Ga0501082_0157552_675_1307 207
469 3300061719 Ga0466962_0034671 Ga0466962_0034671_129_752 207
470 3300005353 Ga0070669_100023434 Ga0070669_1000234344 208
471 3300005356 Ga0070674_100054606 Ga0070674_1000546063 208
472 3300005367 Ga0070667_100028205 Ga0070667_1000282054 208
473 3300005444 Ga0070694_100011360 Ga0070694_1000113602 208
474 3300005459 Ga0068867_100007205 Ga0068867_10000720510 208
475 3300005539 Ga0068853_100815855 Ga0068853_1008158551 208
476 3300005543 Ga0070672_100275709 Ga0070672_1002757092 208
477 3300005545 Ga0070695_100014906 Ga0070695_1000149062 208
478 3300005563 Ga0068855_100130777 Ga0068855_1001307774 208
479 3300005614 Ga0068856_100037225 Ga0068856_1000372252 208
480 3300005616 Ga0068852_100772266 Ga0068852_1007722662 208
481 3300005618 Ga0068864_100102994 Ga0068864_1001029944 208
482 3300005718 Ga0068866_10116826 Ga0068866_101168262 208
483 3300005719 Ga0068861_100005361 Ga0068861_1000053617 208
484 3300005841 Ga0068863_100004114 Ga0068863_1000041149 208
485 3300005842 Ga0068858_100097882 Ga0068858_1000978823 208
486 3300005842 Ga0068858_100386115 Ga0068858_1003861152 208
487 3300005843 Ga0068860_100001386 Ga0068860_1000013867 208
488 3300005843 Ga0068860_100047929 Ga0068860_1000479295 208
489 3300005937 Ga0081455_10119463 Ga0081455_101194632 208
490 3300006881 Ga0068865_100004561 Ga0068865_10000456110 208
491 3300009093 Ga0105240_10122896 Ga0105240_101228962 208
492 3300009093 Ga0105240_10181221 Ga0105240_101812213 208
493 3300009147 Ga0114129_10004078 Ga0114129_1000407815 208
494 3300009148 Ga0105243_10035142 Ga0105243_100351422 208
495 3300009174 Ga0105241_10007758 Ga0105241_1000775815 208
496 3300009174 Ga0105241_10115366 Ga0105241_101153662 208
497 3300009174 Ga0105241_10148456 Ga0105241_101484562 208
498 3300009545 Ga0105237_10010756 Ga0105237_1001075615 208
499 3300009545 Ga0105237_10157977 Ga0105237_101579772 208
500 3300009551 Ga0105238_10006478 Ga0105238_100064784 208
501 3300009551 Ga0105238_10007601 Ga0105238_100076015 208
502 3300009551 Ga0105238_10139564 Ga0105238_101395642 208
503 3300009553 Ga0105249_10150677 Ga0105249_101506771 208
504 3300009553 Ga0105249_10335296 Ga0105249_103352962 208
505 3300010375 Ga0105239_10007170 Ga0105239_1000717018 208
506 3300010375 Ga0105239_10044898 Ga0105239_100448982 208
507 3300013105 Ga0157369_10316790 Ga0157369_103167902 208
508 3300013297 Ga0157378_10004305 Ga0157378_100043053 208
509 3300013306 Ga0163162_10004215 Ga0163162_100042159 208
510 3300013306 Ga0163162_10041433 Ga0163162_100414332 208
511 3300013308 Ga0157375_10102471 Ga0157375_101024714 208
512 3300014325 Ga0163163_10208556 Ga0163163_102085563 208
513 3300014968 Ga0157379_10098367 Ga0157379_100983673 208
514 3300017792 Ga0163161_10274457 Ga0163161_102744572 208
515 3300025899 Ga0207642_10065352 Ga0207642_100653522 208
516 3300025903 Ga0207680_10008080 Ga0207680_100080803 208
517 3300025907 Ga0207645_10052192 Ga0207645_100521922 208
518 3300025911 Ga0207654_10043012 Ga0207654_100430123 208
519 3300025913 Ga0207695_10113680 Ga0207695_101136802 208
520 3300025914 Ga0207671_10031954 Ga0207671_100319546 208
521 3300025914 Ga0207671_10041737 Ga0207671_100417373 208
522 3300025920 Ga0207649_10132241 Ga0207649_101322412 208
523 3300025920 Ga0207649_10478867 Ga0207649_104788671 208
524 3300025923 Ga0207681_10028578 Ga0207681_100285784 208
525 3300025924 Ga0207694_10356850 Ga0207694_103568501 208
526 3300025961 Ga0207712_10288624 Ga0207712_102886242 208
527 3300025972 Ga0207668_10865161 Ga0207668_108651611 208
528 3300025986 Ga0207658_10065783 Ga0207658_100657832 208
529 3300026035 Ga0207703_10082199 Ga0207703_100821994 208
530 3300026035 Ga0207703_11017509 Ga0207703_110175091 208
531 3300026041 Ga0207639_10412274 Ga0207639_104122742 208
532 3300026067 Ga0207678_10023119 Ga0207678_100231195 208
533 3300026078 Ga0207702_10196453 Ga0207702_101964532 208
534 3300026088 Ga0207641_10002934 Ga0207641_1000293418 208
535 3300026088 Ga0207641_10217289 Ga0207641_102172892 208
536 3300026089 Ga0207648_10001237 Ga0207648_100012372 208
537 3300026118 Ga0207675_100001346 Ga0207675_10000134618 208
538 3300026121 Ga0207683_10281086 Ga0207683_102810861 208
539 3300027471 Ga0209995_1024043 Ga0209995_10240432 208
540 3300027665 Ga0209983_1009900 Ga0209983_10099002 208
541 3300027682 Ga0209971_1000923 Ga0209971_10009235 208
542 3300027876 Ga0209974_10008910 Ga0209974_100089105 208
543 3300028380 Ga0268265_10018728 Ga0268265_100187286 208
544 3300028380 Ga0268265_10477202 Ga0268265_104772022 208
545 3300028381 Ga0268264_10323489 Ga0268264_103234892 208
546 3300028573 Ga0265334_10084620 Ga0265334_100846202 208
547 3300028577 Ga0265318_10085693 Ga0265318_100856932 208
548 3300028794 Ga0307515_10326248 Ga0307515_103262482 208
549 3300031235 Ga0265330_10000368 Ga0265330_100003684 208
550 3300031238 Ga0265332_10000394 Ga0265332_1000039421 208
551 3300031240 Ga0265320_10035790 Ga0265320_100357901 208
552 3300031241 Ga0265325_10011672 Ga0265325_100116724 208
553 3300031241 Ga0265325_10060517 Ga0265325_100605172 208
554 3300031247 Ga0265340_10034341 Ga0265340_100343412 208
555 3300031250 Ga0265331_10023713 Ga0265331_100237133 208
556 3300031548 Ga0307408_100000136 Ga0307408_10000013626 208
557 3300031548 Ga0307408_100058895 Ga0307408_1000588952 208
558 3300031665 Ga0316575_10047969 Ga0316575_100479693 208
559 3300031711 Ga0265314_10000292 Ga0265314_1000029221 208
560 3300031901 Ga0307406_10000105 Ga0307406_100001057 208
561 3300033180 Ga0307510_10000018 Ga0307510_1000001830 208
562 3300035116 Ga0373945_0188362 Ga0373945_0188362_124_750 208
563 3300035695 Ga0373927_0024670 Ga0373927_0024670_3070_3696 208
564 3300035695 Ga0373927_0300818 Ga0373927_0300818_164_805 208
565 3300037068 Ga0373925_0001876 Ga0373925_0001876_1943_2569 208
566 3300041456 Ga0451795_0964762 Ga0451795_0964762_94_726 208
567 3300042876 Ga0451577_0023595 Ga0451577_0023595_3462_4088 208
568 3300042876 Ga0451577_0152498 Ga0451577_0152498_740_1366 208
569 3300044712 Ga0453684_0000823 Ga0453684_0000823_67506_68132 208
570 3300044712 Ga0453684_0200643 Ga0453684_0200643_1644_2270 208
571 3300045051 Ga0451576_0239549 Ga0451576_0239549_991_1617 208
572 3300045051 Ga0451576_0936342 Ga0451576_0936342_188_814 208
573 3300046471 Ga0495650_0013148 Ga0495650_0013148_3553_4179 208
574 3300046506 Ga0495583_0202862 Ga0495583_0202862_124_756 208
575 3300046681 Ga0495647_0145203 Ga0495647_0145203_15_641 208
576 3300048906 Ga0496103_0093533 Ga0496103_0093533_809_1474 208
577 3300048919 Ga0496116_0035675 Ga0496116_0035675_1686_2351 208
578 3300048920 Ga0496117_0000067 Ga0496117_0000067_140183_140848 208
579 3300048921 Ga0496118_0000021 Ga0496118_0000021_190905_191570 208
580 3300048922 Ga0496119_0012940 Ga0496119_0012940_6059_6688 208
581 3300048923 Ga0496120_0000042 Ga0496120_0000042_177367_178029 208
582 3300048923 Ga0496120_0047130 Ga0496120_0047130_1121_1786 208
583 3300048923 Ga0496120_0057999 Ga0496120_0057999_1331_1996 208
584 3300048927 Ga0496124_0061127 Ga0496124_0061127_571_1236 208
585 3300048928 Ga0496125_0043123 Ga0496125_0043123_863_1528 208
586 3300049578 Ga0501042_0720115 Ga0501042_0720115_78_707 208
587 3300049581 Ga0501047_0357861 Ga0501047_0357861_376_1002 208
588 3300049763 Ga0501266_000425 Ga0501266_000425_1517_2143 208
589 3300050507 nmdc:mga05p37_8138_c1 nmdc:mga05p37_8138_c1_8401_9033 208
590 3300053087 Ga0500643_085364 Ga0500643_085364_114_740 208
591 3300053139 Ga0500568_0016467 Ga0500568_0016467_1470_2096 208
592 3300053153 Ga0500616_0089221 Ga0500616_0089221_280_906 208
593 3300053156 Ga0500622_0005022 Ga0500622_0005022_1329_1955 208
594 3300053729 Ga0500625_011277 Ga0500625_011277_2539_3165 208
595 3300002705 JGI25156J39149_1000419 JGI25156J39149_100041924 209
596 3300002741 JGI25157J39369_1000174 JGI25157J39369_10001748 209
597 3300002772 JGI25164J39214_1012596 JGI25164J39214_10125961 209
598 3300003320 rootH2_10034065 rootH2_100340653 209
599 3300003752 Ga0055539_1000365 Ga0055539_100036517 209
600 3300003752 Ga0055539_1001538 Ga0055539_10015385 209
601 3300003756 Ga0055533_1000011 Ga0055533_1000011247 209
602 3300003759 Ga0055525_1000989 Ga0055525_100098910 209
603 3300005329 Ga0070683_100331849 Ga0070683_1003318491 209
604 3300005330 Ga0070690_100021105 Ga0070690_1000211054 209
605 3300005334 Ga0068869_100006181 Ga0068869_1000061817 209
606 3300005339 Ga0070660_100197829 Ga0070660_1001978291 209
607 3300005366 Ga0070659_100447996 Ga0070659_1004479961 209
608 3300005441 Ga0070700_100888108 Ga0070700_1008881081 209
609 3300005457 Ga0070662_100570032 Ga0070662_1005700322 209
610 3300005539 Ga0068853_100904758 Ga0068853_1009047581 209
611 3300005563 Ga0068855_100000971 Ga0068855_10000097111 209
612 3300005563 Ga0068855_100560002 Ga0068855_1005600022 209
613 3300005577 Ga0068857_100001909 Ga0068857_10000190913 209
614 3300005614 Ga0068856_100000951 Ga0068856_1000009518 209
615 3300005616 Ga0068852_100284628 Ga0068852_1002846281 209
616 3300005617 Ga0068859_100076958 Ga0068859_1000769585 209
617 3300005617 Ga0068859_100597680 Ga0068859_1005976802 209
618 3300005719 Ga0068861_100178854 Ga0068861_1001788543 209
619 3300005844 Ga0068862_100085310 Ga0068862_1000853102 209
620 3300006195 Ga0075366_10166527 Ga0075366_101665271 209
621 3300006237 Ga0097621_100542356 Ga0097621_1005423562 209
622 3300006844 Ga0075428_101101231 Ga0075428_1011012311 209
623 3300006847 Ga0075431_100013608 Ga0075431_1000136089 209
624 3300006847 Ga0075431_100101045 Ga0075431_1001010452 209
625 3300006847 Ga0075431_100608669 Ga0075431_1006086692 209
626 3300006880 Ga0075429_100482086 Ga0075429_1004820861 209
627 3300006914 Ga0075436_100036963 Ga0075436_1000369632 209
628 3300006931 Ga0097620_100076957 Ga0097620_1000769575 209
629 3300006931 Ga0097620_100597691 Ga0097620_1005976912 209
630 3300009098 Ga0105245_10080032 Ga0105245_100800322 209
631 3300009098 Ga0105245_10305379 Ga0105245_103053792 209
632 3300009147 Ga0114129_10080685 Ga0114129_100806852 209
633 3300009147 Ga0114129_10894858 Ga0114129_108948581 209
634 3300009176 Ga0105242_10035264 Ga0105242_100352644 209
635 3300009176 Ga0105242_10156513 Ga0105242_101565132 209
636 3300009545 Ga0105237_10716269 Ga0105237_107162691 209
637 3300009551 Ga0105238_10031258 Ga0105238_100312585 209
638 3300010375 Ga0105239_10196071 Ga0105239_101960714 209
639 3300013105 Ga0157369_10060633 Ga0157369_100606335 209
640 3300014969 Ga0157376_10267125 Ga0157376_102671251 209
641 3300025226 Ga0209674_100003 Ga0209674_100003546 209
642 3300025230 Ga0209563_100010 Ga0209563_100010276 209
643 3300025231 Ga0207427_100307 Ga0207427_10030735 209
644 3300025242 Ga0209258_101918 Ga0209258_1019185 209
645 3300025246 Ga0209646_1000066 Ga0209646_1000066162 209
646 3300025250 Ga0209026_1000027 Ga0209026_1000027167 209
647 3300025253 Ga0209677_100178 Ga0209677_10017815 209
648 3300025253 Ga0209677_100183 Ga0209677_10018318 209
649 3300025256 Ga0209759_1000131 Ga0209759_100013113 209
650 3300025295 Ga0209564_1002533 Ga0209564_10025332 209
651 3300025911 Ga0207654_10111096 Ga0207654_101110963 209
652 3300025919 Ga0207657_10239272 Ga0207657_102392721 209
653 3300025924 Ga0207694_10027167 Ga0207694_100271674 209
654 3300025933 Ga0207706_10203108 Ga0207706_102031081 209
655 3300025934 Ga0207686_10063305 Ga0207686_100633053 209
656 3300025942 Ga0207689_10094740 Ga0207689_100947403 209
657 3300025944 Ga0207661_10403508 Ga0207661_104035082 209
658 3300025949 Ga0207667_10002057 Ga0207667_1000205713 209
659 3300025949 Ga0207667_10164768 Ga0207667_101647683 209
660 3300025981 Ga0207640_10164555 Ga0207640_101645551 209
661 3300026041 Ga0207639_10133013 Ga0207639_101330133 209
662 3300026075 Ga0207708_10798104 Ga0207708_107981041 209
663 3300026078 Ga0207702_10000220 Ga0207702_1000022031 209
664 3300026089 Ga0207648_10576125 Ga0207648_105761252 209
665 3300026116 Ga0207674_10011271 Ga0207674_100112712 209
666 3300026118 Ga0207675_100347874 Ga0207675_1003478742 209
667 3300026118 Ga0207675_100683657 Ga0207675_1006836572 209
668 3300026142 Ga0207698_10511565 Ga0207698_105115651 209
669 3300028380 Ga0268265_10728971 Ga0268265_107289712 209
670 3300034820 Ga0373959_0066074 Ga0373959_0066074_66_695 209
671 3300037466 Ga0395898_0039705 Ga0395898_0039705_2702_3331 209
672 3300037471 Ga0395905_0156328 Ga0395905_0156328_530_1159 209
673 3300038443 Ga0395901_0016167 Ga0395901_0016167_2333_2962 209
674 3300041452 Ga0451793_0385518 Ga0451793_0385518_32_664 209
675 3300042435 Ga0439434_0049587 Ga0439434_0049587_360_1004 209
676 3300042438 Ga0439459_0006559 Ga0439459_0006559_377_1012 209
677 3300044712 Ga0453684_0340128 Ga0453684_0340128_1014_1658 209
678 3300046460 Ga0495638_0000007 Ga0495638_0000007_568897_569529 209
679 3300046472 Ga0495580_0000077 Ga0495580_0000077_5139_5876 209
680 3300046491 Ga0495584_0033651 Ga0495584_0033651_1766_2503 209
681 3300046507 Ga0495606_0203732 Ga0495606_0203732_217_846 209
682 3300046513 Ga0495616_0033452 Ga0495616_0033452_980_1609 209
683 3300046531 Ga0495665_0070843 Ga0495665_0070843_87_824 209
684 3300046535 Ga0495586_0359238 Ga0495586_0359238_57_794 209
685 3300047319 Ga0495674_0026722 Ga0495674_0026722_1548_2285 209
686 3300047320 Ga0495672_0034691 Ga0495672_0034691_900_1637 209
687 3300048907 Ga0496104_0073344 Ga0496104_0073344_1107_1844 209
688 3300048909 Ga0496106_0222647 Ga0496106_0222647_252_989 209
689 3300048915 Ga0496112_0017817 Ga0496112_0017817_5338_5967 209
690 3300048916 Ga0496113_0083113 Ga0496113_0083113_1481_2218 209
691 3300048924 Ga0496121_0039264 Ga0496121_0039264_781_1518 209
692 3300049459 Ga0495678_015483 Ga0495678_015483_474_1211 209
693 3300049460 Ga0495682_0017496 Ga0495682_0017496_836_1573 209
694 3300049576 Ga0501040_0375309 Ga0501040_0375309_58_735 209
695 3300050507 nmdc:mga05p37_234617_c1 nmdc:mga05p37_234617_c1_651_1289 209
696 3300050507 nmdc:mga05p37_25817_c1 nmdc:mga05p37_25817_c1_5225_5869 209
697 3300050509 nmdc:mga0qj67_82513_c1 nmdc:mga0qj67_82513_c1_977_1621 209
698 3300050510 nmdc:mga06r32_408345_c1 nmdc:mga06r32_408345_c1_12_656 209
699 3300050514 nmdc:mga08x19_15033_c1 nmdc:mga08x19_15033_c1_1529_2167 209
700 3300053086 Ga0500578_0000025 Ga0500578_0000025_119119_119748 209
701 3300053108 Ga0500562_016708 Ga0500562_016708_704_1333 209
702 3300053151 Ga0500604_0007009 Ga0500604_0007009_1432_2061 209
703 iso_pu_bacteria 2791355137 2792835397 209
704 iso_pu_bacteria 2904615490 2904620077 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

14

191

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7962 11 209
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.7449 20 203
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.705 20 200
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.7005 20 200
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.6632 12 201
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9521 6 206 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9241 11 196 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9123 6 206 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9007 11 196 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8411 19 209 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7H9BH28-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9582 4 209 GO:0008654
GO:0016020
GO:0016780
AF-A0A0P0RLU5-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9578 6 208 GO:0003882
GO:0008444
GO:0008654
GO:0016020
AF-A0A1K2H3J2-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9561 4 209 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-Q5H0P8-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9561 5 209 GO:0008654
GO:0016020
GO:0016780
AF-U9TLP1-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9559 6 209 GO:0008654
GO:0012505
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
82.86 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map