F476344

General Info

Members Datasets Scaffolds Average Seq Length
704 441 1408 383

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10058785|Ga0075362_100587852
Length 430
Sequence VGRASMRRASKVAEIRGGFCVKGLAMPQAPRGHPPRTDDISHPSPKEPQMALDPDTFNLLRDTVTRFVNERLISREDEVSETNTIPADVVEEMQSLGLFGLSIPEEFGGLXLSMEEEARIVFELGRASPAFRSVAGTNIGIGSQSIVIAGTDQQKAKYLPRLASGELIGSFALTEPDTGSDAMSIRATARKMGDHYVLNGTKRYITNAPSAGLFTVMARTAQERKADSISCFLVPADTPGITVGKPDKKMGQRGALTSDVIFEDCKVPTSALLGETEGNGFRTSMKVLDKGRLHIAALCVGIADRLIDEAVKYARERKQFGQPIGQFQLVQAMLADSEAEAYAAKCMVIDASRRRDRGEIPTRQAACAKMFASEMVGRVADRAVQIFGGAGYMSEYPVERFYRDVRLFRIFEGTTQIQQLVIARDLLKAV

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
198 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
228 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
339 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
340 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
341 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
359 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
364 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
365 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
366 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
369 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
374 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
375 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
376 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
377 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
378 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
379 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
380 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
381 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
382 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
383 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
384 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
385 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
386 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
389 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
390 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
391 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
394 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 2508501039 Frankia saprophytica CN3 Isolate Nodule
398 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
399 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
400 2534681786 Brucella suis 92/29 Isolate Unclassified
401 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
402 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
403 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
404 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
405 2643221569 Achromobacter sp. Root565 Isolate Unclassified
406 2643221594 Achromobacter sp. Root170 Isolate Unclassified
407 2643221621 Achromobacter sp. Root83 Isolate Unclassified
408 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
409 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
410 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
411 2751185800 Brucella pituitosa AA2 Isolate Unclassified
412 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
413 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
414 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
415 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
416 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
417 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
418 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
419 2855730933 Achromobacter sp. HZ28 Isolate Nodule
420 2855767633 Achromobacter sp. HZ34 Isolate Nodule
421 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
422 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
423 2858950400 Achromobacter sp. K91 Isolate Unclassified
424 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
425 2885266251 Ralstonia sp. SET104 Isolate Nodule
426 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
427 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
428 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
429 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
430 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
431 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
432 2928058823 Ralstonia sp. 1138 Isolate Unclassified
433 2941479691
434 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
435 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
436 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
437 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
438 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
439 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
440 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
441 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.9
Metatranscriptomes 0.71
Isolates 6.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.03
Nodule 2.27
Rhizoplane 4.12
Rhizosphere 61.93
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10058785 3300006177 Bacteria 1735
2 JGI24741J21665_1000448 3300001915 Bacteria 12506
3 JGI24740J21852_10000149 3300001979 Bacteria 27167
4 JGI24740J21852_10000159 3300001979 Bacteria 26704
5 JGI25156J39149_1007314 3300002705 Bacteria 2916
6 JGI25154J39366_1001599 3300002738 Bacteria 7719
7 JGI25151J46595_10000228 3300003187 Bacteria 66484
8 JGI25151J46595_10001462 3300003187 Bacteria 16012
9 Ga0055539_1000086 3300003752 Bacteria 117621
10 Ga0055533_1001557 3300003756 Bacteria 5972
11 Ga0055532_1000041 3300003758 Bacteria 195749
12 Ga0055535_1000030 3300003761 Bacteria 195749
13 Ga0055542_1000818 3300003762 Bacteria 22571
14 Ga0055529_1000058 3300003763 Bacteria 195735
15 Ga0055526_1011710 3300003771 Bacteria 3915
16 Ga0055524_1001952 3300003775 Bacteria 11083
17 Ga0055536_1000114 3300003781 Bacteria 70007
18 Ga0055534_1003641 3300003784 Bacteria 4775
19 Ga0055530_10000579 3300003791 Bacteria 31675
20 Ga0055541_1001902 3300003841 Bacteria 4332
21 Ga0065704_10009005 3300005289 Bacteria 2001
22 Ga0065704_10079565 3300005289 Bacteria 4130
23 Ga0070658_10004072 3300005327 Bacteria 11984
24 Ga0070658_10132353 3300005327 Bacteria 2079
25 Ga0070683_100002003 3300005329 Bacteria 15985
26 Ga0070683_100164059 3300005329 Bacteria 2108
27 Ga0070670_100000981 3300005331 Bacteria 22370
28 Ga0070670_100026142 3300005331 Bacteria 5025
29 Ga0070670_100126234 3300005331 Bacteria 2208
30 Ga0070677_10000559 3300005333 Bacteria 12697
31 Ga0070666_10191773 3300005335 Bacteria 1436
32 Ga0070680_100000727 3300005336 Bacteria 22930
33 Ga0068868_100000036 3300005338 Bacteria 74490
34 Ga0070660_100000347 3300005339 Bacteria 30909
35 Ga0070661_100000001 3300005344 Bacteria 424830
36 Ga0070661_100000072 3300005344 Bacteria 82584
37 Ga0070692_10000276 3300005345 Bacteria 14447
38 Ga0070668_100000013 3300005347 Bacteria 117451
39 Ga0070668_100002822 3300005347 Bacteria 12787
40 Ga0070669_100006287 3300005353 Bacteria 8563
41 Ga0070669_100019626 3300005353 Bacteria 4828
42 Ga0070669_100106120 3300005353 Bacteria 2126
43 Ga0070675_100028436 3300005354 Bacteria 4500
44 Ga0070671_100000225 3300005355 Bacteria 37597
45 Ga0070671_100038951 3300005355 Bacteria 3945
46 Ga0070674_100061329 3300005356 Bacteria 2624
47 Ga0070673_100046037 3300005364 Bacteria 3386
48 Ga0070659_100000034 3300005366 Bacteria 115416
49 Ga0070667_100000328 3300005367 Bacteria 52935
50 Ga0070667_100000413 3300005367 Bacteria 45721
51 Ga0070667_100000889 3300005367 Bacteria 27637
52 Ga0070714_100001638 3300005435 Bacteria 16290
53 Ga0070714_100109168 3300005435 Bacteria 2447
54 Ga0070714_100131545 3300005435 Bacteria 2237
55 Ga0070713_100003580 3300005436 Bacteria 10265
56 Ga0070713_100093464 3300005436 Bacteria 2591
57 Ga0070663_100000015 3300005455 Bacteria 131905
58 Ga0070678_100227437 3300005456 Bacteria 1553
59 Ga0070678_100258433 3300005456 Bacteria 1463
60 Ga0070681_10014042 3300005458 Bacteria 7971
61 Ga0070685_10000593 3300005466 Bacteria 20043
62 Ga0070706_100001450 3300005467 Bacteria 24950
63 Ga0070706_100168273 3300005467 Bacteria 2046
64 Ga0070707_100021081 3300005468 Bacteria 6155
65 Ga0070698_100139653 3300005471 Bacteria 2375
66 Ga0070679_100000003 3300005530 Bacteria 307836
67 Ga0070679_100241703 3300005530 Bacteria 1763
68 Ga0070684_100000748 3300005535 Bacteria 22485
69 Ga0070684_100032929 3300005535 Bacteria 4422
70 Ga0070684_100046047 3300005535 Bacteria 3779
71 Ga0070684_100183359 3300005535 Bacteria 1903
72 Ga0068853_100018340 3300005539 Bacteria 5791
73 Ga0068853_100124373 3300005539 Bacteria 2303
74 Ga0070672_100198775 3300005543 Bacteria 1676
75 Ga0070686_100000140 3300005544 Bacteria 49544
76 Ga0070665_100000105 3300005548 Bacteria 157734
77 Ga0070665_100000232 3300005548 Bacteria 92207
78 Ga0070665_100024985 3300005548 Bacteria 6023
79 Ga0070665_100146602 3300005548 Bacteria 2363
80 Ga0070664_100000058 3300005564 Bacteria 67966
81 Ga0070664_100015104 3300005564 Bacteria 6306
82 Ga0068857_100000132 3300005577 Bacteria 45188
83 Ga0068857_100029386 3300005577 Bacteria 4850
84 Ga0068854_100000025 3300005578 Bacteria 123547
85 Ga0068856_100000084 3300005614 Bacteria 87749
86 Ga0068856_100002961 3300005614 Bacteria 17414
87 Ga0068856_100214593 3300005614 Bacteria 1940
88 Ga0068859_100002459 3300005617 Bacteria 18856
89 Ga0068859_100013326 3300005617 Bacteria 8248
90 Ga0068859_100143598 3300005617 Bacteria 2460
91 Ga0068864_100001706 3300005618 Bacteria 18043
92 Ga0068864_100001781 3300005618 Bacteria 17686
93 Ga0068864_100017608 3300005618 Bacteria 5956
94 Ga0068861_100015250 3300005719 Bacteria 5411
95 Ga0068863_100000293 3300005841 Bacteria 51737
96 Ga0068863_100000466 3300005841 Bacteria 41328
97 Ga0068863_100000646 3300005841 Bacteria 35340
98 Ga0068863_100004472 3300005841 Bacteria 13781
99 Ga0068863_100012390 3300005841 Bacteria 8233
100 Ga0068863_100016521 3300005841 Bacteria 7080
101 Ga0068863_100054023 3300005841 Bacteria 3807
102 Ga0068863_100059233 3300005841 Bacteria 3623
103 Ga0068858_100000374 3300005842 Bacteria 46767
104 Ga0068858_100001936 3300005842 Bacteria 21104
105 Ga0068858_100174174 3300005842 Bacteria 2030
106 Ga0068860_100000436 3300005843 Bacteria 52935
107 Ga0068860_100000473 3300005843 Bacteria 49993
108 Ga0068860_100000638 3300005843 Bacteria 41210
109 Ga0068860_100011535 3300005843 Bacteria 8710
110 Ga0068860_100145738 3300005843 Bacteria 2278
111 Ga0068862_100001919 3300005844 Bacteria 18891
112 Ga0068862_100230441 3300005844 Bacteria 1680
113 Ga0081455_10001460 3300005937 Bacteria 29253
114 Ga0070717_10002935 3300006028 Bacteria 12108
115 Ga0075365_10018258 3300006038 Bacteria 4310
116 Ga0075368_10004106 3300006042 Bacteria 4901
117 Ga0075363_100055032 3300006048 Bacteria 2130
118 Ga0075364_10209901 3300006051 Bacteria 1320
119 Ga0075432_10004168 3300006058 Bacteria 4926
120 Ga0070712_100123961 3300006175 Bacteria 1948
121 Ga0075362_10012482 3300006177 Bacteria 3377
122 Ga0075367_10050617 3300006178 Bacteria 2453
123 Ga0075369_10096982 3300006186 Bacteria 1320
124 Ga0075366_10001326 3300006195 Bacteria 12359
125 Ga0075366_10142000 3300006195 Bacteria 1452
126 Ga0075370_10000007 3300006353 Bacteria 104910
127 Ga0075370_10030387 3300006353 Bacteria 3014
128 Ga0075370_10040419 3300006353 Bacteria 2630
129 Ga0075429_100001204 3300006880 Bacteria 20973
130 Ga0075436_100051187 3300006914 Bacteria 2850
131 Ga0097620_100013326 3300006931 Bacteria 8248
132 Ga0097620_100143601 3300006931 Bacteria 2460
133 Ga0099826_10000107 3300006948 Bacteria 38416
134 Ga0105244_10035746 3300009036 Bacteria 2608
135 Ga0105240_10143133 3300009093 Bacteria 2857
136 Ga0111539_10006194 3300009094 Bacteria 15435
137 Ga0105245_10014088 3300009098 Bacteria 6967
138 Ga0105245_10087320 3300009098 Bacteria 2863
139 Ga0114129_10399020 3300009147 Bacteria 1813
140 Ga0114129_10454935 3300009147 Bacteria 1678
141 Ga0105243_10023246 3300009148 Bacteria 4718
142 Ga0105242_10047440 3300009176 Bacteria 3488
143 Ga0105242_10062141 3300009176 Bacteria 3073
144 Ga0105242_10133617 3300009176 Bacteria 2145
145 Ga0105248_10003501 3300009177 Bacteria 17418
146 Ga0105248_10019503 3300009177 Bacteria 7505
147 Ga0105248_10153966 3300009177 Bacteria 2594
148 Ga0105238_10014995 3300009551 Bacteria 7846
149 Ga0105238_10039628 3300009551 Bacteria 4777
150 Ga0105238_10245863 3300009551 Bacteria 1767
151 Ga0105249_10026960 3300009553 Bacteria 5182
152 Ga0105249_10257053 3300009553 Bacteria 1734
153 Ga0105246_10083818 3300011119 Bacteria 2279
154 Ga0157373_10008055 3300013100 Bacteria 7831
155 Ga0157371_10000100 3300013102 Bacteria 131924
156 Ga0157371_10003600 3300013102 Bacteria 13958
157 Ga0157370_10000004 3300013104 Bacteria 366426
158 Ga0157369_10002048 3300013105 Bacteria 24329
159 Ga0157369_10034953 3300013105 Bacteria 5511
160 Ga0157374_10151270 3300013296 Bacteria 2256
161 Ga0157372_10000279 3300013307 Bacteria 56725
162 Ga0157372_10037866 3300013307 Bacteria 5322
163 Ga0157372_10133610 3300013307 Bacteria 2856
164 Ga0157375_10108322 3300013308 Bacteria 2873
165 Ga0157375_10172571 3300013308 Bacteria 2310
166 Ga0163163_10007083 3300014325 Bacteria 9859
167 Ga0163163_10012463 3300014325 Bacteria 7747
168 Ga0157380_10028164 3300014326 Bacteria 4280
169 Ga0157380_10195109 3300014326 Bacteria 1791
170 Ga0182008_10002889 3300014497 Bacteria 10629
171 Ga0157379_10009393 3300014968 Bacteria 8522
172 Ga0157376_10337921 3300014969 Bacteria 1437
173 Ga0182006_1000214 3300015261 Bacteria 56285
174 Ga0182006_1001983 3300015261 Bacteria 11554
175 Ga0163161_10109611 3300017792 Bacteria 2063
176 Ga0206356_10774019 3300020070 Bacteria 1712
177 Ga0206355_1007462 3300020076 Bacteria 1905
178 Ga0206353_11669705 3300020082 Bacteria 2196
179 Ga0154015_1588421 3300020610 Bacteria 15443
180 Ga0224712_10035527 3300022467 Bacteria 1840
181 Ga0209784_100029 3300025224 Bacteria 347315
182 Ga0209784_100853 3300025224 Bacteria 6667
183 Ga0209784_101137 3300025224 Bacteria 4294
184 Ga0209566_100030 3300025225 Bacteria 347329
185 Ga0209566_100277 3300025225 Bacteria 47887
186 Ga0209566_101363 3300025225 Bacteria 7638
187 Ga0209674_100081 3300025226 Bacteria 201146
188 Ga0209674_100089 3300025226 Bacteria 178751
189 Ga0209674_100123 3300025226 Bacteria 131438
190 Ga0209674_102250 3300025226 Bacteria 4276
191 Ga0209672_101786 3300025228 Bacteria 6628
192 Ga0209147_100008 3300025229 Bacteria 777096
193 Ga0209563_100091 3300025230 Bacteria 168320
194 Ga0209563_100092 3300025230 Bacteria 167669
195 Ga0209258_100013 3300025242 Bacteria 777096
196 Ga0209646_1000065 3300025246 Bacteria 245452
197 Ga0209026_1009936 3300025250 Bacteria 1817
198 Ga0209677_100030 3300025253 Bacteria 347314
199 Ga0209148_1000113 3300025254 Bacteria 195646
200 Ga0209148_1008463 3300025254 Bacteria 2066
201 Ga0209759_1001532 3300025256 Bacteria 12683
202 Ga0209759_1005701 3300025256 Bacteria 4298
203 Ga0209565_1000659 3300025263 Bacteria 22030
204 Ga0209455_1000106 3300025272 Bacteria 195801
205 Ga0209675_1000092 3300025291 Bacteria 144839
206 Ga0209675_1000903 3300025291 Bacteria 18979
207 Ga0209675_1002733 3300025291 Bacteria 8835
208 Ga0209676_1000378 3300025292 Bacteria 82127
209 Ga0209025_1000019 3300025294 Bacteria 631548
210 Ga0209025_1000125 3300025294 Bacteria 201444
211 Ga0209025_1000222 3300025294 Bacteria 135688
212 Ga0209025_1000837 3300025294 Bacteria 48847
213 Ga0209025_1001562 3300025294 Bacteria 29058
214 Ga0209025_1019959 3300025294 Bacteria 3695
215 Ga0209564_1000489 3300025295 Bacteria 65860
216 Ga0209564_1000655 3300025295 Bacteria 51734
217 Ga0209564_1001585 3300025295 Bacteria 22224
218 Ga0209758_1000924 3300025297 Bacteria 39688
219 Ga0209758_1018355 3300025297 Bacteria 3431
220 Ga0209050_1000049 3300025298 Bacteria 364096
221 Ga0209256_1000335 3300025299 Bacteria 78765
222 Ga0209256_1000362 3300025299 Bacteria 73517
223 Ga0209051_1016277 3300025303 Bacteria 3376
224 Ga0209257_1000692 3300025304 Bacteria 52346
225 Ga0209257_1018524 3300025304 Bacteria 2674
226 Ga0207697_10020398 3300025315 Bacteria 2713
227 Ga0207682_10000576 3300025893 Bacteria 16980
228 Ga0207688_10044607 3300025901 Bacteria 2471
229 Ga0207680_10021518 3300025903 Bacteria 3491
230 Ga0207643_10151267 3300025908 Bacteria 1391
231 Ga0207705_10000120 3300025909 Bacteria 87080
232 Ga0207684_10000750 3300025910 Bacteria 37897
233 Ga0207684_10038811 3300025910 Bacteria 4041
234 Ga0207707_10010643 3300025912 Bacteria 7990
235 Ga0207707_10059512 3300025912 Bacteria 3324
236 Ga0207695_10000535 3300025913 Bacteria 79187
237 Ga0207695_10094525 3300025913 Bacteria 2996
238 Ga0207693_10092657 3300025915 Bacteria 2368
239 Ga0207660_10000078 3300025917 Bacteria 51142
240 Ga0207657_10000839 3300025919 Bacteria 32505
241 Ga0207657_10025901 3300025919 Bacteria 5400
242 Ga0207649_10000011 3300025920 Bacteria 266219
243 Ga0207649_10000222 3300025920 Bacteria 46190
244 Ga0207652_10000004 3300025921 Bacteria 436303
245 Ga0207652_10359735 3300025921 Bacteria 1314
246 Ga0207646_10014781 3300025922 Bacteria 7396
247 Ga0207646_10085402 3300025922 Bacteria 2824
248 Ga0207681_10006820 3300025923 Bacteria 7003
249 Ga0207681_10115709 3300025923 Bacteria 1958
250 Ga0207694_10052642 3300025924 Bacteria 3155
251 Ga0207694_10159781 3300025924 Bacteria 1819
252 Ga0207650_10059019 3300025925 Bacteria 2858
253 Ga0207687_10013831 3300025927 Bacteria 5271
254 Ga0207687_10037929 3300025927 Bacteria 3291
255 Ga0207700_10003514 3300025928 Bacteria 9129
256 Ga0207700_10009309 3300025928 Bacteria 6130
257 Ga0207664_10003232 3300025929 Bacteria 10827
258 Ga0207664_10007189 3300025929 Bacteria 7713
259 Ga0207644_10000398 3300025931 Bacteria 28322
260 Ga0207690_10000005 3300025932 Bacteria 581199
261 Ga0207686_10009583 3300025934 Bacteria 5256
262 Ga0207709_10083363 3300025935 Bacteria 2067
263 Ga0207691_10043621 3300025940 Bacteria 4132
264 Ga0207711_10000552 3300025941 Bacteria 38214
265 Ga0207711_10001339 3300025941 Bacteria 23287
266 Ga0207711_10007657 3300025941 Bacteria 9032
267 Ga0207711_10276342 3300025941 Bacteria 1546
268 Ga0207661_10000743 3300025944 Bacteria 21120
269 Ga0207661_10047497 3300025944 Bacteria 3409
270 Ga0207661_10053941 3300025944 Bacteria 3219
271 Ga0207679_10000038 3300025945 Bacteria 131935
272 Ga0207679_10011528 3300025945 Bacteria 5730
273 Ga0207679_10093210 3300025945 Bacteria 2335
274 Ga0207667_10000002 3300025949 Bacteria 895662
275 Ga0207651_10126486 3300025960 Bacteria 1948
276 Ga0207712_10124398 3300025961 Bacteria 1956
277 Ga0207668_10000022 3300025972 Bacteria 135782
278 Ga0207668_10000132 3300025972 Bacteria 53005
279 Ga0207640_10000096 3300025981 Bacteria 68105
280 Ga0207658_10000021 3300025986 Bacteria 201456
281 Ga0207658_10000269 3300025986 Bacteria 54732
282 Ga0207658_10000646 3300025986 Bacteria 30565
283 Ga0207658_10024951 3300025986 Bacteria 4183
284 Ga0207658_10129407 3300025986 Bacteria 2026
285 Ga0207677_10000044 3300026023 Bacteria 107614
286 Ga0207677_10187761 3300026023 Bacteria 1632
287 Ga0207703_10000309 3300026035 Bacteria 52974
288 Ga0207703_10009731 3300026035 Bacteria 7544
289 Ga0207703_10022814 3300026035 Bacteria 4916
290 Ga0207639_10007774 3300026041 Bacteria 7325
291 Ga0207678_10000021 3300026067 Bacteria 131877
292 Ga0207678_10140873 3300026067 Bacteria 2058
293 Ga0207702_10000203 3300026078 Bacteria 70226
294 Ga0207702_10293593 3300026078 Bacteria 1541
295 Ga0207641_10000040 3300026088 Bacteria 192446
296 Ga0207641_10000098 3300026088 Bacteria 123514
297 Ga0207641_10000303 3300026088 Bacteria 61340
298 Ga0207641_10003348 3300026088 Bacteria 14247
299 Ga0207641_10004850 3300026088 Bacteria 11580
300 Ga0207641_10046616 3300026088 Bacteria 3654
301 Ga0207676_10000538 3300026095 Bacteria 31682
302 Ga0207676_10001168 3300026095 Bacteria 19769
303 Ga0207676_10204598 3300026095 Bacteria 1747
304 Ga0207674_10000875 3300026116 Bacteria 39434
305 Ga0207674_10010466 3300026116 Bacteria 10502
306 Ga0207675_100040137 3300026118 Bacteria 4369
307 Ga0207683_10019848 3300026121 Bacteria 5742
308 Ga0207683_10207938 3300026121 Bacteria 1780
309 Ga0207698_10137939 3300026142 Bacteria 2096
310 Ga0209970_1000216 3300027614 Bacteria 9245
311 Ga0209282_1000164 3300027666 Bacteria 38002
312 Ga0209813_10000538 3300027866 Bacteria 8948
313 Ga0209974_10008422 3300027876 Bacteria 3525
314 Ga0207428_10000092 3300027907 Bacteria 123897
315 Ga0207428_10025530 3300027907 Bacteria 4946
316 Ga0268266_10000055 3300028379 Bacteria 291630
317 Ga0268266_10003472 3300028379 Bacteria 15722
318 Ga0268266_10016499 3300028379 Bacteria 6313
319 Ga0268266_10317852 3300028379 Bacteria 1456
320 Ga0268265_10000536 3300028380 Bacteria 38704
321 Ga0268265_10001938 3300028380 Bacteria 16418
322 Ga0268264_10000224 3300028381 Bacteria 110355
323 Ga0268264_10000448 3300028381 Bacteria 56330
324 Ga0268264_10000670 3300028381 Bacteria 40140
325 Ga0268264_10008180 3300028381 Bacteria 8683
326 Ga0265337_1009722 3300028556 Bacteria 3417
327 Ga0307517_10000160 3300028786 Bacteria 108370
328 Ga0307515_10083866 3300028794 Bacteria 4102
329 Ga0307512_10028196 3300030522 Bacteria 4927
330 Ga0265332_10000023 3300031238 Bacteria 211994
331 Ga0265320_10001604 3300031240 Bacteria 16231
332 Ga0307513_10000012 3300031456 Bacteria 328865
333 Ga0307513_10015291 3300031456 Bacteria 9308
334 Ga0307513_10132955 3300031456 Bacteria 2429
335 Ga0307509_10000317 3300031507 Bacteria 79032
336 Ga0307408_100184728 3300031548 Bacteria 1675
337 Ga0307508_10000332 3300031616 Bacteria 57039
338 Ga0307508_10007527 3300031616 Bacteria 10124
339 Ga0307508_10007605 3300031616 Bacteria 10070
340 Ga0316575_10004304 3300031665 Bacteria 5003
341 Ga0316579_10003150 3300031691 Bacteria 6377
342 Ga0265314_10004285 3300031711 Bacteria 13328
343 Ga0265314_10017039 3300031711 Bacteria 5713
344 Ga0316578_10004181 3300031728 Bacteria 6767
345 Ga0307516_10000780 3300031730 Bacteria 43450
346 Ga0307516_10061200 3300031730 Bacteria 3654
347 Ga0307516_10114153 3300031730 Bacteria 2499
348 Ga0316577_10006191 3300031733 Bacteria 6313
349 Ga0316577_10045703 3300031733 Unclassified 2447
350 Ga0307406_10059244 3300031901 Bacteria 2464
351 Ga0307412_10002104 3300031911 Bacteria 11059
352 Ga0307409_100052099 3300031995 Bacteria 3136
353 Ga0307416_100024842 3300032002 Bacteria 4382
354 Ga0307416_100142383 3300032002 Bacteria 2182
355 Ga0307415_100000216 3300032126 Bacteria 25296
356 Ga0316583_10005971 3300032133 Bacteria 4375
357 Ga0307507_10003609 3300033179 Bacteria 29424
358 Ga0373943_0002887 3300035170 Bacteria 7805
359 Ga0373943_0111234 3300035170 Bacteria 1445
360 Ga0373946_0015907 3300035171 Bacteria 2860
361 Ga0316574_0007755 3300035398 Bacteria 5907
362 Ga0316574_0083477 3300035398 Bacteria 2031
363 Ga0373931_0055251 3300035691 Bacteria 2124
364 Ga0373927_0023557 3300035695 Bacteria 4031
365 Ga0373947_0005518 3300035725 Bacteria 7382
366 Ga0373937_0204671 3300036401 Bacteria 1856
367 Ga0316582_0012322 3300036647 Bacteria 4765
368 Ga0316582_0029496 3300036647 Bacteria 3333
369 Ga0316584_0024929 3300036712 Bacteria 4382
370 Ga0373925_0015618 3300037068 Bacteria 5493
371 Ga0395899_0068146 3300037312 Bacteria 2610
372 Ga0395900_0017809 3300037418 Bacteria 7252
373 Ga0395898_0002667 3300037466 Bacteria 20695
374 Ga0395898_0228097 3300037466 Bacteria 1776
375 Ga0395905_0126226 3300037471 Bacteria 2406
376 Ga0395905_0248951 3300037471 Bacteria 1660
377 Ga0316581_0002782 3300037588 Bacteria 4253
378 Ga0436364_0623951 3300037853 Bacteria 1727
379 Ga0395901_0356252 3300038443 Bacteria 1509
380 Ga0400489_74021 3300039093 Bacteria 99222
381 Ga0237816_00675 3300039145 Bacteria 2879
382 Ga0436365_1862304 3300039437 Bacteria 21258
383 Ga0436360_0151113 3300039438 Bacteria 2522
384 Ga0436361_0523586 3300039447 Bacteria 2239
385 Ga0436361_1082374 3300039447 Bacteria 1356
386 Ga0436362_0793039 3300039453 Bacteria 2761
387 Ga0439465_0003542 3300041413 Bacteria 5088
388 Ga0451789_0160161 3300041443 Bacteria 1657
389 Ga0439431_0009881 3300041997 Bacteria 2160
390 Ga0439433_0016132 3300041999 Bacteria 1652
391 Ga0439445_0001721 3300042004 Bacteria 4814
392 Ga0439432_013107 3300042006 Bacteria 2822
393 Ga0439452_002901 3300042010 Bacteria 6146
394 Ga0439462_0002353 3300042015 Bacteria 4380
395 Ga0451577_0003119 3300042876 Bacteria 18698
396 Ga0451577_0009675 3300042876 Bacteria 9250
397 Ga0451577_0024476 3300042876 Bacteria 5492
398 Ga0466972_0012085 3300044658 Bacteria 4337
399 Ga0466977_0000017 3300044666 Bacteria 25598
400 Ga0453683_0008099 3300044673 Bacteria 7071
401 Ga0466961_0029656 3300044693 Bacteria 3515
402 Ga0466963_0009063 3300044694 Bacteria 5980
403 Ga0466963_0017004 3300044694 Bacteria 4531
404 Ga0466963_0018728 3300044694 Bacteria 4333
405 Ga0466963_0041835 3300044694 Bacteria 3006
406 Ga0466963_0069549 3300044694 Bacteria 2366
407 Ga0466963_0115902 3300044694 Bacteria 1841
408 Ga0466964_0017280 3300044706 Bacteria 2760
409 Ga0453684_0001067 3300044712 Bacteria 87208
410 Ga0453684_0005158 3300044712 Bacteria 26278
411 Ga0453684_0013899 3300044712 Bacteria 12984
412 Ga0453684_0048167 3300044712 Bacteria 5640
413 Ga0466967_0009491 3300045976 Bacteria 7223
414 Ga0466967_0032996 3300045976 Bacteria 4378
415 Ga0466967_0139468 3300045976 Bacteria 2257
416 Ga0466967_0210765 3300045976 Bacteria 1843
417 Ga0495617_001554 3300046452 Bacteria 9939
418 Ga0495627_000014 3300046453 Bacteria 326114
419 Ga0495603_0000988 3300046455 Bacteria 16389
420 Ga0495590_0005528 3300046457 Bacteria 5002
421 Ga0495638_0000574 3300046460 Bacteria 41469
422 Ga0495638_0093897 3300046460 Bacteria 1803
423 Ga0495653_0013130 3300046463 Bacteria 6753
424 Ga0495650_0064296 3300046471 Bacteria 1460
425 Ga0495580_0007367 3300046472 Bacteria 8848
426 Ga0495580_0049094 3300046472 Bacteria 2986
427 Ga0495582_0062462 3300046473 Bacteria 2058
428 Ga0495605_0002043 3300046474 Bacteria 12726
429 Ga0495605_0085363 3300046474 Bacteria 1471
430 Ga0495664_0014761 3300046477 Bacteria 4433
431 Ga0495584_0079964 3300046491 Bacteria 1644
432 Ga0495585_0152065 3300046492 Bacteria 1206
433 Ga0495594_0160333 3300046499 Bacteria 1278
434 Ga0495596_0008204 3300046500 Bacteria 4657
435 Ga0495607_0004169 3300046501 Bacteria 10749
436 Ga0495610_0000544 3300046512 Bacteria 37703
437 Ga0495610_0001425 3300046512 Bacteria 21154
438 Ga0495610_0077086 3300046512 Bacteria 1540
439 Ga0495630_0111726 3300046517 Bacteria 2070
440 Ga0495631_0002618 3300046518 Bacteria 10048
441 Ga0495632_0000071 3300046519 Bacteria 105606
442 Ga0495632_0017991 3300046519 Bacteria 3886
443 Ga0495643_0000019 3300046522 Bacteria 303627
444 Ga0495643_0079766 3300046522 Bacteria 1706
445 Ga0495666_0000304 3300046526 Bacteria 21414
446 Ga0495654_0092141 3300046530 Bacteria 1405
447 Ga0495665_0042865 3300046531 Bacteria 2407
448 Ga0495609_0000774 3300046538 Bacteria 23950
449 Ga0495609_0011105 3300046538 Bacteria 4300
450 Ga0495621_0023547 3300046539 Bacteria 2049
451 Ga0495597_0001142 3300046542 Bacteria 20021
452 Ga0495597_0001324 3300046542 Bacteria 18105
453 Ga0495633_0007390 3300046558 Bacteria 6326
454 Ga0495633_0017348 3300046558 Bacteria 3684
455 Ga0495633_0047771 3300046558 Bacteria 2022
456 Ga0495656_0003734 3300046615 Bacteria 5170
457 Ga0495668_0002749 3300046616 Bacteria 14061
458 Ga0495668_0006888 3300046616 Bacteria 7365
459 Ga0495668_0007365 3300046616 Bacteria 7048
460 Ga0495611_0005124 3300046648 Bacteria 5616
461 Ga0495625_0009987 3300046660 Bacteria 7895
462 Ga0495661_0012421 3300046665 Bacteria 5749
463 Ga0495661_0160659 3300046665 Bacteria 1206
464 Ga0495588_0000738 3300046674 Bacteria 14916
465 Ga0495599_0017583 3300046678 Bacteria 4445
466 Ga0495623_0071650 3300046679 Bacteria 2156
467 Ga0495658_0027317 3300046683 Bacteria 3070
468 Ga0495658_0038141 3300046683 Bacteria 2660
469 Ga0495669_0000457 3300046684 Bacteria 19129
470 Ga0495670_0044048 3300046691 Bacteria 2228
471 Ga0495671_0019697 3300046692 Bacteria 3562
472 Ga0495671_0052407 3300046692 Bacteria 2028
473 Ga0495671_0088770 3300046692 Bacteria 1514
474 Ga0495589_0014193 3300046794 Bacteria 4105
475 Ga0495660_0085296 3300046810 Bacteria 1650
476 Ga0495581_0073713 3300047315 Bacteria 1976
477 Ga0495604_0000217 3300047317 Bacteria 52754
478 Ga0495604_0034176 3300047317 Bacteria 4023
479 Ga0495636_0022712 3300047318 Bacteria 2538
480 Ga0495674_0024158 3300047319 Bacteria 5591
481 Ga0495676_0007422 3300047321 Bacteria 10060
482 Ga0495687_000088 3300047443 Bacteria 142499
483 Ga0495675_0045177 3300047444 Bacteria 2805
484 Ga0495685_015806 3300047447 Bacteria 2577
485 Ga0495681_0007224 3300047470 Bacteria 7138
486 Ga0495686_0045107 3300047472 Bacteria 2790
487 Ga0495686_0116773 3300047472 Bacteria 1595
488 Ga0495602_0146940 3300048088 Bacteria 1858
489 Ga0495602_0209775 3300048088 Bacteria 1479
490 Ga0495615_0002368 3300048090 Bacteria 3018
491 Ga0495615_0012211 3300048090 Bacteria 1766
492 Ga0496100_0068457 3300048903 Bacteria 2361
493 Ga0496101_0134058 3300048904 Bacteria 1883
494 Ga0496102_0019796 3300048905 Bacteria 5933
495 Ga0496102_0036013 3300048905 Bacteria 4457
496 Ga0496102_0339008 3300048905 Bacteria 1416
497 Ga0496104_0003494 3300048907 Bacteria 13552
498 Ga0496104_0024889 3300048907 Bacteria 5513
499 Ga0496104_0032875 3300048907 Bacteria 4829
500 Ga0496105_0001303 3300048908 Bacteria 17456
501 Ga0496108_0002007 3300048911 Bacteria 16311
502 Ga0496108_0253004 3300048911 Bacteria 1533
503 Ga0496109_0005264 3300048912 Bacteria 10806
504 Ga0496110_0018031 3300048913 Bacteria 5913
505 Ga0496110_0063217 3300048913 Bacteria 3270
506 Ga0496110_0078107 3300048913 Bacteria 2947
507 Ga0496111_0012102 3300048914 Bacteria 5834
508 Ga0496112_0020625 3300048915 Bacteria 6249
509 Ga0496112_0078711 3300048915 Bacteria 3260
510 Ga0496112_0095315 3300048915 Bacteria 2946
511 Ga0496112_0118720 3300048915 Bacteria 2615
512 Ga0496112_0231596 3300048915 Bacteria 1802
513 Ga0496113_0000822 3300048916 Bacteria 16174
514 Ga0496113_0128734 3300048916 Bacteria 1985
515 Ga0496114_0001735 3300048917 Bacteria 16539
516 Ga0496114_0269482 3300048917 Bacteria 1500
517 Ga0496115_0036684 3300048918 Bacteria 3882
518 Ga0496116_0009863 3300048919 Bacteria 8081
519 Ga0496116_0064990 3300048919 Bacteria 2342
520 Ga0496117_0003650 3300048920 Bacteria 17708
521 Ga0496117_0011109 3300048920 Bacteria 8098
522 Ga0496118_0005735 3300048921 Bacteria 13968
523 Ga0496118_0107692 3300048921 Bacteria 1860
524 Ga0496119_0012959 3300048922 Bacteria 6705
525 Ga0496119_0059160 3300048922 Bacteria 2303
526 Ga0496120_0062689 3300048923 Bacteria 2070
527 Ga0496121_0000130 3300048924 Bacteria 168094
528 Ga0496121_0003287 3300048924 Bacteria 23207
529 Ga0496121_0010155 3300048924 Bacteria 10663
530 Ga0496121_0015854 3300048924 Bacteria 7835
531 Ga0496121_0054278 3300048924 Bacteria 3350
532 Ga0496122_0000497 3300048925 Bacteria 81763
533 Ga0496122_0001804 3300048925 Bacteria 32800
534 Ga0496122_0017319 3300048925 Bacteria 6747
535 Ga0496123_0001884 3300048926 Bacteria 27381
536 Ga0496123_0003744 3300048926 Bacteria 16674
537 Ga0496123_0013777 3300048926 Bacteria 6753
538 Ga0496123_0047399 3300048926 Bacteria 2904
539 Ga0496124_0004245 3300048927 Bacteria 16863
540 Ga0496124_0043872 3300048927 Bacteria 3840
541 Ga0496124_0054741 3300048927 Bacteria 3375
542 Ga0496125_0000166 3300048928 Bacteria 147432
543 Ga0496125_0016464 3300048928 Bacteria 7097
544 Ga0496125_0041883 3300048928 Bacteria 3909
545 Ga0496125_0136526 3300048928 Bacteria 1714
546 Ga0496125_0141908 3300048928 Bacteria 1668
547 Ga0496125_0189022 3300048928 Bacteria 1362
548 Ga0496126_0000090 3300048929 Bacteria 210538
549 Ga0496126_0001188 3300048929 Bacteria 42555
550 Ga0496126_0032209 3300048929 Bacteria 4941
551 Ga0496126_0032887 3300048929 Bacteria 4881
552 Ga0495678_005337 3300049459 Bacteria 7127
553 Ga0495678_018010 3300049459 Bacteria 3185
554 Ga0501032_0093152 3300049569 Bacteria 1998
555 Ga0501033_0037756 3300049570 Bacteria 3614
556 Ga0501034_0000022 3300049571 Bacteria 264441
557 Ga0501034_0000874 3300049571 Bacteria 44331
558 Ga0501034_0001048 3300049571 Bacteria 39365
559 Ga0501034_0128127 3300049571 Bacteria 2523
560 Ga0501034_0163474 3300049571 Bacteria 2195
561 Ga0501036_0044073 3300049572 Bacteria 3778
562 Ga0501037_0007425 3300049573 Bacteria 8014
563 Ga0501047_0001179 3300049581 Bacteria 25916
564 Ga0501047_0003160 3300049581 Bacteria 15617
565 Ga0501047_0093778 3300049581 Bacteria 2881
566 Ga0501072_0109871 3300049588 Bacteria 2194
567 Ga0501073_0000068 3300049589 Bacteria 63524
568 Ga0501077_0000056 3300049593 Bacteria 57478
569 Ga0501227_000555 3300049665 Bacteria 8121
570 Ga0501233_007858 3300049668 Bacteria 2041
571 Ga0501238_002816 3300049671 Bacteria 2106
572 Ga0501225_0005596 3300049705 Bacteria 3681
573 Ga0501080_0216113 3300049742 Bacteria 1756
574 Ga0501035_0060943 3300049822 Bacteria 3358
575 Ga0501035_0116678 3300049822 Bacteria 2336
576 Ga0501044_0008276 3300049823 Bacteria 11404
577 Ga0501044_0010514 3300049823 Bacteria 10043
578 Ga0501044_0087580 3300049823 Bacteria 3145
579 Ga0501044_0180316 3300049823 Bacteria 2079
580 Ga0501044_0487690 3300049823 Bacteria 1135
581 nmdc:mga03683_38552_c1 3300050489 Bacteria 1952
582 nmdc:mga03683_591_c1 3300050489 Bacteria 10402
583 nmdc:mga03n38_20105_c1 3300050490 Bacteria 2666
584 nmdc:mga00v17_139488_c1 3300050491 Bacteria 1554
585 nmdc:mga0k408_161729_c1 3300050493 Bacteria 1334
586 nmdc:mga0k408_353_c1 3300050493 Bacteria 25220
587 nmdc:mga0k408_72272_c1 3300050493 Bacteria 2015
588 nmdc:mga06z11_231_c1 3300050494 Bacteria 21729
589 nmdc:mga04h51_485_c1 3300050495 Bacteria 9513
590 nmdc:mga07m45_116560_c1 3300050496 Bacteria 1541
591 nmdc:mga07m45_263_c1 3300050496 Bacteria 21293
592 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
593 nmdc:mga07m45_57039_c1 3300050496 Bacteria 2208
594 nmdc:mga07m45_88_c1 3300050496 Bacteria 34971
595 nmdc:mga05p37_360043_c1 3300050507 Bacteria 1710
596 nmdc:mga08y16_177547_c1 3300050511 Bacteria 2211
597 nmdc:mga08y16_46_c1 3300050511 Bacteria 112050
598 nmdc:mga0n895_25306_c1 3300050512 Bacteria 5606
599 nmdc:mga08x19_69278_c1 3300050514 Bacteria 2297
600 nmdc:mga0sz30_1776_c1 3300050516 Bacteria 7657
601 Ga0500643_006677 3300053087 Bacteria 4779
602 Ga0500643_010806 3300053087 Bacteria 3374
603 Ga0500643_036052 3300053087 Bacteria 1478
604 Ga0500644_0008259 3300053088 Bacteria 2743
605 Ga0500646_0010306 3300053090 Bacteria 2398
606 Ga0500651_0002923 3300053093 Bacteria 9181
607 Ga0500566_0037686 3300053094 Bacteria 2800
608 Ga0500641_0004583 3300053096 Bacteria 4884
609 Ga0500556_0049884 3300053104 Bacteria 1511
610 Ga0500569_002802 3300053109 Bacteria 3479
611 Ga0500572_002675 3300053111 Bacteria 4217
612 Ga0500592_000770 3300053116 Bacteria 5266
613 Ga0500594_0002724 3300053118 Bacteria 3847
614 Ga0500594_0067983 3300053118 Bacteria 1042
615 Ga0500608_000265 3300053122 Bacteria 20322
616 Ga0500614_000567 3300053123 Bacteria 9542
617 Ga0500618_000833 3300053125 Bacteria 16749
618 Ga0500618_004394 3300053125 Bacteria 4531
619 Ga0500618_006225 3300053125 Bacteria 3524
620 Ga0500642_0000278 3300053130 Bacteria 19182
621 Ga0500652_003604 3300053131 Bacteria 4702
622 Ga0500655_000670 3300053133 Bacteria 6806
623 Ga0500658_0000047 3300053134 Bacteria 66543
624 Ga0500559_0000442 3300053136 Bacteria 29452
625 Ga0500559_0002100 3300053136 Bacteria 10621
626 Ga0500559_0005405 3300053136 Bacteria 5884
627 Ga0500568_0002510 3300053139 Bacteria 10740
628 Ga0500577_0004311 3300053142 Bacteria 3750
629 Ga0500577_0007102 3300053142 Bacteria 3125
630 Ga0500577_0102201 3300053142 Bacteria 1173
631 Ga0500588_0000198 3300053146 Bacteria 8377
632 Ga0500590_021126 3300053148 Bacteria 3379
633 Ga0500604_0000031 3300053151 Bacteria 57942
634 Ga0500604_0050890 3300053151 Bacteria 1278
635 Ga0500616_0000108 3300053153 Bacteria 152917
636 Ga0500616_0001465 3300053153 Bacteria 22527
637 Ga0500616_0001953 3300053153 Bacteria 18378
638 Ga0500616_0002610 3300053153 Bacteria 14737
639 Ga0500616_0002923 3300053153 Bacteria 13613
640 Ga0500619_038130 3300053154 Bacteria 1505
641 Ga0500622_0000937 3300053156 Bacteria 24806
642 Ga0500622_0006169 3300053156 Bacteria 7026
643 Ga0500624_000072 3300053157 Bacteria 57950
644 Ga0500624_000210 3300053157 Bacteria 22056
645 Ga0500627_0000297 3300053158 Bacteria 13822
646 Ga0500639_005154 3300053163 Bacteria 6669
647 Ga0500636_0000144 3300053177 Bacteria 37563
648 Ga0500636_0005061 3300053177 Bacteria 7481
649 Ga0500636_0120981 3300053177 Bacteria 1468
650 Ga0500567_007296 3300053723 Bacteria 5202
651 Ga0500570_000059 3300053724 Bacteria 27832
652 Ga0500611_001425 3300053727 Bacteria 2624
653 Ga0500625_000003 3300053729 Bacteria 268493
654 Ga0500645_004201 3300053730 Bacteria 5602
655 Ga0500645_005487 3300053730 Bacteria 4658
656 Ga0500656_003807 3300053732 Bacteria 1428
657 Ga0500587_005434 3300053739 Bacteria 1712
658 Ga0501082_0001742 3300060353 Bacteria 19211
659 Ga0466962_0022700 3300061719 Bacteria 3016
660 2508678058 2508501039 Bacteria 9978592
661 2513954612 2513237150 Bacteria 6553639
662 2514043503 2513237165 Bacteria 6771773
663 2535487023 2534681786 Bacteria 3308809
664 2558911688 2558860112 Bacteria 9931328
665 2597031435 2596583598 Bacteria 5251611
666 2599445216 2599185178 Bacteria 5365746
667 2599904135 2599185292 Bacteria 6290804
668 2643861332 2643221569 Bacteria 6064337
669 2643983119 2643221594 Bacteria 5811388
670 2644120538 2643221621 Bacteria 6212786
671 2676202151 2675902999 Bacteria 9438463
672 2739651477 2739367664 Bacteria 4114334
673 2740029950 2739367865 Bacteria 4114482
674 2753357145 2751185800 Bacteria 5467370
675 2758639429 2758568016 Bacteria 5645291
676 2792833517 2791355137 Bacteria 9654227
677 2809032890 2808606395 Bacteria 6020352
678 2816506841 2816332139 Bacteria 9138787
679 2819694293 2818991463 Bacteria 7948711
680 2828307547 2828305725 Bacteria 4916900
681 2834643682 2834641062 Bacteria 5559922
682 2855733015 2855730933 Bacteria 7047938
683 2855771767 2855767633 Bacteria 7049357
684 2856318166 2856314179 Bacteria 6477897
685 2857537824 2857537821 Bacteria 5248181
686 2858956241 2858950400 Bacteria 6783797
687 2881415823 2881412998 Bacteria 6492157
688 2885270335 2885266251 Bacteria 4796748
689 2885320801 2885318864 Bacteria 6729568
690 2891636798 2891633521 Bacteria 4602265
691 2900580497 2900577576 Bacteria 5438534
692 2901311801 2901300506 Bacteria 8463898
693 2906418203 2906414383 Bacteria 6580790
694 2915654387 2915650412 Bacteria 4288180
695 2928063790 2928058823 Bacteria 5520022
696 2941482888
697 2961175848 2961170736 Bacteria 7072258
698 2970508513 2970503327 Bacteria 7099517
699 2979811838 2979808191 Bacteria 7179355
700 2989352632 2989349275 Bacteria 6349068
701 2989781214 2989776772 Bacteria 4843317
702 644752294 644736347 Bacteria 6476522
703 8003405068 8003400568 Bacteria 5535898
704 8048749669 8048746797 Bacteria 3557226
705 Ga0075362_10058785
706 JGI24741J21665_1000448
707 JGI24740J21852_10000149
708 JGI24740J21852_10000159
709 JGI25156J39149_1007314
710 JGI25154J39366_1001599
711 JGI25151J46595_10000228
712 JGI25151J46595_10001462
713 Ga0055539_1000086
714 Ga0055533_1001557
715 Ga0055532_1000041
716 Ga0055535_1000030
717 Ga0055542_1000818
718 Ga0055529_1000058
719 Ga0055526_1011710
720 Ga0055524_1001952
721 Ga0055536_1000114
722 Ga0055534_1003641
723 Ga0055530_10000579
724 Ga0055541_1001902
725 Ga0065704_10009005
726 Ga0065704_10079565
727 Ga0070658_10004072
728 Ga0070658_10132353
729 Ga0070683_100002003
730 Ga0070683_100164059
731 Ga0070670_100000981
732 Ga0070670_100026142
733 Ga0070670_100126234
734 Ga0070677_10000559
735 Ga0070666_10191773
736 Ga0070680_100000727
737 Ga0068868_100000036
738 Ga0070660_100000347
739 Ga0070661_100000001
740 Ga0070661_100000072
741 Ga0070692_10000276
742 Ga0070668_100000013
743 Ga0070668_100002822
744 Ga0070669_100006287
745 Ga0070669_100019626
746 Ga0070669_100106120
747 Ga0070675_100028436
748 Ga0070671_100000225
749 Ga0070671_100038951
750 Ga0070674_100061329
751 Ga0070673_100046037
752 Ga0070659_100000034
753 Ga0070667_100000328
754 Ga0070667_100000413
755 Ga0070667_100000889
756 Ga0070714_100001638
757 Ga0070714_100109168
758 Ga0070714_100131545
759 Ga0070713_100003580
760 Ga0070713_100093464
761 Ga0070663_100000015
762 Ga0070678_100227437
763 Ga0070678_100258433
764 Ga0070681_10014042
765 Ga0070685_10000593
766 Ga0070706_100001450
767 Ga0070706_100168273
768 Ga0070707_100021081
769 Ga0070698_100139653
770 Ga0070679_100000003
771 Ga0070679_100241703
772 Ga0070684_100000748
773 Ga0070684_100032929
774 Ga0070684_100046047
775 Ga0070684_100183359
776 Ga0068853_100018340
777 Ga0068853_100124373
778 Ga0070672_100198775
779 Ga0070686_100000140
780 Ga0070665_100000105
781 Ga0070665_100000232
782 Ga0070665_100024985
783 Ga0070665_100146602
784 Ga0070664_100000058
785 Ga0070664_100015104
786 Ga0068857_100000132
787 Ga0068857_100029386
788 Ga0068854_100000025
789 Ga0068856_100000084
790 Ga0068856_100002961
791 Ga0068856_100214593
792 Ga0068859_100002459
793 Ga0068859_100013326
794 Ga0068859_100143598
795 Ga0068864_100001706
796 Ga0068864_100001781
797 Ga0068864_100017608
798 Ga0068861_100015250
799 Ga0068863_100000293
800 Ga0068863_100000466
801 Ga0068863_100000646
802 Ga0068863_100004472
803 Ga0068863_100012390
804 Ga0068863_100016521
805 Ga0068863_100054023
806 Ga0068863_100059233
807 Ga0068858_100000374
808 Ga0068858_100001936
809 Ga0068858_100174174
810 Ga0068860_100000436
811 Ga0068860_100000473
812 Ga0068860_100000638
813 Ga0068860_100011535
814 Ga0068860_100145738
815 Ga0068862_100001919
816 Ga0068862_100230441
817 Ga0081455_10001460
818 Ga0070717_10002935
819 Ga0075365_10018258
820 Ga0075368_10004106
821 Ga0075363_100055032
822 Ga0075364_10209901
823 Ga0075432_10004168
824 Ga0070712_100123961
825 Ga0075362_10012482
826 Ga0075367_10050617
827 Ga0075369_10096982
828 Ga0075366_10001326
829 Ga0075366_10142000
830 Ga0075370_10000007
831 Ga0075370_10030387
832 Ga0075370_10040419
833 Ga0075429_100001204
834 Ga0075436_100051187
835 Ga0097620_100013326
836 Ga0097620_100143601
837 Ga0099826_10000107
838 Ga0105244_10035746
839 Ga0105240_10143133
840 Ga0111539_10006194
841 Ga0105245_10014088
842 Ga0105245_10087320
843 Ga0114129_10399020
844 Ga0114129_10454935
845 Ga0105243_10023246
846 Ga0105242_10047440
847 Ga0105242_10062141
848 Ga0105242_10133617
849 Ga0105248_10003501
850 Ga0105248_10019503
851 Ga0105248_10153966
852 Ga0105238_10014995
853 Ga0105238_10039628
854 Ga0105238_10245863
855 Ga0105249_10026960
856 Ga0105249_10257053
857 Ga0105246_10083818
858 Ga0157373_10008055
859 Ga0157371_10000100
860 Ga0157371_10003600
861 Ga0157370_10000004
862 Ga0157369_10002048
863 Ga0157369_10034953
864 Ga0157374_10151270
865 Ga0157372_10000279
866 Ga0157372_10037866
867 Ga0157372_10133610
868 Ga0157375_10108322
869 Ga0157375_10172571
870 Ga0163163_10007083
871 Ga0163163_10012463
872 Ga0157380_10028164
873 Ga0157380_10195109
874 Ga0182008_10002889
875 Ga0157379_10009393
876 Ga0157376_10337921
877 Ga0182006_1000214
878 Ga0182006_1001983
879 Ga0163161_10109611
880 Ga0206356_10774019
881 Ga0206355_1007462
882 Ga0206353_11669705
883 Ga0154015_1588421
884 Ga0224712_10035527
885 Ga0209784_100029
886 Ga0209784_100853
887 Ga0209784_101137
888 Ga0209566_100030
889 Ga0209566_100277
890 Ga0209566_101363
891 Ga0209674_100081
892 Ga0209674_100089
893 Ga0209674_100123
894 Ga0209674_102250
895 Ga0209672_101786
896 Ga0209147_100008
897 Ga0209563_100091
898 Ga0209563_100092
899 Ga0209258_100013
900 Ga0209646_1000065
901 Ga0209026_1009936
902 Ga0209677_100030
903 Ga0209148_1000113
904 Ga0209148_1008463
905 Ga0209759_1001532
906 Ga0209759_1005701
907 Ga0209565_1000659
908 Ga0209455_1000106
909 Ga0209675_1000092
910 Ga0209675_1000903
911 Ga0209675_1002733
912 Ga0209676_1000378
913 Ga0209025_1000019
914 Ga0209025_1000125
915 Ga0209025_1000222
916 Ga0209025_1000837
917 Ga0209025_1001562
918 Ga0209025_1019959
919 Ga0209564_1000489
920 Ga0209564_1000655
921 Ga0209564_1001585
922 Ga0209758_1000924
923 Ga0209758_1018355
924 Ga0209050_1000049
925 Ga0209256_1000335
926 Ga0209256_1000362
927 Ga0209051_1016277
928 Ga0209257_1000692
929 Ga0209257_1018524
930 Ga0207697_10020398
931 Ga0207682_10000576
932 Ga0207688_10044607
933 Ga0207680_10021518
934 Ga0207643_10151267
935 Ga0207705_10000120
936 Ga0207684_10000750
937 Ga0207684_10038811
938 Ga0207707_10010643
939 Ga0207707_10059512
940 Ga0207695_10000535
941 Ga0207695_10094525
942 Ga0207693_10092657
943 Ga0207660_10000078
944 Ga0207657_10000839
945 Ga0207657_10025901
946 Ga0207649_10000011
947 Ga0207649_10000222
948 Ga0207652_10000004
949 Ga0207652_10359735
950 Ga0207646_10014781
951 Ga0207646_10085402
952 Ga0207681_10006820
953 Ga0207681_10115709
954 Ga0207694_10052642
955 Ga0207694_10159781
956 Ga0207650_10059019
957 Ga0207687_10013831
958 Ga0207687_10037929
959 Ga0207700_10003514
960 Ga0207700_10009309
961 Ga0207664_10003232
962 Ga0207664_10007189
963 Ga0207644_10000398
964 Ga0207690_10000005
965 Ga0207686_10009583
966 Ga0207709_10083363
967 Ga0207691_10043621
968 Ga0207711_10000552
969 Ga0207711_10001339
970 Ga0207711_10007657
971 Ga0207711_10276342
972 Ga0207661_10000743
973 Ga0207661_10047497
974 Ga0207661_10053941
975 Ga0207679_10000038
976 Ga0207679_10011528
977 Ga0207679_10093210
978 Ga0207667_10000002
979 Ga0207651_10126486
980 Ga0207712_10124398
981 Ga0207668_10000022
982 Ga0207668_10000132
983 Ga0207640_10000096
984 Ga0207658_10000021
985 Ga0207658_10000269
986 Ga0207658_10000646
987 Ga0207658_10024951
988 Ga0207658_10129407
989 Ga0207677_10000044
990 Ga0207677_10187761
991 Ga0207703_10000309
992 Ga0207703_10009731
993 Ga0207703_10022814
994 Ga0207639_10007774
995 Ga0207678_10000021
996 Ga0207678_10140873
997 Ga0207702_10000203
998 Ga0207702_10293593
999 Ga0207641_10000040
1000 Ga0207641_10000098
1001 Ga0207641_10000303
1002 Ga0207641_10003348
1003 Ga0207641_10004850
1004 Ga0207641_10046616
1005 Ga0207676_10000538
1006 Ga0207676_10001168
1007 Ga0207676_10204598
1008 Ga0207674_10000875
1009 Ga0207674_10010466
1010 Ga0207675_100040137
1011 Ga0207683_10019848
1012 Ga0207683_10207938
1013 Ga0207698_10137939
1014 Ga0209970_1000216
1015 Ga0209282_1000164
1016 Ga0209813_10000538
1017 Ga0209974_10008422
1018 Ga0207428_10000092
1019 Ga0207428_10025530
1020 Ga0268266_10000055
1021 Ga0268266_10003472
1022 Ga0268266_10016499
1023 Ga0268266_10317852
1024 Ga0268265_10000536
1025 Ga0268265_10001938
1026 Ga0268264_10000224
1027 Ga0268264_10000448
1028 Ga0268264_10000670
1029 Ga0268264_10008180
1030 Ga0265337_1009722
1031 Ga0307517_10000160
1032 Ga0307515_10083866
1033 Ga0307512_10028196
1034 Ga0265332_10000023
1035 Ga0265320_10001604
1036 Ga0307513_10000012
1037 Ga0307513_10015291
1038 Ga0307513_10132955
1039 Ga0307509_10000317
1040 Ga0307408_100184728
1041 Ga0307508_10000332
1042 Ga0307508_10007527
1043 Ga0307508_10007605
1044 Ga0316575_10004304
1045 Ga0316579_10003150
1046 Ga0265314_10004285
1047 Ga0265314_10017039
1048 Ga0316578_10004181
1049 Ga0307516_10000780
1050 Ga0307516_10061200
1051 Ga0307516_10114153
1052 Ga0316577_10006191
1053 Ga0316577_10045703
1054 Ga0307406_10059244
1055 Ga0307412_10002104
1056 Ga0307409_100052099
1057 Ga0307416_100024842
1058 Ga0307416_100142383
1059 Ga0307415_100000216
1060 Ga0316583_10005971
1061 Ga0307507_10003609
1062 Ga0373943_0002887
1063 Ga0373943_0111234
1064 Ga0373946_0015907
1065 Ga0316574_0007755
1066 Ga0316574_0083477
1067 Ga0373931_0055251
1068 Ga0373927_0023557
1069 Ga0373947_0005518
1070 Ga0373937_0204671
1071 Ga0316582_0012322
1072 Ga0316582_0029496
1073 Ga0316584_0024929
1074 Ga0373925_0015618
1075 Ga0395899_0068146
1076 Ga0395900_0017809
1077 Ga0395898_0002667
1078 Ga0395898_0228097
1079 Ga0395905_0126226
1080 Ga0395905_0248951
1081 Ga0316581_0002782
1082 Ga0436364_0623951
1083 Ga0395901_0356252
1084 Ga0400489_74021
1085 Ga0237816_00675
1086 Ga0436365_1862304
1087 Ga0436360_0151113
1088 Ga0436361_0523586
1089 Ga0436361_1082374
1090 Ga0436362_0793039
1091 Ga0439465_0003542
1092 Ga0451789_0160161
1093 Ga0439431_0009881
1094 Ga0439433_0016132
1095 Ga0439445_0001721
1096 Ga0439432_013107
1097 Ga0439452_002901
1098 Ga0439462_0002353
1099 Ga0451577_0003119
1100 Ga0451577_0009675
1101 Ga0451577_0024476
1102 Ga0466972_0012085
1103 Ga0466977_0000017
1104 Ga0453683_0008099
1105 Ga0466961_0029656
1106 Ga0466963_0009063
1107 Ga0466963_0017004
1108 Ga0466963_0018728
1109 Ga0466963_0041835
1110 Ga0466963_0069549
1111 Ga0466963_0115902
1112 Ga0466964_0017280
1113 Ga0453684_0001067
1114 Ga0453684_0005158
1115 Ga0453684_0013899
1116 Ga0453684_0048167
1117 Ga0466967_0009491
1118 Ga0466967_0032996
1119 Ga0466967_0139468
1120 Ga0466967_0210765
1121 Ga0495617_001554
1122 Ga0495627_000014
1123 Ga0495603_0000988
1124 Ga0495590_0005528
1125 Ga0495638_0000574
1126 Ga0495638_0093897
1127 Ga0495653_0013130
1128 Ga0495650_0064296
1129 Ga0495580_0007367
1130 Ga0495580_0049094
1131 Ga0495582_0062462
1132 Ga0495605_0002043
1133 Ga0495605_0085363
1134 Ga0495664_0014761
1135 Ga0495584_0079964
1136 Ga0495585_0152065
1137 Ga0495594_0160333
1138 Ga0495596_0008204
1139 Ga0495607_0004169
1140 Ga0495610_0000544
1141 Ga0495610_0001425
1142 Ga0495610_0077086
1143 Ga0495630_0111726
1144 Ga0495631_0002618
1145 Ga0495632_0000071
1146 Ga0495632_0017991
1147 Ga0495643_0000019
1148 Ga0495643_0079766
1149 Ga0495666_0000304
1150 Ga0495654_0092141
1151 Ga0495665_0042865
1152 Ga0495609_0000774
1153 Ga0495609_0011105
1154 Ga0495621_0023547
1155 Ga0495597_0001142
1156 Ga0495597_0001324
1157 Ga0495633_0007390
1158 Ga0495633_0017348
1159 Ga0495633_0047771
1160 Ga0495656_0003734
1161 Ga0495668_0002749
1162 Ga0495668_0006888
1163 Ga0495668_0007365
1164 Ga0495611_0005124
1165 Ga0495625_0009987
1166 Ga0495661_0012421
1167 Ga0495661_0160659
1168 Ga0495588_0000738
1169 Ga0495599_0017583
1170 Ga0495623_0071650
1171 Ga0495658_0027317
1172 Ga0495658_0038141
1173 Ga0495669_0000457
1174 Ga0495670_0044048
1175 Ga0495671_0019697
1176 Ga0495671_0052407
1177 Ga0495671_0088770
1178 Ga0495589_0014193
1179 Ga0495660_0085296
1180 Ga0495581_0073713
1181 Ga0495604_0000217
1182 Ga0495604_0034176
1183 Ga0495636_0022712
1184 Ga0495674_0024158
1185 Ga0495676_0007422
1186 Ga0495687_000088
1187 Ga0495675_0045177
1188 Ga0495685_015806
1189 Ga0495681_0007224
1190 Ga0495686_0045107
1191 Ga0495686_0116773
1192 Ga0495602_0146940
1193 Ga0495602_0209775
1194 Ga0495615_0002368
1195 Ga0495615_0012211
1196 Ga0496100_0068457
1197 Ga0496101_0134058
1198 Ga0496102_0019796
1199 Ga0496102_0036013
1200 Ga0496102_0339008
1201 Ga0496104_0003494
1202 Ga0496104_0024889
1203 Ga0496104_0032875
1204 Ga0496105_0001303
1205 Ga0496108_0002007
1206 Ga0496108_0253004
1207 Ga0496109_0005264
1208 Ga0496110_0018031
1209 Ga0496110_0063217
1210 Ga0496110_0078107
1211 Ga0496111_0012102
1212 Ga0496112_0020625
1213 Ga0496112_0078711
1214 Ga0496112_0095315
1215 Ga0496112_0118720
1216 Ga0496112_0231596
1217 Ga0496113_0000822
1218 Ga0496113_0128734
1219 Ga0496114_0001735
1220 Ga0496114_0269482
1221 Ga0496115_0036684
1222 Ga0496116_0009863
1223 Ga0496116_0064990
1224 Ga0496117_0003650
1225 Ga0496117_0011109
1226 Ga0496118_0005735
1227 Ga0496118_0107692
1228 Ga0496119_0012959
1229 Ga0496119_0059160
1230 Ga0496120_0062689
1231 Ga0496121_0000130
1232 Ga0496121_0003287
1233 Ga0496121_0010155
1234 Ga0496121_0015854
1235 Ga0496121_0054278
1236 Ga0496122_0000497
1237 Ga0496122_0001804
1238 Ga0496122_0017319
1239 Ga0496123_0001884
1240 Ga0496123_0003744
1241 Ga0496123_0013777
1242 Ga0496123_0047399
1243 Ga0496124_0004245
1244 Ga0496124_0043872
1245 Ga0496124_0054741
1246 Ga0496125_0000166
1247 Ga0496125_0016464
1248 Ga0496125_0041883
1249 Ga0496125_0136526
1250 Ga0496125_0141908
1251 Ga0496125_0189022
1252 Ga0496126_0000090
1253 Ga0496126_0001188
1254 Ga0496126_0032209
1255 Ga0496126_0032887
1256 Ga0495678_005337
1257 Ga0495678_018010
1258 Ga0501032_0093152
1259 Ga0501033_0037756
1260 Ga0501034_0000022
1261 Ga0501034_0000874
1262 Ga0501034_0001048
1263 Ga0501034_0128127
1264 Ga0501034_0163474
1265 Ga0501036_0044073
1266 Ga0501037_0007425
1267 Ga0501047_0001179
1268 Ga0501047_0003160
1269 Ga0501047_0093778
1270 Ga0501072_0109871
1271 Ga0501073_0000068
1272 Ga0501077_0000056
1273 Ga0501227_000555
1274 Ga0501233_007858
1275 Ga0501238_002816
1276 Ga0501225_0005596
1277 Ga0501080_0216113
1278 Ga0501035_0060943
1279 Ga0501035_0116678
1280 Ga0501044_0008276
1281 Ga0501044_0010514
1282 Ga0501044_0087580
1283 Ga0501044_0180316
1284 Ga0501044_0487690
1285 nmdc:mga03683_38552_c1
1286 nmdc:mga03683_591_c1
1287 nmdc:mga03n38_20105_c1
1288 nmdc:mga00v17_139488_c1
1289 nmdc:mga0k408_161729_c1
1290 nmdc:mga0k408_353_c1
1291 nmdc:mga0k408_72272_c1
1292 nmdc:mga06z11_231_c1
1293 nmdc:mga04h51_485_c1
1294 nmdc:mga07m45_116560_c1
1295 nmdc:mga07m45_263_c1
1296 nmdc:mga07m45_2_c1
1297 nmdc:mga07m45_57039_c1
1298 nmdc:mga07m45_88_c1
1299 nmdc:mga05p37_360043_c1
1300 nmdc:mga08y16_177547_c1
1301 nmdc:mga08y16_46_c1
1302 nmdc:mga0n895_25306_c1
1303 nmdc:mga08x19_69278_c1
1304 nmdc:mga0sz30_1776_c1
1305 Ga0500643_006677
1306 Ga0500643_010806
1307 Ga0500643_036052
1308 Ga0500644_0008259
1309 Ga0500646_0010306
1310 Ga0500651_0002923
1311 Ga0500566_0037686
1312 Ga0500641_0004583
1313 Ga0500556_0049884
1314 Ga0500569_002802
1315 Ga0500572_002675
1316 Ga0500592_000770
1317 Ga0500594_0002724
1318 Ga0500594_0067983
1319 Ga0500608_000265
1320 Ga0500614_000567
1321 Ga0500618_000833
1322 Ga0500618_004394
1323 Ga0500618_006225
1324 Ga0500642_0000278
1325 Ga0500652_003604
1326 Ga0500655_000670
1327 Ga0500658_0000047
1328 Ga0500559_0000442
1329 Ga0500559_0002100
1330 Ga0500559_0005405
1331 Ga0500568_0002510
1332 Ga0500577_0004311
1333 Ga0500577_0007102
1334 Ga0500577_0102201
1335 Ga0500588_0000198
1336 Ga0500590_021126
1337 Ga0500604_0000031
1338 Ga0500604_0050890
1339 Ga0500616_0000108
1340 Ga0500616_0001465
1341 Ga0500616_0001953
1342 Ga0500616_0002610
1343 Ga0500616_0002923
1344 Ga0500619_038130
1345 Ga0500622_0000937
1346 Ga0500622_0006169
1347 Ga0500624_000072
1348 Ga0500624_000210
1349 Ga0500627_0000297
1350 Ga0500639_005154
1351 Ga0500636_0000144
1352 Ga0500636_0005061
1353 Ga0500636_0120981
1354 Ga0500567_007296
1355 Ga0500570_000059
1356 Ga0500611_001425
1357 Ga0500625_000003
1358 Ga0500645_004201
1359 Ga0500645_005487
1360 Ga0500656_003807
1361 Ga0500587_005434
1362 Ga0501082_0001742
1363 Ga0466962_0022700
1364 2508678058
1365 2513954612
1366 2514043503
1367 2535487023
1368 2558911688
1369 2597031435
1370 2599445216
1371 2599904135
1372 2643861332
1373 2643983119
1374 2644120538
1375 2676202151
1376 2739651477
1377 2740029950
1378 2753357145
1379 2758639429
1380 2792833517
1381 2809032890
1382 2816506841
1383 2819694293
1384 2828307547
1385 2834643682
1386 2855733015
1387 2855771767
1388 2856318166
1389 2857537824
1390 2858956241
1391 2881415823
1392 2885270335
1393 2885320801
1394 2891636798
1395 2900580497
1396 2901311801
1397 2906418203
1398 2915654387
1399 2928063790
1400 2941482888
1401 2961175848
1402 2970508513
1403 2979811838
1404 2989352632
1405 2989781214
1406 644752294
1407 8003405068
1408 8048749669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

278

427

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

54

166

0.98

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

170

265

0.93

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

293

416

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lnx-assembly2.cif.gz_E crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9647 10 383
5lnx-assembly1.cif.gz_B crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9634 7 383
5lnx-assembly1.cif.gz_C crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9627 12 383
2vig-assembly1.cif.gz_B crystal structure of human short-chain acyl coa dehydrogenase 0.9604 4 384
5lnx-assembly2.cif.gz_H crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.96 4 383
ID Description Score Start End Superfamily
3pfdC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9795 231 382 1.20.140.10
af_Q9D7B6_155_263_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9736 121 230 2.40.110.10
3pfdB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.972 231 382 1.20.140.10
af_M0RAD8_170_241_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9704 119 185 2.40.110.10
af_P9WQG1_243_389_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9689 235 384 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2N3CQG8-F1-model_v4 Acyl-CoA dehydrogenase 0.9782 2 308 GO:0003995
GO:0050660
AF-A0A176QGM5-F1-model_v4 Acyl-CoA dehydrogenase 0.9745 3 384 GO:0003995
GO:0050660
AF-A0A437CAG7-F1-model_v4 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.5) (2-methyl branched chain acyl-CoA dehydrogenase) (2-methylbutyryl-coenzyme A dehydrogenase) 0.9727 118 289 GO:0003995
GO:0005739
GO:0006631
AF-A0A2N0QJJ7-F1-model_v4 Acyl-CoA dehydrogenase NM domain-like protein 0.972 63 306 GO:0003995
GO:0050660
AF-A0A528IP61-F1-model_v4 Acyl-CoA dehydrogenase 0.9715 63 359 GO:0003995
GO:0050660

Map