F476352

General Info

Members Datasets Scaffolds Average Seq Length
704 382 1404 723

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10041775|Ga0157375_100417753
Length 777
Sequence MKKDRAMQTPSSSISSDLPPLPELDGIDAVAPAQFQPKARAVSRRRFLGGTVAAGGLVVAFNVPFPQRAVAQGMGGAATPASATGXXXXASVRPDEMNCWVVIQPDETVIIRVARSEMGQGTLTGLAQLVAEELECDWAKASTEYPTPGQNLARNRIWGSFSTGGSRGVRESHDYVRKGGATARVMLVQAAADGWKVPAGECAVAKGVITHKPSGRTTTYGKVCEAAAKLTPPTDVALKDPKDWKIAGQRVARLDTAAKVDGSQVYGMDLKLPEMLNAAIKACPVFGGKVKRFDAAAVASRPGVKKVVPVGDYAVAVVADTWWRAKTALDALPIEWDFGPSAAVSSATIAATLKAGLDASDAIVGSQAGDARQALATAVRKVEAVYSYPYQNHATMEVMNATARWTPERCEVWAPTQNGEAALAATAEASGLPTAKCDVHKLNLGGGFGRRGQHDWLGQAVTIARQMPGTPVKLIWSREEDMTHGRYHPITQCKMTAGLDADGNVTALHMRISGQSIVAGVFPQNLQNGKDPVVFQGLNAGGAEGAFGYAVSNLLIDHAMRNPHVPPGFWRGVNLNHNAIYVESFIDEVAQATKQDPLALRRKLLAQSPKHLAVLNAVAARIGWDKPAPAGVGRGLAQIMGFGSYVAACAEVSVADDGTLKILRIVAATDPGHAVNPQQIEAQVEGSFAYGLSAALYGACTVKDGRIEQDNFSTYPALLMAQMPKVETIVMPSGGFWGGVGEPTIAVAAPAVLNAIFALTGKRIRDLPLKDHSLKKA

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
210 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
211 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
326 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
327 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
328 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
331 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
336 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 2508501050 Microvirga lupini Lut6 Isolate Nodule
341 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
342 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
343 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
344 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
345 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
346 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
347 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
348 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
349 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
350 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
351 2643221638 Duganella sp. Root336D2 Isolate Unclassified
352 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
353 2643221645 Massilia sp. Root351 Isolate Unclassified
354 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
355 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
356 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
357 2643221664 Massilia sp. Root418 Isolate Unclassified
358 2738541280 Massilia sp. GV090 Isolate Unclassified
359 2738541297 Duganella sp. GV083 Isolate Unclassified
360 2738541300 Massilia sp. GV016 Isolate Unclassified
361 2738541337 Pelomonas sp. BT06 Isolate Unclassified
362 2738541357 Duganella sp. GV053 Isolate Unclassified
363 2738543003 Duganella sp. GV066 Isolate Unclassified
364 2738543018 Massilia sp. GV045 Isolate Unclassified
365 2738543026 Duganella sp. GV089 Isolate Unclassified
366 2738543029 Duganella sp. GV039 Isolate Unclassified
367 2738543030 Massilia sp. GV097 Isolate Unclassified
368 2821131069 Duganella sp. 1224 Isolate Unclassified
369 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
370 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
371 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
372 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
373 2842711865 Duganella sp. R-73148 Isolate Unclassified
374 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
375 2857558681 Duganella sp. R-74565 Isolate Unclassified
376 2857564685 Duganella sp. R-74599 Isolate Unclassified
377 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
378 2904424332 Duganella sp. 1411 Isolate Rhizosphere
379 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
380 641522639 Methylobacterium sp. 4-46 Isolate Nodule
381 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
382 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.89
Metatranscriptomes 0
Isolates 6.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 1.42
Rhizoplane 7.81
Rhizosphere 67.05
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10041775 3300013308 Bacteria 4431
2 JGI25155J39150_1000095 3300002704 Bacteria 49917
3 JGI25156J39149_1000025 3300002705 Bacteria 136287
4 JGI25154J39366_1000045 3300002738 Bacteria 136302
5 JGI25157J39369_1000034 3300002741 Bacteria 136301
6 JGI25152J39213_1005951 3300002773 Bacteria 3430
7 JGI25151J46595_10000268 3300003187 Bacteria 59703
8 JGI25406J46586_10000546 3300003203 Bacteria 17656
9 JGI25153J46596_10000420 3300003215 Bacteria 27768
10 JGI25153J46596_10001641 3300003215 Bacteria 13278
11 JGI25153J46596_10005265 3300003215 Bacteria 6801
12 JGI25160J50197_1000885 3300003354 Bacteria 15764
13 Ga0055529_1000274 3300003763 Bacteria 61422
14 Ga0055526_1000076 3300003771 Bacteria 92438
15 Ga0055526_1000321 3300003771 Bacteria 39789
16 Ga0055526_1001433 3300003771 Bacteria 16981
17 Ga0055526_1002957 3300003771 Bacteria 11137
18 Ga0055526_1005175 3300003771 Bacteria 7583
19 Ga0055526_1005582 3300003771 Bacteria 7175
20 Ga0055537_1000119 3300003773 Bacteria 59684
21 Ga0055524_1000124 3300003775 Bacteria 90282
22 Ga0055534_1000047 3300003784 Bacteria 94932
23 Ga0055528_1000049 3300003790 Bacteria 94814
24 Ga0055528_1000272 3300003790 Bacteria 43798
25 Ga0055530_10001546 3300003791 Bacteria 16531
26 Ga0055531_10000208 3300003794 Bacteria 64490
27 Ga0055531_10000652 3300003794 Bacteria 29887
28 Ga0055543_1000185 3300004625 Bacteria 50666
29 Ga0065165_1000697 3300005262 Bacteria 48010
30 Ga0065165_1001958 3300005262 Bacteria 19506
31 Ga0070683_100089573 3300005329 Bacteria 2888
32 Ga0070690_100022077 3300005330 Bacteria 3891
33 Ga0070670_100004770 3300005331 Bacteria 11385
34 Ga0070670_100039501 3300005331 Bacteria 4058
35 Ga0070677_10000927 3300005333 Bacteria 9568
36 Ga0070677_10008859 3300005333 Bacteria 3398
37 Ga0070666_10021947 3300005335 Bacteria 4142
38 Ga0070666_10029729 3300005335 Bacteria 3595
39 Ga0070666_10060281 3300005335 Bacteria 2568
40 Ga0068868_100044181 3300005338 Bacteria 3483
41 Ga0070689_100035553 3300005340 Bacteria 3807
42 Ga0070691_10011103 3300005341 Bacteria 4110
43 Ga0070668_100017054 3300005347 Bacteria 5434
44 Ga0070668_100034715 3300005347 Bacteria 3844
45 Ga0070668_100036523 3300005347 Bacteria 3750
46 Ga0070675_100000635 3300005354 Bacteria 24215
47 Ga0070675_100001909 3300005354 Bacteria 15395
48 Ga0070675_100033898 3300005354 Bacteria 4141
49 Ga0070671_100003673 3300005355 Bacteria 12028
50 Ga0070671_100007952 3300005355 Bacteria 8482
51 Ga0070674_100003116 3300005356 Bacteria 9233
52 Ga0070674_100004623 3300005356 Bacteria 7864
53 Ga0070674_100005603 3300005356 Bacteria 7271
54 Ga0070673_100002713 3300005364 Bacteria 10854
55 Ga0070673_100026580 3300005364 Bacteria 4277
56 Ga0070667_100001934 3300005367 Bacteria 18379
57 Ga0070667_100008322 3300005367 Bacteria 8597
58 Ga0070667_100018352 3300005367 Bacteria 5801
59 Ga0070709_10002197 3300005434 Bacteria 10578
60 Ga0070709_10021867 3300005434 Bacteria 3732
61 Ga0070714_100022253 3300005435 Bacteria 5195
62 Ga0070714_100044739 3300005435 Bacteria 3748
63 Ga0070714_100046588 3300005435 Bacteria 3679
64 Ga0070713_100001144 3300005436 Bacteria 16996
65 Ga0070710_10000678 3300005437 Bacteria 16149
66 Ga0070710_10006908 3300005437 Bacteria 5474
67 Ga0070710_10011481 3300005437 Bacteria 4375
68 Ga0070711_100000465 3300005439 Bacteria 21200
69 Ga0070700_100043211 3300005441 Bacteria 2771
70 Ga0070663_100008226 3300005455 Bacteria 6407
71 Ga0070681_10019125 3300005458 Bacteria 6854
72 Ga0070681_10035333 3300005458 Bacteria 5020
73 Ga0070685_10015424 3300005466 Bacteria 4060
74 Ga0070707_100071057 3300005468 Bacteria 3353
75 Ga0070707_100106258 3300005468 Bacteria 2722
76 Ga0070707_100125036 3300005468 Bacteria 2498
77 Ga0070698_100003370 3300005471 Bacteria 17580
78 Ga0070698_100009043 3300005471 Bacteria 10708
79 Ga0070699_100006674 3300005518 Bacteria 10036
80 Ga0070699_100012326 3300005518 Bacteria 7375
81 Ga0070697_100003641 3300005536 Bacteria 11838
82 Ga0070697_100018598 3300005536 Bacteria 5479
83 Ga0070672_100000188 3300005543 Bacteria 34174
84 Ga0070672_100002376 3300005543 Bacteria 11911
85 Ga0070672_100017911 3300005543 Bacteria 5108
86 Ga0070695_100021413 3300005545 Bacteria 3956
87 Ga0070665_100002312 3300005548 Bacteria 21154
88 Ga0070665_100015938 3300005548 Bacteria 7543
89 Ga0070664_100012364 3300005564 Bacteria 6937
90 Ga0070664_100091274 3300005564 Bacteria 2636
91 Ga0068856_100037803 3300005614 Bacteria 4737
92 Ga0068859_100007034 3300005617 Bacteria 11425
93 Ga0068859_100024206 3300005617 Bacteria 6093
94 Ga0068859_100060887 3300005617 Bacteria 3803
95 Ga0068859_100071289 3300005617 Bacteria 3511
96 Ga0068864_100026836 3300005618 Bacteria 4858
97 Ga0068864_100090086 3300005618 Bacteria 2704
98 Ga0068861_100015089 3300005719 Bacteria 5437
99 Ga0068851_10013223 3300005834 Bacteria 3906
100 Ga0068863_100005464 3300005841 Bacteria 12512
101 Ga0068863_100011707 3300005841 Bacteria 8483
102 Ga0068863_100051584 3300005841 Bacteria 3898
103 Ga0068858_100001491 3300005842 Bacteria 24120
104 Ga0068858_100010923 3300005842 Bacteria 8581
105 Ga0068858_100019290 3300005842 Bacteria 6376
106 Ga0068858_100103817 3300005842 Bacteria 2652
107 Ga0068860_100057676 3300005843 Bacteria 3691
108 Ga0081455_10002982 3300005937 Bacteria 19755
109 Ga0081455_10017845 3300005937 Bacteria 6785
110 Ga0081455_10032865 3300005937 Bacteria 4669
111 Ga0081540_1000087 3300005983 Bacteria 99227
112 Ga0081540_1003808 3300005983 Bacteria 11799
113 Ga0081540_1016339 3300005983 Bacteria 4648
114 Ga0081539_10000169 3300005985 Bacteria 153327
115 Ga0081539_10004360 3300005985 Bacteria 15771
116 Ga0070717_10007544 3300006028 Bacteria 8083
117 Ga0075365_10047372 3300006038 Bacteria 2825
118 Ga0075365_10055411 3300006038 Bacteria 2631
119 Ga0075368_10002094 3300006042 Bacteria 6447
120 Ga0075368_10007021 3300006042 Bacteria 3964
121 Ga0075364_10022463 3300006051 Bacteria 3984
122 Ga0070712_100010931 3300006175 Bacteria 5741
123 Ga0075367_10002518 3300006178 Bacteria 8401
124 Ga0075366_10016273 3300006195 Bacteria 4273
125 Ga0097621_100007904 3300006237 Bacteria 7628
126 Ga0097621_100020508 3300006237 Bacteria 5093
127 Ga0097621_100021085 3300006237 Bacteria 5032
128 Ga0068871_100022548 3300006358 Bacteria 4857
129 Ga0075428_100001776 3300006844 Bacteria 23025
130 Ga0075428_100005277 3300006844 Bacteria 14368
131 Ga0075428_100011557 3300006844 Bacteria 9821
132 Ga0075428_100023456 3300006844 Bacteria 6828
133 Ga0075428_100040747 3300006844 Bacteria 5109
134 Ga0075430_100004621 3300006846 Bacteria 11585
135 Ga0075431_100013919 3300006847 Bacteria 8124
136 Ga0075433_10011531 3300006852 Bacteria 7118
137 Ga0075429_100050693 3300006880 Bacteria 3612
138 Ga0097620_100007034 3300006931 Bacteria 11425
139 Ga0097620_100024206 3300006931 Bacteria 6093
140 Ga0097620_100060892 3300006931 Bacteria 3803
141 Ga0097620_100071289 3300006931 Bacteria 3511
142 Ga0099826_10000048 3300006948 Bacteria 74895
143 Ga0075435_100019988 3300007076 Bacteria 5120
144 Ga0099794_10010289 3300007265 Bacteria 3965
145 Ga0099795_10003512 3300007788 Bacteria 3892
146 Ga0105244_10000185 3300009036 Bacteria 63288
147 Ga0105244_10002531 3300009036 Bacteria 13730
148 Ga0111539_10045558 3300009094 Bacteria 5250
149 Ga0111539_10046004 3300009094 Bacteria 5222
150 Ga0111539_10087616 3300009094 Bacteria 3657
151 Ga0114129_10002963 3300009147 Bacteria 23761
152 Ga0114129_10004155 3300009147 Bacteria 20467
153 Ga0114129_10006327 3300009147 Bacteria 16791
154 Ga0114129_10012532 3300009147 Bacteria 12074
155 Ga0114129_10032785 3300009147 Bacteria 7340
156 Ga0105241_10068988 3300009174 Bacteria 2741
157 Ga0105248_10008356 3300009177 Bacteria 11372
158 Ga0105248_10014905 3300009177 Bacteria 8560
159 Ga0105248_10033668 3300009177 Bacteria 5725
160 Ga0105237_10011557 3300009545 Bacteria 9337
161 Ga0105237_10037515 3300009545 Bacteria 4898
162 Ga0099796_10001906 3300010159 Bacteria 4414
163 Ga0105239_10055801 3300010375 Bacteria 4333
164 Ga0105239_10056616 3300010375 Bacteria 4300
165 Ga0157370_10017206 3300013104 Bacteria 7297
166 Ga0157369_10005990 3300013105 Bacteria 14124
167 Ga0157374_10028336 3300013296 Bacteria 5060
168 Ga0157378_10008668 3300013297 Bacteria 8850
169 Ga0157372_10020991 3300013307 Bacteria 7052
170 Ga0157372_10112337 3300013307 Bacteria 3122
171 Ga0157375_10004650 3300013308 Bacteria 11933
172 Ga0157375_10011267 3300013308 Bacteria 7892
173 Ga0157375_10034265 3300013308 Bacteria 4836
174 Ga0163163_10003401 3300014325 Bacteria 13512
175 Ga0182008_10020587 3300014497 Bacteria 3395
176 Ga0157379_10050739 3300014968 Bacteria 3704
177 Ga0157376_10008920 3300014969 Bacteria 7261
178 Ga0157376_10026276 3300014969 Bacteria 4598
179 Ga0157376_10029501 3300014969 Bacteria 4369
180 Ga0163161_10020611 3300017792 Bacteria 4629
181 Ga0213872_10000136 3300021361 Bacteria 66682
182 Ga0213872_10000981 3300021361 Bacteria 19948
183 Ga0213876_10004148 3300021384 Bacteria 8131
184 Ga0213876_10029472 3300021384 Bacteria 2892
185 Ga0209435_100001 3300025206 Bacteria 1424171
186 Ga0209436_100510 3300025208 Bacteria 16995
187 Ga0207425_1000093 3300025245 Bacteria 87038
188 Ga0207425_1000216 3300025245 Bacteria 45716
189 Ga0207425_1000221 3300025245 Bacteria 44837
190 Ga0209646_1000001 3300025246 Bacteria 3092932
191 Ga0209026_1000003 3300025250 Bacteria 1060571
192 Ga0209677_102245 3300025253 Bacteria 7486
193 Ga0209759_1000001 3300025256 Bacteria 2799452
194 Ga0209129_1000012 3300025258 Bacteria 541516
195 Ga0209129_1000344 3300025258 Bacteria 39975
196 Ga0209565_1000112 3300025263 Bacteria 117209
197 Ga0209565_1001307 3300025263 Bacteria 11476
198 Ga0209565_1005330 3300025263 Bacteria 3753
199 Ga0209455_1000253 3300025272 Bacteria 62650
200 Ga0209673_1000210 3300025273 Bacteria 117276
201 Ga0209130_1000369 3300025284 Bacteria 51132
202 Ga0209130_1000395 3300025284 Bacteria 47652
203 Ga0209130_1001834 3300025284 Bacteria 12255
204 Ga0209675_1000142 3300025291 Bacteria 95327
205 Ga0209675_1004692 3300025291 Bacteria 5993
206 Ga0209025_1000146 3300025294 Bacteria 180022
207 Ga0209025_1004048 3300025294 Bacteria 13113
208 Ga0209564_1000022 3300025295 Bacteria 555109
209 Ga0209564_1000042 3300025295 Bacteria 392805
210 Ga0209564_1000245 3300025295 Bacteria 117378
211 Ga0209564_1000448 3300025295 Bacteria 70600
212 Ga0209758_1000124 3300025297 Bacteria 189933
213 Ga0209758_1000659 3300025297 Bacteria 51717
214 Ga0209758_1000707 3300025297 Bacteria 49499
215 Ga0209758_1007515 3300025297 Bacteria 7386
216 Ga0209050_1000086 3300025298 Bacteria 262009
217 Ga0209050_1000211 3300025298 Bacteria 129614
218 Ga0209050_1000282 3300025298 Bacteria 108629
219 Ga0209050_1001245 3300025298 Bacteria 29453
220 Ga0209256_1000252 3300025299 Bacteria 94936
221 Ga0209256_1000268 3300025299 Bacteria 91897
222 Ga0209256_1002063 3300025299 Bacteria 17738
223 Ga0207426_1001536 3300025302 Bacteria 18776
224 Ga0209257_1000017 3300025304 Bacteria 866287
225 Ga0209257_1000087 3300025304 Bacteria 282503
226 Ga0209257_1001799 3300025304 Bacteria 23534
227 Ga0207697_10018836 3300025315 Bacteria 2829
228 Ga0207655_1004090 3300025728 Bacteria 10499
229 Ga0207655_1018636 3300025728 Bacteria 3668
230 Ga0207682_10002266 3300025893 Bacteria 8674
231 Ga0207692_10000797 3300025898 Bacteria 11223
232 Ga0207692_10000975 3300025898 Bacteria 10411
233 Ga0207642_10006235 3300025899 Bacteria 3953
234 Ga0207688_10000311 3300025901 Bacteria 22428
235 Ga0207680_10012276 3300025903 Bacteria 4359
236 Ga0207680_10037647 3300025903 Bacteria 2794
237 Ga0207699_10001610 3300025906 Bacteria 10719
238 Ga0207699_10001791 3300025906 Bacteria 10087
239 Ga0207645_10002792 3300025907 Bacteria 13590
240 Ga0207645_10026450 3300025907 Bacteria 3750
241 Ga0207645_10032166 3300025907 Bacteria 3372
242 Ga0207643_10001497 3300025908 Bacteria 13381
243 Ga0207684_10009441 3300025910 Bacteria 8614
244 Ga0207684_10012679 3300025910 Bacteria 7319
245 Ga0207684_10022391 3300025910 Bacteria 5392
246 Ga0207684_10038223 3300025910 Bacteria 4073
247 Ga0207693_10002637 3300025915 Bacteria 15580
248 Ga0207693_10018020 3300025915 Bacteria 5628
249 Ga0207657_10010638 3300025919 Bacteria 9164
250 Ga0207657_10035050 3300025919 Bacteria 4505
251 Ga0207646_10003246 3300025922 Bacteria 18533
252 Ga0207646_10019157 3300025922 Bacteria 6364
253 Ga0207681_10011447 3300025923 Bacteria 5451
254 Ga0207681_10042552 3300025923 Bacteria 3035
255 Ga0207681_10048062 3300025923 Bacteria 2878
256 Ga0207650_10000878 3300025925 Bacteria 22741
257 Ga0207650_10035398 3300025925 Bacteria 3625
258 Ga0207650_10043598 3300025925 Bacteria 3294
259 Ga0207659_10000207 3300025926 Bacteria 35338
260 Ga0207659_10032550 3300025926 Bacteria 3580
261 Ga0207700_10001723 3300025928 Bacteria 12419
262 Ga0207700_10068480 3300025928 Bacteria 2721
263 Ga0207664_10022731 3300025929 Bacteria 4687
264 Ga0207644_10001228 3300025931 Bacteria 16510
265 Ga0207706_10003678 3300025933 Bacteria 14643
266 Ga0207669_10001590 3300025937 Bacteria 9667
267 Ga0207669_10002166 3300025937 Bacteria 8335
268 Ga0207669_10041019 3300025937 Bacteria 2690
269 Ga0207704_10024034 3300025938 Bacteria 3296
270 Ga0207704_10025515 3300025938 Bacteria 3226
271 Ga0207665_10001083 3300025939 Bacteria 18353
272 Ga0207665_10005000 3300025939 Bacteria 8848
273 Ga0207665_10036103 3300025939 Bacteria 3285
274 Ga0207691_10001187 3300025940 Bacteria 25907
275 Ga0207691_10005334 3300025940 Bacteria 12409
276 Ga0207691_10016733 3300025940 Bacteria 6962
277 Ga0207691_10016828 3300025940 Bacteria 6938
278 Ga0207691_10035831 3300025940 Bacteria 4601
279 Ga0207711_10005547 3300025941 Bacteria 10668
280 Ga0207711_10018280 3300025941 Bacteria 5826
281 Ga0207711_10044509 3300025941 Bacteria 3789
282 Ga0207689_10003137 3300025942 Bacteria 15170
283 Ga0207689_10004069 3300025942 Bacteria 13289
284 Ga0207651_10002333 3300025960 Bacteria 9046
285 Ga0207668_10036745 3300025972 Bacteria 3272
286 Ga0207658_10006941 3300025986 Bacteria 7710
287 Ga0207658_10010134 3300025986 Bacteria 6403
288 Ga0207658_10071822 3300025986 Bacteria 2622
289 Ga0207677_10001755 3300026023 Bacteria 11477
290 Ga0207703_10049410 3300026035 Bacteria 3400
291 Ga0207703_10049586 3300026035 Bacteria 3394
292 Ga0207639_10020891 3300026041 Bacteria 4696
293 Ga0207678_10003853 3300026067 Bacteria 13489
294 Ga0207678_10024057 3300026067 Bacteria 5322
295 Ga0207708_10000545 3300026075 Bacteria 29127
296 Ga0207708_10054475 3300026075 Bacteria 3049
297 Ga0207708_10070976 3300026075 Bacteria 2667
298 Ga0207641_10021918 3300026088 Bacteria 5252
299 Ga0207641_10024266 3300026088 Bacteria 4998
300 Ga0207648_10033846 3300026089 Bacteria 4506
301 Ga0207648_10039458 3300026089 Bacteria 4152
302 Ga0207648_10088536 3300026089 Bacteria 2703
303 Ga0207676_10002643 3300026095 Bacteria 12753
304 Ga0207674_10040578 3300026116 Bacteria 4820
305 Ga0207675_100002474 3300026118 Bacteria 18290
306 Ga0207675_100012299 3300026118 Bacteria 7996
307 Ga0207675_100064388 3300026118 Bacteria 3427
308 Ga0207675_100089090 3300026118 Bacteria 2899
309 Ga0207683_10003797 3300026121 Bacteria 13083
310 Ga0207683_10006943 3300026121 Bacteria 9698
311 Ga0207683_10014958 3300026121 Bacteria 6604
312 Ga0207683_10036493 3300026121 Bacteria 4281
313 Ga0207683_10037515 3300026121 Bacteria 4220
314 Ga0207698_10035367 3300026142 Bacteria 3653
315 Ga0209282_1000066 3300027666 Bacteria 87072
316 Ga0209588_1003015 3300027671 Bacteria 4638
317 Ga0207428_10026244 3300027907 Bacteria 4864
318 Ga0268266_10013765 3300028379 Bacteria 6965
319 Ga0268265_10105251 3300028380 Bacteria 2289
320 Ga0265334_10002832 3300028573 Bacteria 7983
321 Ga0307517_10003242 3300028786 Bacteria 25464
322 Ga0307515_10000109 3300028794 Bacteria 195895
323 Ga0307515_10000292 3300028794 Bacteria 123160
324 Ga0307515_10000458 3300028794 Bacteria 97523
325 Ga0307515_10000658 3300028794 Bacteria 79766
326 Ga0307515_10002868 3300028794 Bacteria 36682
327 Ga0307515_10014704 3300028794 Bacteria 14486
328 Ga0307515_10020398 3300028794 Bacteria 11827
329 Ga0307515_10036757 3300028794 Bacteria 7907
330 Ga0307515_10053861 3300028794 Bacteria 5921
331 Ga0307515_10090338 3300028794 Bacteria 3842
332 Ga0307512_10026131 3300030522 Bacteria 5159
333 Ga0265328_10002123 3300031239 Bacteria 8942
334 Ga0265325_10000599 3300031241 Bacteria 26290
335 Ga0265331_10002520 3300031250 Bacteria 12346
336 Ga0265327_10000083 3300031251 Bacteria 204923
337 Ga0307513_10001393 3300031456 Bacteria 34808
338 Ga0307513_10011471 3300031456 Bacteria 11012
339 Ga0307513_10018336 3300031456 Bacteria 8367
340 Ga0307408_100000106 3300031548 Bacteria 91438
341 Ga0307408_100000289 3300031548 Bacteria 49603
342 Ga0307408_100000326 3300031548 Bacteria 45638
343 Ga0307408_100034159 3300031548 Bacteria 3559
344 Ga0307508_10000028 3300031616 Bacteria 168639
345 Ga0307508_10000101 3300031616 Bacteria 100858
346 Ga0307508_10001494 3300031616 Bacteria 26240
347 Ga0307514_10000780 3300031649 Bacteria 52828
348 Ga0316575_10004668 3300031665 Bacteria 4828
349 Ga0316579_10019515 3300031691 Bacteria 2996
350 Ga0265314_10001728 3300031711 Bacteria 23687
351 Ga0265314_10005924 3300031711 Bacteria 10935
352 Ga0316576_10004331 3300031727 Bacteria 8491
353 Ga0316578_10000083 3300031728 Bacteria 21511
354 Ga0316578_10002722 3300031728 Bacteria 7862
355 Ga0307516_10001972 3300031730 Bacteria 28094
356 Ga0307405_10008817 3300031731 Bacteria 5137
357 Ga0316577_10000153 3300031733 Bacteria 21302
358 Ga0307412_10011314 3300031911 Bacteria 5163
359 Ga0307414_10031092 3300032004 Bacteria 3497
360 Ga0307411_10003909 3300032005 Bacteria 7027
361 Ga0307507_10092192 3300033179 Bacteria 2588
362 Ga0307510_10033557 3300033180 Bacteria 5762
363 Ga0373961_0007329 3300035241 Bacteria 2667
364 Ga0373931_0002012 3300035691 Bacteria 8952
365 Ga0373931_0002221 3300035691 Bacteria 8576
366 Ga0373931_0006248 3300035691 Bacteria 5557
367 Ga0373933_0001821 3300035724 Bacteria 12354
368 Ga0373933_0033832 3300035724 Bacteria 2976
369 Ga0316584_0000907 3300036712 Bacteria 16888
370 Ga0316584_0051937 3300036712 Bacteria 3066
371 Ga0373925_0007276 3300037068 Bacteria 8090
372 Ga0395900_0003092 3300037418 Bacteria 18074
373 Ga0395898_0009202 3300037466 Bacteria 10398
374 Ga0395905_0000557 3300037471 Bacteria 50828
375 Ga0395901_0001902 3300038443 Bacteria 21558
376 Ga0400487_37257 3300039110 Bacteria 4401
377 Ga0436365_0599131 3300039437 Bacteria 4176
378 Ga0436365_1236739 3300039437 Bacteria 30341
379 Ga0436365_1599502 3300039437 Bacteria 7471
380 Ga0436360_1240980 3300039438 Bacteria 3369
381 Ga0436361_0228609 3300039447 Bacteria 9906
382 Ga0436361_0324047 3300039447 Bacteria 25390
383 Ga0436361_0954756 3300039447 Bacteria 64588
384 Ga0436361_1158315 3300039447 Bacteria 8002
385 Ga0436363_0990368 3300039450 Bacteria 2562
386 Ga0436362_0387970 3300039453 Bacteria 2490
387 Ga0450890_000545 3300042127 Bacteria 5540
388 Ga0450889_000155 3300042144 Bacteria 7034
389 Ga0450916_000827 3300042530 Bacteria 2896
390 Ga0451577_0104917 3300042876 Bacteria 2526
391 Ga0466963_0001888 3300044694 Bacteria 11439
392 Ga0451576_0152174 3300045051 Bacteria 2413
393 Ga0466967_0004857 3300045976 Bacteria 9176
394 Ga0466967_0029604 3300045976 Bacteria 4585
395 Ga0466967_0080935 3300045976 Bacteria 2933
396 Ga0495617_002348 3300046452 Bacteria 7579
397 Ga0495617_012011 3300046452 Bacteria 2953
398 Ga0495592_0001923 3300046454 Bacteria 14629
399 Ga0495590_0000056 3300046457 Bacteria 96913
400 Ga0495638_0000170 3300046460 Bacteria 101629
401 Ga0495638_0006602 3300046460 Bacteria 8430
402 Ga0495638_0040175 3300046460 Bacteria 2965
403 Ga0495653_0000066 3300046463 Bacteria 91671
404 Ga0495650_0000528 3300046471 Bacteria 55706
405 Ga0495650_0000553 3300046471 Bacteria 53302
406 Ga0495650_0000571 3300046471 Bacteria 51694
407 Ga0495650_0000878 3300046471 Bacteria 35618
408 Ga0495650_0001888 3300046471 Bacteria 18636
409 Ga0495650_0008315 3300046471 Bacteria 6075
410 Ga0495650_0014486 3300046471 Bacteria 4099
411 Ga0495580_0002475 3300046472 Bacteria 16114
412 Ga0495582_0019145 3300046473 Bacteria 3746
413 Ga0495605_0000315 3300046474 Bacteria 50714
414 Ga0495664_0009952 3300046477 Bacteria 5333
415 Ga0495584_0000365 3300046491 Bacteria 31489
416 Ga0495584_0001822 3300046491 Bacteria 12380
417 Ga0495585_0000070 3300046492 Bacteria 106156
418 Ga0495585_0000646 3300046492 Bacteria 32025
419 Ga0495585_0039423 3300046492 Bacteria 2655
420 Ga0495607_0000906 3300046501 Bacteria 27598
421 Ga0495607_0001697 3300046501 Bacteria 18946
422 Ga0495607_0014081 3300046501 Bacteria 5220
423 Ga0495607_0022969 3300046501 Bacteria 3909
424 Ga0495583_0000417 3300046506 Bacteria 64786
425 Ga0495583_0001330 3300046506 Bacteria 25663
426 Ga0495606_0000063 3300046507 Bacteria 184610
427 Ga0495606_0000431 3300046507 Bacteria 69714
428 Ga0495606_0001347 3300046507 Bacteria 33360
429 Ga0495606_0001680 3300046507 Bacteria 28578
430 Ga0495606_0003374 3300046507 Bacteria 16993
431 Ga0495606_0004107 3300046507 Bacteria 14789
432 Ga0495606_0008520 3300046507 Bacteria 8892
433 Ga0495610_0000014 3300046512 Bacteria 444708
434 Ga0495610_0000353 3300046512 Bacteria 48216
435 Ga0495610_0001670 3300046512 Bacteria 19517
436 Ga0495610_0005618 3300046512 Bacteria 8852
437 Ga0495616_0001267 3300046513 Bacteria 17758
438 Ga0495616_0011359 3300046513 Bacteria 5108
439 Ga0495618_0014079 3300046514 Bacteria 4869
440 Ga0495630_0000460 3300046517 Bacteria 30750
441 Ga0495632_0004456 3300046519 Bacteria 9514
442 Ga0495637_0006039 3300046520 Bacteria 6115
443 Ga0495643_0000246 3300046522 Bacteria 80483
444 Ga0495643_0000302 3300046522 Bacteria 68932
445 Ga0495644_0000451 3300046523 Bacteria 18007
446 Ga0495644_0000622 3300046523 Bacteria 14853
447 Ga0495648_0000119 3300046524 Bacteria 95682
448 Ga0495648_0000486 3300046524 Bacteria 42701
449 Ga0495648_0003471 3300046524 Bacteria 13857
450 Ga0495648_0013106 3300046524 Bacteria 6146
451 Ga0495666_0009013 3300046526 Bacteria 4990
452 Ga0495642_0001364 3300046528 Bacteria 10919
453 Ga0495642_0017073 3300046528 Bacteria 2834
454 Ga0495652_0049047 3300046529 Bacteria 3616
455 Ga0495654_0000014 3300046530 Bacteria 312126
456 Ga0495640_0002731 3300046533 Bacteria 14194
457 Ga0495609_0000190 3300046538 Bacteria 61573
458 Ga0495609_0000803 3300046538 Bacteria 23487
459 Ga0495609_0001962 3300046538 Bacteria 13050
460 Ga0495609_0014881 3300046538 Bacteria 3650
461 Ga0495597_0000069 3300046542 Bacteria 89990
462 Ga0495597_0000123 3300046542 Bacteria 70236
463 Ga0495597_0002767 3300046542 Bacteria 10803
464 Ga0495622_0000109 3300046557 Bacteria 71936
465 Ga0495622_0000246 3300046557 Bacteria 42141
466 Ga0495622_0023337 3300046557 Bacteria 2883
467 Ga0495622_0024474 3300046557 Bacteria 2820
468 Ga0495633_0000088 3300046558 Bacteria 124193
469 Ga0495633_0000131 3300046558 Bacteria 100408
470 Ga0495633_0005902 3300046558 Bacteria 7365
471 Ga0495633_0012055 3300046558 Bacteria 4618
472 Ga0495656_0019290 3300046615 Bacteria 2631
473 Ga0495668_0000152 3300046616 Bacteria 104716
474 Ga0495668_0000574 3300046616 Bacteria 45013
475 Ga0495668_0000636 3300046616 Bacteria 42184
476 Ga0495668_0002746 3300046616 Bacteria 14081
477 Ga0495668_0017181 3300046616 Bacteria 4201
478 Ga0495634_0028643 3300046642 Bacteria 3864
479 Ga0495634_0047918 3300046642 Bacteria 2878
480 Ga0495611_0004697 3300046648 Bacteria 5865
481 Ga0495611_0004729 3300046648 Bacteria 5847
482 Ga0495625_0000386 3300046660 Bacteria 67356
483 Ga0495625_0003039 3300046660 Bacteria 17201
484 Ga0495625_0003363 3300046660 Bacteria 16060
485 Ga0495625_0004123 3300046660 Bacteria 13868
486 Ga0495625_0010047 3300046660 Bacteria 7865
487 Ga0495625_0016848 3300046660 Bacteria 5738
488 Ga0495635_0009099 3300046663 Bacteria 6933
489 Ga0495659_0000026 3300046664 Bacteria 69038
490 Ga0495659_0000364 3300046664 Bacteria 17652
491 Ga0495661_0016859 3300046665 Bacteria 4828
492 Ga0495661_0048637 3300046665 Bacteria 2576
493 Ga0495588_0054014 3300046674 Unclassified 2072
494 Ga0495647_0010771 3300046681 Bacteria 3121
495 Ga0495624_0055963 3300046690 Bacteria 2483
496 Ga0495670_0009901 3300046691 Bacteria 4686
497 Ga0495670_0028373 3300046691 Bacteria 2774
498 Ga0495671_0000005 3300046692 Bacteria 509397
499 Ga0495671_0000144 3300046692 Bacteria 63224
500 Ga0495671_0003189 3300046692 Bacteria 10190
501 Ga0495671_0007388 3300046692 Bacteria 6270
502 Ga0495649_0000600 3300046694 Bacteria 30004
503 Ga0495649_0011122 3300046694 Bacteria 5296
504 Ga0495660_0000229 3300046810 Bacteria 55150
505 Ga0495660_0000962 3300046810 Bacteria 21017
506 Ga0495660_0007303 3300046810 Bacteria 6495
507 Ga0495636_0000861 3300047318 Bacteria 11216
508 Ga0495674_0007508 3300047319 Bacteria 10408
509 Ga0495672_0000232 3300047320 Bacteria 79561
510 Ga0495672_0000260 3300047320 Bacteria 73347
511 Ga0495672_0004556 3300047320 Bacteria 11276
512 Ga0495676_0014702 3300047321 Bacteria 6995
513 Ga0495683_0002158 3300047323 Bacteria 12082
514 Ga0495683_0003420 3300047323 Bacteria 9263
515 Ga0495687_000629 3300047443 Bacteria 40470
516 Ga0495687_003552 3300047443 Bacteria 11207
517 Ga0495687_003553 3300047443 Bacteria 11205
518 Ga0495677_0003543 3300047445 Bacteria 6056
519 Ga0495677_0013107 3300047445 Bacteria 3017
520 Ga0495685_000147 3300047447 Bacteria 24129
521 Ga0495685_014082 3300047447 Bacteria 2714
522 Ga0495673_0000009 3300047469 Bacteria 731993
523 Ga0495673_0000012 3300047469 Bacteria 656908
524 Ga0495673_0000146 3300047469 Bacteria 127378
525 Ga0495684_0011032 3300047471 Bacteria 6986
526 Ga0495684_0034406 3300047471 Bacteria 3887
527 Ga0495686_0003776 3300047472 Bacteria 12869
528 Ga0495686_0005943 3300047472 Bacteria 9496
529 Ga0496100_0008335 3300048903 Bacteria 5776
530 Ga0496101_0002908 3300048904 Bacteria 10544
531 Ga0496101_0012498 3300048904 Bacteria 5666
532 Ga0496101_0039071 3300048904 Bacteria 3373
533 Ga0496102_0000896 3300048905 Bacteria 28249
534 Ga0496102_0012019 3300048905 Bacteria 7479
535 Ga0496102_0012800 3300048905 Bacteria 7263
536 Ga0496102_0104339 3300048905 Bacteria 2636
537 Ga0496103_0001127 3300048906 Bacteria 18573
538 Ga0496103_0055292 3300048906 Bacteria 2461
539 Ga0496104_0001647 3300048907 Bacteria 19277
540 Ga0496104_0005692 3300048907 Bacteria 10907
541 Ga0496104_0006941 3300048907 Bacteria 9989
542 Ga0496104_0008908 3300048907 Bacteria 8917
543 Ga0496104_0018113 3300048907 Bacteria 6421
544 Ga0496104_0044535 3300048907 Bacteria 4169
545 Ga0496104_0074674 3300048907 Bacteria 3227
546 Ga0496105_0005783 3300048908 Bacteria 9429
547 Ga0496105_0017152 3300048908 Bacteria 5799
548 Ga0496105_0017542 3300048908 Bacteria 5742
549 Ga0496105_0022584 3300048908 Bacteria 5096
550 Ga0496105_0053005 3300048908 Bacteria 3350
551 Ga0496105_0071049 3300048908 Bacteria 2877
552 Ga0496106_0014751 3300048909 Bacteria 5777
553 Ga0496106_0033976 3300048909 Bacteria 3807
554 Ga0496106_0063824 3300048909 Bacteria 2800
555 Ga0496106_0094711 3300048909 Bacteria 2309
556 Ga0496107_0052655 3300048910 Bacteria 2936
557 Ga0496108_0002340 3300048911 Bacteria 15178
558 Ga0496108_0011172 3300048911 Bacteria 7294
559 Ga0496109_0001545 3300048912 Bacteria 19142
560 Ga0496109_0022061 3300048912 Bacteria 5636
561 Ga0496109_0027112 3300048912 Bacteria 5113
562 Ga0496110_0001147 3300048913 Bacteria 18763
563 Ga0496110_0021891 3300048913 Bacteria 5420
564 Ga0496110_0022376 3300048913 Bacteria 5367
565 Ga0496110_0048635 3300048913 Bacteria 3718
566 Ga0496110_0069247 3300048913 Bacteria 3125
567 Ga0496111_0015230 3300048914 Bacteria 5273
568 Ga0496111_0033256 3300048914 Bacteria 3676
569 Ga0496112_0000008 3300048915 Bacteria 310323
570 Ga0496112_0014407 3300048915 Bacteria 7332
571 Ga0496112_0040810 3300048915 Bacteria 4538
572 Ga0496113_0000257 3300048916 Bacteria 25061
573 Ga0496113_0027487 3300048916 Bacteria 4079
574 Ga0496114_0002985 3300048917 Bacteria 12975
575 Ga0496114_0042486 3300048917 Bacteria 3769
576 Ga0496114_0059128 3300048917 Bacteria 3202
577 Ga0496115_0000535 3300048918 Bacteria 29580
578 Ga0496115_0003236 3300048918 Bacteria 11694
579 Ga0496115_0028715 3300048918 Bacteria 4362
580 Ga0496115_0034877 3300048918 Bacteria 3977
581 Ga0496115_0035852 3300048918 Bacteria 3927
582 Ga0496115_0105893 3300048918 Bacteria 2308
583 Ga0496119_0001286 3300048922 Bacteria 31059
584 Ga0496121_0022719 3300048924 Bacteria 6070
585 Ga0496122_0003797 3300048925 Bacteria 19441
586 Ga0496123_0008256 3300048926 Bacteria 9601
587 Ga0496123_0025288 3300048926 Bacteria 4481
588 Ga0496124_0014652 3300048927 Bacteria 7569
589 Ga0496124_0107728 3300048927 Bacteria 2248
590 Ga0496125_0000746 3300048928 Bacteria 53671
591 Ga0496125_0038049 3300048928 Bacteria 4172
592 Ga0496126_0043656 3300048929 Bacteria 4133
593 Ga0495678_000278 3300049459 Bacteria 56511
594 Ga0495678_008142 3300049459 Bacteria 5335
595 Ga0495682_0000515 3300049460 Bacteria 26766
596 Ga0495682_0000614 3300049460 Bacteria 23998
597 Ga0501034_0001211 3300049571 Bacteria 35412
598 Ga0501034_0016043 3300049571 Bacteria 7687
599 Ga0501036_0031524 3300049572 Bacteria 4480
600 Ga0501072_0001047 3300049588 Bacteria 20473
601 Ga0501072_0003158 3300049588 Bacteria 12400
602 Ga0501073_0037597 3300049589 Bacteria 3435
603 Ga0501077_0042573 3300049593 Bacteria 2887
604 Ga0501229_000400 3300049706 Bacteria 4849
605 Ga0501079_0075878 3300049741 Bacteria 2600
606 Ga0501081_0030262 3300049743 Bacteria 3664
607 Ga0501081_0033192 3300049743 Bacteria 3506
608 Ga0501081_0056238 3300049743 Bacteria 2719
609 Ga0501083_0049010 3300049744 Bacteria 2849
610 nmdc:mga03n38_17743_c1 3300050490 Bacteria 2793
611 nmdc:mga0yw44_21784_c1 3300050492 Bacteria 3582
612 nmdc:mga0yw44_24359_c1 3300050492 Bacteria 3424
613 nmdc:mga0k408_396_c1 3300050493 Bacteria 23854
614 nmdc:mga05p37_24611_c1 3300050507 Bacteria 7319
615 nmdc:mga05p37_31849_c1 3300050507 Bacteria 6445
616 nmdc:mga05p37_3234_c1 3300050507 Bacteria 18974
617 nmdc:mga05p37_517_c1 3300050507 Bacteria 42690
618 nmdc:mga05p37_6051_c1 3300050507 Bacteria 14242
619 nmdc:mga09592_9105_c1 3300050508 Bacteria 8073
620 nmdc:mga0qj67_219_c1 3300050509 Bacteria 39116
621 nmdc:mga06r32_2713_c1 3300050510 Bacteria 15844
622 nmdc:mga06r32_47361_c1 3300050510 Bacteria 4106
623 nmdc:mga06r32_9139_c1 3300050510 Bacteria 8933
624 nmdc:mga06r32_93366_c1 3300050510 Bacteria 2943
625 nmdc:mga08y16_33510_c1 3300050511 Bacteria 5394
626 nmdc:mga08y16_76745_c1 3300050511 Bacteria 3483
627 nmdc:mga0n895_13353_c1 3300050512 Bacteria 7406
628 nmdc:mga0rr50_4990_c1 3300050513 Bacteria 7859
629 nmdc:mga0rr50_8180_c1 3300050513 Bacteria 6494
630 nmdc:mga0a205_2701_c1 3300050515 Bacteria 15678
631 Ga0495601_0023183 3300053077 Bacteria 3813
632 Ga0495612_0004983 3300053078 Bacteria 5496
633 Ga0495619_0006266 3300053085 Bacteria 7544
634 Ga0495619_0026413 3300053085 Bacteria 3735
635 Ga0500578_0001060 3300053086 Bacteria 29908
636 Ga0500641_0009515 3300053096 Bacteria 3495
637 Ga0500556_0000073 3300053104 Bacteria 99145
638 Ga0500572_000025 3300053111 Bacteria 45953
639 Ga0500618_001265 3300053125 Bacteria 11758
640 Ga0500642_0030780 3300053130 Bacteria 2236
641 Ga0500559_0000694 3300053136 Bacteria 22155
642 Ga0500559_0002387 3300053136 Bacteria 9758
643 Ga0500586_000181 3300053145 Bacteria 11854
644 Ga0500586_002010 3300053145 Bacteria 4468
645 Ga0500590_007311 3300053148 Bacteria 5445
646 Ga0500622_0000125 3300053156 Bacteria 81109
647 Ga0500622_0003132 3300053156 Bacteria 11352
648 Ga0500622_0008466 3300053156 Bacteria 5753
649 Ga0500636_0010652 3300053177 Bacteria 5367
650 Ga0500645_000631 3300053730 Bacteria 22397
651 Ga0500645_005748 3300053730 Bacteria 4514
652 Ga0500596_000208 3300053735 Bacteria 9800
653 Ga0500587_000458 3300053739 Bacteria 4843
654 Ga0501084_0023516 3300054114 Bacteria 5141
655 Ga0501084_0088423 3300054114 Bacteria 2601
656 Ga0501082_0001469 3300060353 Bacteria 20732
657 Ga0501082_0016215 3300060353 Bacteria 6414
658 Ga0501082_0064100 3300060353 Bacteria 3165
659 Ga0530510_0012323 3300061734 Bacteria 6004
660 2508731877 2508501050 Bacteria 9633614
661 2545678385 2545555834 Bacteria 8130841
662 2587725345 2585428057 Bacteria 6737412
663 2587731296 2585428058 Bacteria 6853932
664 2587759901 2585428062 Bacteria 6842168
665 2588290052 2588253510 Bacteria 6901809
666 2643745870 2643221544 Bacteria 5886209
667 2643790284 2643221554 Bacteria 6603920
668 2643972772 2643221592 Bacteria 6608788
669 2644031335 2643221603 Bacteria 6147767
670 2644143381 2643221625 Bacteria 6512927
671 2644216807 2643221638 Bacteria 6579467
672 2644221791 2643221639 Bacteria 6649903
673 2644250425 2643221645 Bacteria 7207331
674 2644257418 2643221646 Bacteria 6433402
675 2644276182 2643221648 Bacteria 6521465
676 2644301136 2643221654 Bacteria 5273570
677 2644356053 2643221664 Bacteria 7272945
678 2738742610 2738541280 Bacteria 6630198
679 2738826066 2738541297 Bacteria 6549566
680 2738842386 2738541300 Bacteria 6675882
681 2739055002 2738541337 Bacteria 6183410
682 2739149863 2738541357 Bacteria 6549408
683 2739191782 2738543003 Bacteria 6549560
684 2739273133 2738543018 Bacteria 6718814
685 2739318259 2738543026 Bacteria 6549408
686 2739336500 2738543029 Bacteria 6549249
687 2739342177 2738543030 Bacteria 6719714
688 2821136406 2821131069 Bacteria 6108407
689 2828307169 2828305725 Bacteria 4916900
690 2841911517 2841911363 Bacteria 6173697
691 2841917802 2841917233 Bacteria 6173500
692 2842339064 2842333319 Bacteria 8899485
693 2842715990 2842711865 Bacteria 7155354
694 2844534784 2844533157 Bacteria 7517899
695 2857564141 2857558681 Bacteria 6617694
696 2857570359 2857564685 Bacteria 6290584
697 2883580452 2883577096 Bacteria 4709178
698 2904428482 2904424332 Bacteria 7633521
699 2919452735 2919450847 Bacteria 5631160
700 641643238 641522639 Bacteria 7737025
701 643602212 643348564 Bacteria 8839022
702 8016594596 8016583857 Bacteria 10421953
703 Ga0157375_10041775
704 JGI25155J39150_1000095
705 JGI25156J39149_1000025
706 JGI25154J39366_1000045
707 JGI25157J39369_1000034
708 JGI25152J39213_1005951
709 JGI25151J46595_10000268
710 JGI25406J46586_10000546
711 JGI25153J46596_10000420
712 JGI25153J46596_10001641
713 JGI25153J46596_10005265
714 JGI25160J50197_1000885
715 Ga0055529_1000274
716 Ga0055526_1000076
717 Ga0055526_1000321
718 Ga0055526_1001433
719 Ga0055526_1002957
720 Ga0055526_1005175
721 Ga0055526_1005582
722 Ga0055537_1000119
723 Ga0055524_1000124
724 Ga0055534_1000047
725 Ga0055528_1000049
726 Ga0055528_1000272
727 Ga0055530_10001546
728 Ga0055531_10000208
729 Ga0055531_10000652
730 Ga0055543_1000185
731 Ga0065165_1000697
732 Ga0065165_1001958
733 Ga0070683_100089573
734 Ga0070690_100022077
735 Ga0070670_100004770
736 Ga0070670_100039501
737 Ga0070677_10000927
738 Ga0070677_10008859
739 Ga0070666_10021947
740 Ga0070666_10029729
741 Ga0070666_10060281
742 Ga0068868_100044181
743 Ga0070689_100035553
744 Ga0070691_10011103
745 Ga0070668_100017054
746 Ga0070668_100034715
747 Ga0070668_100036523
748 Ga0070675_100000635
749 Ga0070675_100001909
750 Ga0070675_100033898
751 Ga0070671_100003673
752 Ga0070671_100007952
753 Ga0070674_100003116
754 Ga0070674_100004623
755 Ga0070674_100005603
756 Ga0070673_100002713
757 Ga0070673_100026580
758 Ga0070667_100001934
759 Ga0070667_100008322
760 Ga0070667_100018352
761 Ga0070709_10002197
762 Ga0070709_10021867
763 Ga0070714_100022253
764 Ga0070714_100044739
765 Ga0070714_100046588
766 Ga0070713_100001144
767 Ga0070710_10000678
768 Ga0070710_10006908
769 Ga0070710_10011481
770 Ga0070711_100000465
771 Ga0070700_100043211
772 Ga0070663_100008226
773 Ga0070681_10019125
774 Ga0070681_10035333
775 Ga0070685_10015424
776 Ga0070707_100071057
777 Ga0070707_100106258
778 Ga0070707_100125036
779 Ga0070698_100003370
780 Ga0070698_100009043
781 Ga0070699_100006674
782 Ga0070699_100012326
783 Ga0070697_100003641
784 Ga0070697_100018598
785 Ga0070672_100000188
786 Ga0070672_100002376
787 Ga0070672_100017911
788 Ga0070695_100021413
789 Ga0070665_100002312
790 Ga0070665_100015938
791 Ga0070664_100012364
792 Ga0070664_100091274
793 Ga0068856_100037803
794 Ga0068859_100007034
795 Ga0068859_100024206
796 Ga0068859_100060887
797 Ga0068859_100071289
798 Ga0068864_100026836
799 Ga0068864_100090086
800 Ga0068861_100015089
801 Ga0068851_10013223
802 Ga0068863_100005464
803 Ga0068863_100011707
804 Ga0068863_100051584
805 Ga0068858_100001491
806 Ga0068858_100010923
807 Ga0068858_100019290
808 Ga0068858_100103817
809 Ga0068860_100057676
810 Ga0081455_10002982
811 Ga0081455_10017845
812 Ga0081455_10032865
813 Ga0081540_1000087
814 Ga0081540_1003808
815 Ga0081540_1016339
816 Ga0081539_10000169
817 Ga0081539_10004360
818 Ga0070717_10007544
819 Ga0075365_10047372
820 Ga0075365_10055411
821 Ga0075368_10002094
822 Ga0075368_10007021
823 Ga0075364_10022463
824 Ga0070712_100010931
825 Ga0075367_10002518
826 Ga0075366_10016273
827 Ga0097621_100007904
828 Ga0097621_100020508
829 Ga0097621_100021085
830 Ga0068871_100022548
831 Ga0075428_100001776
832 Ga0075428_100005277
833 Ga0075428_100011557
834 Ga0075428_100023456
835 Ga0075428_100040747
836 Ga0075430_100004621
837 Ga0075431_100013919
838 Ga0075433_10011531
839 Ga0075429_100050693
840 Ga0097620_100007034
841 Ga0097620_100024206
842 Ga0097620_100060892
843 Ga0097620_100071289
844 Ga0099826_10000048
845 Ga0075435_100019988
846 Ga0099794_10010289
847 Ga0099795_10003512
848 Ga0105244_10000185
849 Ga0105244_10002531
850 Ga0111539_10045558
851 Ga0111539_10046004
852 Ga0111539_10087616
853 Ga0114129_10002963
854 Ga0114129_10004155
855 Ga0114129_10006327
856 Ga0114129_10012532
857 Ga0114129_10032785
858 Ga0105241_10068988
859 Ga0105248_10008356
860 Ga0105248_10014905
861 Ga0105248_10033668
862 Ga0105237_10011557
863 Ga0105237_10037515
864 Ga0099796_10001906
865 Ga0105239_10055801
866 Ga0105239_10056616
867 Ga0157370_10017206
868 Ga0157369_10005990
869 Ga0157374_10028336
870 Ga0157378_10008668
871 Ga0157372_10020991
872 Ga0157372_10112337
873 Ga0157375_10004650
874 Ga0157375_10011267
875 Ga0157375_10034265
876 Ga0163163_10003401
877 Ga0182008_10020587
878 Ga0157379_10050739
879 Ga0157376_10008920
880 Ga0157376_10026276
881 Ga0157376_10029501
882 Ga0163161_10020611
883 Ga0213872_10000136
884 Ga0213872_10000981
885 Ga0213876_10004148
886 Ga0213876_10029472
887 Ga0209435_100001
888 Ga0209436_100510
889 Ga0207425_1000093
890 Ga0207425_1000216
891 Ga0207425_1000221
892 Ga0209646_1000001
893 Ga0209026_1000003
894 Ga0209677_102245
895 Ga0209759_1000001
896 Ga0209129_1000012
897 Ga0209129_1000344
898 Ga0209565_1000112
899 Ga0209565_1001307
900 Ga0209565_1005330
901 Ga0209455_1000253
902 Ga0209673_1000210
903 Ga0209130_1000369
904 Ga0209130_1000395
905 Ga0209130_1001834
906 Ga0209675_1000142
907 Ga0209675_1004692
908 Ga0209025_1000146
909 Ga0209025_1004048
910 Ga0209564_1000022
911 Ga0209564_1000042
912 Ga0209564_1000245
913 Ga0209564_1000448
914 Ga0209758_1000124
915 Ga0209758_1000659
916 Ga0209758_1000707
917 Ga0209758_1007515
918 Ga0209050_1000086
919 Ga0209050_1000211
920 Ga0209050_1000282
921 Ga0209050_1001245
922 Ga0209256_1000252
923 Ga0209256_1000268
924 Ga0209256_1002063
925 Ga0207426_1001536
926 Ga0209257_1000017
927 Ga0209257_1000087
928 Ga0209257_1001799
929 Ga0207697_10018836
930 Ga0207655_1004090
931 Ga0207655_1018636
932 Ga0207682_10002266
933 Ga0207692_10000797
934 Ga0207692_10000975
935 Ga0207642_10006235
936 Ga0207688_10000311
937 Ga0207680_10012276
938 Ga0207680_10037647
939 Ga0207699_10001610
940 Ga0207699_10001791
941 Ga0207645_10002792
942 Ga0207645_10026450
943 Ga0207645_10032166
944 Ga0207643_10001497
945 Ga0207684_10009441
946 Ga0207684_10012679
947 Ga0207684_10022391
948 Ga0207684_10038223
949 Ga0207693_10002637
950 Ga0207693_10018020
951 Ga0207657_10010638
952 Ga0207657_10035050
953 Ga0207646_10003246
954 Ga0207646_10019157
955 Ga0207681_10011447
956 Ga0207681_10042552
957 Ga0207681_10048062
958 Ga0207650_10000878
959 Ga0207650_10035398
960 Ga0207650_10043598
961 Ga0207659_10000207
962 Ga0207659_10032550
963 Ga0207700_10001723
964 Ga0207700_10068480
965 Ga0207664_10022731
966 Ga0207644_10001228
967 Ga0207706_10003678
968 Ga0207669_10001590
969 Ga0207669_10002166
970 Ga0207669_10041019
971 Ga0207704_10024034
972 Ga0207704_10025515
973 Ga0207665_10001083
974 Ga0207665_10005000
975 Ga0207665_10036103
976 Ga0207691_10001187
977 Ga0207691_10005334
978 Ga0207691_10016733
979 Ga0207691_10016828
980 Ga0207691_10035831
981 Ga0207711_10005547
982 Ga0207711_10018280
983 Ga0207711_10044509
984 Ga0207689_10003137
985 Ga0207689_10004069
986 Ga0207651_10002333
987 Ga0207668_10036745
988 Ga0207658_10006941
989 Ga0207658_10010134
990 Ga0207658_10071822
991 Ga0207677_10001755
992 Ga0207703_10049410
993 Ga0207703_10049586
994 Ga0207639_10020891
995 Ga0207678_10003853
996 Ga0207678_10024057
997 Ga0207708_10000545
998 Ga0207708_10054475
999 Ga0207708_10070976
1000 Ga0207641_10021918
1001 Ga0207641_10024266
1002 Ga0207648_10033846
1003 Ga0207648_10039458
1004 Ga0207648_10088536
1005 Ga0207676_10002643
1006 Ga0207674_10040578
1007 Ga0207675_100002474
1008 Ga0207675_100012299
1009 Ga0207675_100064388
1010 Ga0207675_100089090
1011 Ga0207683_10003797
1012 Ga0207683_10006943
1013 Ga0207683_10014958
1014 Ga0207683_10036493
1015 Ga0207683_10037515
1016 Ga0207698_10035367
1017 Ga0209282_1000066
1018 Ga0209588_1003015
1019 Ga0207428_10026244
1020 Ga0268266_10013765
1021 Ga0268265_10105251
1022 Ga0265334_10002832
1023 Ga0307517_10003242
1024 Ga0307515_10000109
1025 Ga0307515_10000292
1026 Ga0307515_10000458
1027 Ga0307515_10000658
1028 Ga0307515_10002868
1029 Ga0307515_10014704
1030 Ga0307515_10020398
1031 Ga0307515_10036757
1032 Ga0307515_10053861
1033 Ga0307515_10090338
1034 Ga0307512_10026131
1035 Ga0265328_10002123
1036 Ga0265325_10000599
1037 Ga0265331_10002520
1038 Ga0265327_10000083
1039 Ga0307513_10001393
1040 Ga0307513_10011471
1041 Ga0307513_10018336
1042 Ga0307408_100000106
1043 Ga0307408_100000289
1044 Ga0307408_100000326
1045 Ga0307408_100034159
1046 Ga0307508_10000028
1047 Ga0307508_10000101
1048 Ga0307508_10001494
1049 Ga0307514_10000780
1050 Ga0316575_10004668
1051 Ga0316579_10019515
1052 Ga0265314_10001728
1053 Ga0265314_10005924
1054 Ga0316576_10004331
1055 Ga0316578_10000083
1056 Ga0316578_10002722
1057 Ga0307516_10001972
1058 Ga0307405_10008817
1059 Ga0316577_10000153
1060 Ga0307412_10011314
1061 Ga0307414_10031092
1062 Ga0307411_10003909
1063 Ga0307507_10092192
1064 Ga0307510_10033557
1065 Ga0373961_0007329
1066 Ga0373931_0002012
1067 Ga0373931_0002221
1068 Ga0373931_0006248
1069 Ga0373933_0001821
1070 Ga0373933_0033832
1071 Ga0316584_0000907
1072 Ga0316584_0051937
1073 Ga0373925_0007276
1074 Ga0395900_0003092
1075 Ga0395898_0009202
1076 Ga0395905_0000557
1077 Ga0395901_0001902
1078 Ga0400487_37257
1079 Ga0436365_0599131
1080 Ga0436365_1236739
1081 Ga0436365_1599502
1082 Ga0436360_1240980
1083 Ga0436361_0228609
1084 Ga0436361_0324047
1085 Ga0436361_0954756
1086 Ga0436361_1158315
1087 Ga0436363_0990368
1088 Ga0436362_0387970
1089 Ga0450890_000545
1090 Ga0450889_000155
1091 Ga0450916_000827
1092 Ga0451577_0104917
1093 Ga0466963_0001888
1094 Ga0451576_0152174
1095 Ga0466967_0004857
1096 Ga0466967_0029604
1097 Ga0466967_0080935
1098 Ga0495617_002348
1099 Ga0495617_012011
1100 Ga0495592_0001923
1101 Ga0495590_0000056
1102 Ga0495638_0000170
1103 Ga0495638_0006602
1104 Ga0495638_0040175
1105 Ga0495653_0000066
1106 Ga0495650_0000528
1107 Ga0495650_0000553
1108 Ga0495650_0000571
1109 Ga0495650_0000878
1110 Ga0495650_0001888
1111 Ga0495650_0008315
1112 Ga0495650_0014486
1113 Ga0495580_0002475
1114 Ga0495582_0019145
1115 Ga0495605_0000315
1116 Ga0495664_0009952
1117 Ga0495584_0000365
1118 Ga0495584_0001822
1119 Ga0495585_0000070
1120 Ga0495585_0000646
1121 Ga0495585_0039423
1122 Ga0495607_0000906
1123 Ga0495607_0001697
1124 Ga0495607_0014081
1125 Ga0495607_0022969
1126 Ga0495583_0000417
1127 Ga0495583_0001330
1128 Ga0495606_0000063
1129 Ga0495606_0000431
1130 Ga0495606_0001347
1131 Ga0495606_0001680
1132 Ga0495606_0003374
1133 Ga0495606_0004107
1134 Ga0495606_0008520
1135 Ga0495610_0000014
1136 Ga0495610_0000353
1137 Ga0495610_0001670
1138 Ga0495610_0005618
1139 Ga0495616_0001267
1140 Ga0495616_0011359
1141 Ga0495618_0014079
1142 Ga0495630_0000460
1143 Ga0495632_0004456
1144 Ga0495637_0006039
1145 Ga0495643_0000246
1146 Ga0495643_0000302
1147 Ga0495644_0000451
1148 Ga0495644_0000622
1149 Ga0495648_0000119
1150 Ga0495648_0000486
1151 Ga0495648_0003471
1152 Ga0495648_0013106
1153 Ga0495666_0009013
1154 Ga0495642_0001364
1155 Ga0495642_0017073
1156 Ga0495652_0049047
1157 Ga0495654_0000014
1158 Ga0495640_0002731
1159 Ga0495609_0000190
1160 Ga0495609_0000803
1161 Ga0495609_0001962
1162 Ga0495609_0014881
1163 Ga0495597_0000069
1164 Ga0495597_0000123
1165 Ga0495597_0002767
1166 Ga0495622_0000109
1167 Ga0495622_0000246
1168 Ga0495622_0023337
1169 Ga0495622_0024474
1170 Ga0495633_0000088
1171 Ga0495633_0000131
1172 Ga0495633_0005902
1173 Ga0495633_0012055
1174 Ga0495656_0019290
1175 Ga0495668_0000152
1176 Ga0495668_0000574
1177 Ga0495668_0000636
1178 Ga0495668_0002746
1179 Ga0495668_0017181
1180 Ga0495634_0028643
1181 Ga0495634_0047918
1182 Ga0495611_0004697
1183 Ga0495611_0004729
1184 Ga0495625_0000386
1185 Ga0495625_0003039
1186 Ga0495625_0003363
1187 Ga0495625_0004123
1188 Ga0495625_0010047
1189 Ga0495625_0016848
1190 Ga0495635_0009099
1191 Ga0495659_0000026
1192 Ga0495659_0000364
1193 Ga0495661_0016859
1194 Ga0495661_0048637
1195 Ga0495588_0054014
1196 Ga0495647_0010771
1197 Ga0495624_0055963
1198 Ga0495670_0009901
1199 Ga0495670_0028373
1200 Ga0495671_0000005
1201 Ga0495671_0000144
1202 Ga0495671_0003189
1203 Ga0495671_0007388
1204 Ga0495649_0000600
1205 Ga0495649_0011122
1206 Ga0495660_0000229
1207 Ga0495660_0000962
1208 Ga0495660_0007303
1209 Ga0495636_0000861
1210 Ga0495674_0007508
1211 Ga0495672_0000232
1212 Ga0495672_0000260
1213 Ga0495672_0004556
1214 Ga0495676_0014702
1215 Ga0495683_0002158
1216 Ga0495683_0003420
1217 Ga0495687_000629
1218 Ga0495687_003552
1219 Ga0495687_003553
1220 Ga0495677_0003543
1221 Ga0495677_0013107
1222 Ga0495685_000147
1223 Ga0495685_014082
1224 Ga0495673_0000009
1225 Ga0495673_0000012
1226 Ga0495673_0000146
1227 Ga0495684_0011032
1228 Ga0495684_0034406
1229 Ga0495686_0003776
1230 Ga0495686_0005943
1231 Ga0496100_0008335
1232 Ga0496101_0002908
1233 Ga0496101_0012498
1234 Ga0496101_0039071
1235 Ga0496102_0000896
1236 Ga0496102_0012019
1237 Ga0496102_0012800
1238 Ga0496102_0104339
1239 Ga0496103_0001127
1240 Ga0496103_0055292
1241 Ga0496104_0001647
1242 Ga0496104_0005692
1243 Ga0496104_0006941
1244 Ga0496104_0008908
1245 Ga0496104_0018113
1246 Ga0496104_0044535
1247 Ga0496104_0074674
1248 Ga0496105_0005783
1249 Ga0496105_0017152
1250 Ga0496105_0017542
1251 Ga0496105_0022584
1252 Ga0496105_0053005
1253 Ga0496105_0071049
1254 Ga0496106_0014751
1255 Ga0496106_0033976
1256 Ga0496106_0063824
1257 Ga0496106_0094711
1258 Ga0496107_0052655
1259 Ga0496108_0002340
1260 Ga0496108_0011172
1261 Ga0496109_0001545
1262 Ga0496109_0022061
1263 Ga0496109_0027112
1264 Ga0496110_0001147
1265 Ga0496110_0021891
1266 Ga0496110_0022376
1267 Ga0496110_0048635
1268 Ga0496110_0069247
1269 Ga0496111_0015230
1270 Ga0496111_0033256
1271 Ga0496112_0000008
1272 Ga0496112_0014407
1273 Ga0496112_0040810
1274 Ga0496113_0000257
1275 Ga0496113_0027487
1276 Ga0496114_0002985
1277 Ga0496114_0042486
1278 Ga0496114_0059128
1279 Ga0496115_0000535
1280 Ga0496115_0003236
1281 Ga0496115_0028715
1282 Ga0496115_0034877
1283 Ga0496115_0035852
1284 Ga0496115_0105893
1285 Ga0496119_0001286
1286 Ga0496121_0022719
1287 Ga0496122_0003797
1288 Ga0496123_0008256
1289 Ga0496123_0025288
1290 Ga0496124_0014652
1291 Ga0496124_0107728
1292 Ga0496125_0000746
1293 Ga0496125_0038049
1294 Ga0496126_0043656
1295 Ga0495678_000278
1296 Ga0495678_008142
1297 Ga0495682_0000515
1298 Ga0495682_0000614
1299 Ga0501034_0001211
1300 Ga0501034_0016043
1301 Ga0501036_0031524
1302 Ga0501072_0001047
1303 Ga0501072_0003158
1304 Ga0501073_0037597
1305 Ga0501077_0042573
1306 Ga0501229_000400
1307 Ga0501079_0075878
1308 Ga0501081_0030262
1309 Ga0501081_0033192
1310 Ga0501081_0056238
1311 Ga0501083_0049010
1312 nmdc:mga03n38_17743_c1
1313 nmdc:mga0yw44_21784_c1
1314 nmdc:mga0yw44_24359_c1
1315 nmdc:mga0k408_396_c1
1316 nmdc:mga05p37_24611_c1
1317 nmdc:mga05p37_31849_c1
1318 nmdc:mga05p37_3234_c1
1319 nmdc:mga05p37_517_c1
1320 nmdc:mga05p37_6051_c1
1321 nmdc:mga09592_9105_c1
1322 nmdc:mga0qj67_219_c1
1323 nmdc:mga06r32_2713_c1
1324 nmdc:mga06r32_47361_c1
1325 nmdc:mga06r32_9139_c1
1326 nmdc:mga06r32_93366_c1
1327 nmdc:mga08y16_33510_c1
1328 nmdc:mga08y16_76745_c1
1329 nmdc:mga0n895_13353_c1
1330 nmdc:mga0rr50_4990_c1
1331 nmdc:mga0rr50_8180_c1
1332 nmdc:mga0a205_2701_c1
1333 Ga0495601_0023183
1334 Ga0495612_0004983
1335 Ga0495619_0006266
1336 Ga0495619_0026413
1337 Ga0500578_0001060
1338 Ga0500641_0009515
1339 Ga0500556_0000073
1340 Ga0500572_000025
1341 Ga0500618_001265
1342 Ga0500642_0030780
1343 Ga0500559_0000694
1344 Ga0500559_0002387
1345 Ga0500586_000181
1346 Ga0500586_002010
1347 Ga0500590_007311
1348 Ga0500622_0000125
1349 Ga0500622_0003132
1350 Ga0500622_0008466
1351 Ga0500636_0010652
1352 Ga0500645_000631
1353 Ga0500645_005748
1354 Ga0500596_000208
1355 Ga0500587_000458
1356 Ga0501084_0023516
1357 Ga0501084_0088423
1358 Ga0501082_0001469
1359 Ga0501082_0016215
1360 Ga0501082_0064100
1361 Ga0530510_0012323
1362 2508731877
1363 2545678385
1364 2587725345
1365 2587731296
1366 2587759901
1367 2588290052
1368 2643745870
1369 2643790284
1370 2643972772
1371 2644031335
1372 2644143381
1373 2644216807
1374 2644221791
1375 2644250425
1376 2644257418
1377 2644276182
1378 2644301136
1379 2644356053
1380 2738742610
1381 2738826066
1382 2738842386
1383 2739055002
1384 2739149863
1385 2739191782
1386 2739273133
1387 2739318259
1388 2739336500
1389 2739342177
1390 2821136406
1391 2828307169
1392 2841911517
1393 2841917802
1394 2842339064
1395 2842715990
1396 2844534784
1397 2857564141
1398 2857570359
1399 2883580452
1400 2904428482
1401 2919452735
1402 641643238
1403 643602212
1404 8016594596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20256

MoCoBD_2

Molybdopterin cofactor-binding domain

624

724

0.94

PF02738

MoCoBD_1

Molybdopterin cofactor-binding domain

358

605

0.84

PF20256

MoCoBD_2

Molybdopterin cofactor-binding domain

65

265

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_C cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9199 49 728
5g5g-assembly1.cif.gz_C escherichia coli periplasmic aldehyde oxidase 0.8692 192 722
5g5h-assembly1.cif.gz_C escherichia coli periplasmic aldehyde oxidase r440h mutant 0.8616 198 722
8gy3-assembly1.cif.gz_C cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.858 49 728
7px0-assembly1.cif.gz_A drosophila melanogaster aldehyde oxidase 1 0.8398 200 728
ID Description Score Start End Superfamily
1rm6D04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8948 529 728 3.30.365.10
af_Q46799_603_751_3.30.365.10 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8932 597 728 3.30.365.10
af_A0A1D6HSW8_1223_1425_3.30.365.10 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8869 597 712 3.30.365.10
1sb3D01 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8846 345 434 3.30.365.10
1t3qB03 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8771 345 434 3.30.365.10
ID Description Score Start End GO Terms
AF-A0A7W1AN22-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.9942 49 730 GO:0016491
AF-A0A7W1AN22-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.9913 49 730 GO:0016491
AF-A0A4Q5UE50-F1-model_v4 deleted 0.9862 278 643
AF-A0A659YKB3-F1-model_v4 deleted 0.9848 276 584
AF-A0A2W4P617-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase a/b hammerhead domain-containing protein 0.9776 239 724 GO:0016491

Map