F476353

General Info

Members Datasets Scaffolds Average Seq Length
704 376 1408 308

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10185834|Ga0157380_101858342
Length 345
Sequence VSGLIVIGQSFGNDFNISGARMAADALQFWASSKEAPMANARGLIAVDKMGTKVLFLNPVTYETEVVLDGFDKTVHELLVMPEISRAYVPIFGDGIHGRNPNPQHWLCVFDLEKRALLTTIDLRPYIAPHTLKLAPDGLIYITCENSAKVVAIDPKTNTVVGAIDSGSTNGHRLIISPDGKRLYTENEEDGTVSVIDLPMRKLLGKIKTPRPLAGIAISADGRTVVAVDDAEPTLFLLDAEAGQVRQEVRLKDVPKAAQIARYAPDNSLIGVTSLNSDTVSLIDPSFREKTAIKVGNQPMDMAFHGDELFVPCQGDGSVHVIDIPNKRHKTSFSAGKGCESLAFY

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
231 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
232 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
241 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 7.1
Rhizosphere 91.34
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10185834 3300014326 Bacteria 1830
2 2214745219 2209111006 Bacteria 14065
3 ARSoilYngRDRAFT_c00268 3300000042 Bacteria 7919
4 ARcpr5yngRDRAFT_c000083 3300000043 Bacteria 15543
5 ARcpr5yngRDRAFT_c000130 3300000043 Bacteria 11824
6 ARSoilOldRDRAFT_c000077 3300000044 Bacteria 18706
7 ARCol0yngRDRAFT_1000003 3300000652 Bacteria 53041
8 JGI24741J21665_1010919 3300001915 Bacteria 1606
9 JGI24746J21847_1000172 3300001977 Bacteria 8495
10 JGI24739J22299_10002161 3300001989 Bacteria 7538
11 JGI24737J22298_10002605 3300001990 Bacteria 6382
12 JGI24737J22298_10004159 3300001990 Bacteria 5058
13 JGI24750J21931_1000256 3300002070 Bacteria 9041
14 JGI24745J21846_1008664 3300002073 Bacteria 1148
15 JGI24748J21848_1000381 3300002074 Bacteria 5024
16 JGI24738J21930_10000425 3300002075 Bacteria 11873
17 JGI24749J21850_1001974 3300002076 Bacteria 2897
18 JGI24035J26624_1000008 3300002126 Bacteria 13965
19 JGI24035J26624_1000030 3300002126 Bacteria 10265
20 JGI24751J29686_10005576 3300002459 Bacteria 2563
21 JGI25406J46586_10024660 3300003203 Bacteria 2352
22 JGI26145J50221_1002475 3300003371 Bacteria 1454
23 JGI25405J52794_10033288 3300003911 Bacteria 1075
24 Ga0065716_1001562 3300005277 Bacteria 6533
25 Ga0065704_10079631 3300005289 Bacteria 4090
26 Ga0065712_10000247 3300005290 Bacteria 16703
27 Ga0065712_10069581 3300005290 Bacteria 7025
28 Ga0065715_10090800 3300005293 Bacteria 6445
29 Ga0070658_10132885 3300005327 Bacteria 2075
30 Ga0070676_10000036 3300005328 Bacteria 40368
31 Ga0070676_10020980 3300005328 Bacteria 3655
32 Ga0070683_100002049 3300005329 Bacteria 15883
33 Ga0070683_100285309 3300005329 Bacteria 1571
34 Ga0070690_100001849 3300005330 Bacteria 11234
35 Ga0070670_100003778 3300005331 Bacteria 12606
36 Ga0070677_10000104 3300005333 Bacteria 27953
37 Ga0068869_100000087 3300005334 Bacteria 42211
38 Ga0068869_100235469 3300005334 Bacteria 1457
39 Ga0070680_100003276 3300005336 Bacteria 12068
40 Ga0070680_100105591 3300005336 Bacteria 2341
41 Ga0070682_100000341 3300005337 Bacteria 32124
42 Ga0068868_100025389 3300005338 Bacteria 4508
43 Ga0070660_100006206 3300005339 Bacteria 8272
44 Ga0070660_100084732 3300005339 Bacteria 2491
45 Ga0070660_100198860 3300005339 Bacteria 1625
46 Ga0070689_100000963 3300005340 Bacteria 17950
47 Ga0070689_100002790 3300005340 Bacteria 11470
48 Ga0070691_10000518 3300005341 Bacteria 14537
49 Ga0070691_10060275 3300005341 Bacteria 1824
50 Ga0070687_100000245 3300005343 Bacteria 18566
51 Ga0070687_100017541 3300005343 Bacteria 3294
52 Ga0070687_100078543 3300005343 Bacteria 1794
53 Ga0070661_100000017 3300005344 Bacteria 153232
54 Ga0070661_100230987 3300005344 Bacteria 1422
55 Ga0070692_10003367 3300005345 Bacteria 6470
56 Ga0070692_10003914 3300005345 Bacteria 6140
57 Ga0070668_100001356 3300005347 Bacteria 17522
58 Ga0070668_100096942 3300005347 Bacteria 2331
59 Ga0070669_100000217 3300005353 Bacteria 47833
60 Ga0070669_100038543 3300005353 Bacteria 3470
61 Ga0070675_100000088 3300005354 Bacteria 53698
62 Ga0070675_100495057 3300005354 Bacteria 1101
63 Ga0070671_100000768 3300005355 Bacteria 23064
64 Ga0070671_100100518 3300005355 Bacteria 2427
65 Ga0070674_100000623 3300005356 Bacteria 17847
66 Ga0070673_100000239 3300005364 Bacteria 27611
67 Ga0070688_100000084 3300005365 Bacteria 47194
68 Ga0070688_100193923 3300005365 Bacteria 1417
69 Ga0070688_100255013 3300005365 Bacteria 1250
70 Ga0070659_100000252 3300005366 Bacteria 42278
71 Ga0070659_100122428 3300005366 Bacteria 2108
72 Ga0070667_100003023 3300005367 Bacteria 14455
73 Ga0070709_10010014 3300005434 Bacteria 5239
74 Ga0070709_10047656 3300005434 Bacteria 2670
75 Ga0070714_100114788 3300005435 Bacteria 2389
76 Ga0070713_100002359 3300005436 Bacteria 12318
77 Ga0070713_100087274 3300005436 Bacteria 2676
78 Ga0070713_100088931 3300005436 Bacteria 2652
79 Ga0070713_100111681 3300005436 Bacteria 2384
80 Ga0070710_10208523 3300005437 Bacteria 1238
81 Ga0070701_10010531 3300005438 Bacteria 4091
82 Ga0070701_10026873 3300005438 Bacteria 2812
83 Ga0070711_100048327 3300005439 Bacteria 2908
84 Ga0070711_100091039 3300005439 Bacteria 2198
85 Ga0070711_100093628 3300005439 Unclassified 2170
86 Ga0070711_100289900 3300005439 Unclassified 1298
87 Ga0070705_100000425 3300005440 Bacteria 24231
88 Ga0070705_100036888 3300005440 Bacteria 2752
89 Ga0070700_100000370 3300005441 Bacteria 23064
90 Ga0070700_100260020 3300005441 Bacteria 1250
91 Ga0070694_100000401 3300005444 Bacteria 23534
92 Ga0070694_100097071 3300005444 Bacteria 2078
93 Ga0070708_100004439 3300005445 Bacteria 11027
94 Ga0070708_100098455 3300005445 Bacteria 2674
95 Ga0070663_100000415 3300005455 Bacteria 22408
96 Ga0070678_100000053 3300005456 Bacteria 40418
97 Ga0070662_100003931 3300005457 Bacteria 9321
98 Ga0070662_100146016 3300005457 Bacteria 1838
99 Ga0070681_10000493 3300005458 Bacteria 32198
100 Ga0070681_10004194 3300005458 Bacteria 13656
101 Ga0070681_10326374 3300005458 Bacteria 1444
102 Ga0070681_10436233 3300005458 Unclassified 1222
103 Ga0068867_100001581 3300005459 Bacteria 15837
104 Ga0070685_10012006 3300005466 Bacteria 4541
105 Ga0070679_100000679 3300005530 Bacteria 29087
106 Ga0070679_100009527 3300005530 Bacteria 9187
107 Ga0070679_100112073 3300005530 Bacteria 2714
108 Ga0070679_100144710 3300005530 Bacteria 2355
109 Ga0070684_100000144 3300005535 Bacteria 47665
110 Ga0068853_100005864 3300005539 Bacteria 9680
111 Ga0070672_100000014 3300005543 Bacteria 72627
112 Ga0070672_100121769 3300005543 Bacteria 2136
113 Ga0070686_100000754 3300005544 Bacteria 18754
114 Ga0070686_100022707 3300005544 Bacteria 3740
115 Ga0070695_100000743 3300005545 Bacteria 17429
116 Ga0070696_100000918 3300005546 Bacteria 19157
117 Ga0070696_100073748 3300005546 Bacteria 2405
118 Ga0070693_100000141 3300005547 Bacteria 32426
119 Ga0070665_100294999 3300005548 Bacteria 1624
120 Ga0070704_100064769 3300005549 Bacteria 2628
121 Ga0070704_100096887 3300005549 Bacteria 2212
122 Ga0068855_100009106 3300005563 Bacteria 11994
123 Ga0068855_100108304 3300005563 Bacteria 3191
124 Ga0070664_100000816 3300005564 Bacteria 23970
125 Ga0070664_100053558 3300005564 Bacteria 3420
126 Ga0068857_100000567 3300005577 Bacteria 26993
127 Ga0068854_100000168 3300005578 Bacteria 44522
128 Ga0068856_100143631 3300005614 Bacteria 2394
129 Ga0070702_100000857 3300005615 Bacteria 11750
130 Ga0068852_100002066 3300005616 Bacteria 13707
131 Ga0068852_100052192 3300005616 Bacteria 3513
132 Ga0068859_100012990 3300005617 Bacteria 8367
133 Ga0068859_100162636 3300005617 Bacteria 2311
134 Ga0068859_100247647 3300005617 Bacteria 1872
135 Ga0068864_100000980 3300005618 Bacteria 23924
136 Ga0068866_10000264 3300005718 Bacteria 24776
137 Ga0068861_100000315 3300005719 Bacteria 27094
138 Ga0068861_100395829 3300005719 Bacteria 1224
139 Ga0068870_10000002 3300005840 Bacteria 91107
140 Ga0068863_100001290 3300005841 Bacteria 25007
141 Ga0068858_100000356 3300005842 Bacteria 48189
142 Ga0068858_100150298 3300005842 Bacteria 2190
143 Ga0068860_100000747 3300005843 Bacteria 36976
144 Ga0068860_100138100 3300005843 Bacteria 2341
145 Ga0068860_100379873 3300005843 Bacteria 1394
146 Ga0068862_100002002 3300005844 Bacteria 18476
147 Ga0068862_100346524 3300005844 Unclassified 1377
148 Ga0081455_10000048 3300005937 Bacteria 126551
149 Ga0081455_10000369 3300005937 Bacteria 59441
150 Ga0081455_10016383 3300005937 Bacteria 7159
151 Ga0081540_1006164 3300005983 Bacteria 8795
152 Ga0081539_10002225 3300005985 Bacteria 28285
153 Ga0070717_10009878 3300006028 Bacteria 7187
154 Ga0070717_10093129 3300006028 Bacteria 2546
155 Ga0070717_10167220 3300006028 Unclassified 1911
156 Ga0075365_10225635 3300006038 Bacteria 1314
157 Ga0070715_10000513 3300006163 Bacteria 10119
158 Ga0070716_100056116 3300006173 Bacteria 2257
159 Ga0070716_100121550 3300006173 Bacteria 1635
160 Ga0070712_100029497 3300006175 Bacteria 3678
161 Ga0070712_100081098 3300006175 Bacteria 2350
162 Ga0070712_100178419 3300006175 Bacteria 1653
163 Ga0075367_10012917 3300006178 Bacteria 4474
164 Ga0097621_100000144 3300006237 Bacteria 43169
165 Ga0068871_100000110 3300006358 Bacteria 49756
166 Ga0075428_100084138 3300006844 Bacteria 3471
167 Ga0075430_100094974 3300006846 Bacteria 2492
168 Ga0075431_100115216 3300006847 Bacteria 2774
169 Ga0075433_10026099 3300006852 Bacteria 4942
170 Ga0075433_10133112 3300006852 Bacteria 2209
171 Ga0075434_100000084 3300006871 Bacteria 50928
172 Ga0075434_100043477 3300006871 Unclassified 4456
173 Ga0075434_100053336 3300006871 Bacteria 4018
174 Ga0075434_100057142 3300006871 Unclassified 3878
175 Ga0075434_100145571 3300006871 Bacteria 2390
176 Ga0075434_100359687 3300006871 Bacteria 1477
177 Ga0068865_100000066 3300006881 Bacteria 54564
178 Ga0068865_100078367 3300006881 Bacteria 2363
179 Ga0075436_100012722 3300006914 Bacteria 5768
180 Ga0097620_100012990 3300006931 Bacteria 8367
181 Ga0097620_100162629 3300006931 Bacteria 2311
182 Ga0097620_100247649 3300006931 Bacteria 1872
183 Ga0075435_100028540 3300007076 Bacteria 4377
184 Ga0075435_100077114 3300007076 Bacteria 2732
185 Ga0075435_100281005 3300007076 Bacteria 1421
186 Ga0099794_10038178 3300007265 Bacteria 2275
187 Ga0105240_10408797 3300009093 Bacteria 1527
188 Ga0111539_10000652 3300009094 Bacteria 44828
189 Ga0111539_10001255 3300009094 Bacteria 33804
190 Ga0111539_10030559 3300009094 Bacteria 6546
191 Ga0111539_10515911 3300009094 Unclassified 1392
192 Ga0105245_10000287 3300009098 Bacteria 48204
193 Ga0105247_10001223 3300009101 Bacteria 19057
194 Ga0105247_10120013 3300009101 Bacteria 1702
195 Ga0114129_10092448 3300009147 Unclassified 4191
196 Ga0105243_10000695 3300009148 Bacteria 32613
197 Ga0105243_10053738 3300009148 Bacteria 3196
198 Ga0105241_10002331 3300009174 Bacteria 14262
199 Ga0105241_10106605 3300009174 Bacteria 2237
200 Ga0105242_10000792 3300009176 Bacteria 24525
201 Ga0105248_10000535 3300009177 Bacteria 43210
202 Ga0105237_10002795 3300009545 Bacteria 21203
203 Ga0105238_10181825 3300009551 Bacteria 2079
204 Ga0105249_10000279 3300009553 Bacteria 53594
205 Ga0105249_10003839 3300009553 Bacteria 12962
206 Ga0105249_10018980 3300009553 Bacteria 6131
207 Ga0105249_10441238 3300009553 Bacteria 1339
208 Ga0099796_10004966 3300010159 Bacteria 3276
209 Ga0105239_10001686 3300010375 Bacteria 29130
210 Ga0105246_10000095 3300011119 Bacteria 38417
211 Ga0105246_10302262 3300011119 Bacteria 1292
212 Ga0157373_10050116 3300013100 Bacteria 2974
213 Ga0157373_10062875 3300013100 Bacteria 2629
214 Ga0157371_10148569 3300013102 Bacteria 1671
215 Ga0157374_10001348 3300013296 Bacteria 20895
216 Ga0157378_10000956 3300013297 Bacteria 26502
217 Ga0163162_10003795 3300013306 Bacteria 14493
218 Ga0163162_10042395 3300013306 Bacteria 4555
219 Ga0163162_10147815 3300013306 Bacteria 2467
220 Ga0163162_10354099 3300013306 Bacteria 1601
221 Ga0157372_10445281 3300013307 Bacteria 1510
222 Ga0157372_10639429 3300013307 Bacteria 1239
223 Ga0157375_10001973 3300013308 Bacteria 17692
224 Ga0163163_10055839 3300014325 Bacteria 3903
225 Ga0163163_10187980 3300014325 Bacteria 2114
226 Ga0157380_10000052 3300014326 Bacteria 67030
227 Ga0157380_10189714 3300014326 Bacteria 1813
228 Ga0157380_10252784 3300014326 Bacteria 1596
229 Ga0157380_10537572 3300014326 Bacteria 1144
230 Ga0157377_10000076 3300014745 Bacteria 75835
231 Ga0157379_10000060 3300014968 Bacteria 69312
232 Ga0157379_10364183 3300014968 Bacteria 1325
233 Ga0157379_10432425 3300014968 Bacteria 1213
234 Ga0157376_10000141 3300014969 Bacteria 49288
235 Ga0163161_10000739 3300017792 Bacteria 25660
236 Ga0163161_10067121 3300017792 Bacteria 2620
237 Ga0163161_10206041 3300017792 Bacteria 1517
238 Ga0213876_10044059 3300021384 Bacteria 2358
239 Ga0213876_10062025 3300021384 Bacteria 1973
240 Ga0213871_10003427 3300021441 Bacteria 3054
241 Ga0207666_1000005 3300025271 Bacteria 54011
242 Ga0207673_1007698 3300025290 Bacteria 1354
243 Ga0209758_1000569 3300025297 Bacteria 57936
244 Ga0209758_1040673 3300025297 Bacteria 1750
245 Ga0207697_10000011 3300025315 Bacteria 65035
246 Ga0207682_10000051 3300025893 Bacteria 49249
247 Ga0207692_10235758 3300025898 Bacteria 1091
248 Ga0207642_10000176 3300025899 Bacteria 18394
249 Ga0207710_10001284 3300025900 Bacteria 12696
250 Ga0207688_10000001 3300025901 Bacteria 107505
251 Ga0207680_10002846 3300025903 Bacteria 8110
252 Ga0207647_10001714 3300025904 Bacteria 16833
253 Ga0207647_10037247 3300025904 Bacteria 3085
254 Ga0207699_10008926 3300025906 Bacteria 4970
255 Ga0207699_10088943 3300025906 Unclassified 1934
256 Ga0207699_10269612 3300025906 Bacteria 1179
257 Ga0207699_10345010 3300025906 Unclassified 1050
258 Ga0207645_10000121 3300025907 Bacteria 58999
259 Ga0207645_10023007 3300025907 Bacteria 4050
260 Ga0207643_10000009 3300025908 Bacteria 160496
261 Ga0207654_10001894 3300025911 Bacteria 10849
262 Ga0207707_10000840 3300025912 Bacteria 30189
263 Ga0207707_10145090 3300025912 Bacteria 2075
264 Ga0207695_10168202 3300025913 Bacteria 2119
265 Ga0207671_10007485 3300025914 Bacteria 9471
266 Ga0207693_10009486 3300025915 Bacteria 7926
267 Ga0207693_10016164 3300025915 Bacteria 5968
268 Ga0207693_10086779 3300025915 Bacteria 2452
269 Ga0207693_10187356 3300025915 Bacteria 1628
270 Ga0207693_10314300 3300025915 Bacteria 1226
271 Ga0207660_10000775 3300025917 Bacteria 21240
272 Ga0207660_10018073 3300025917 Bacteria 4696
273 Ga0207660_10028511 3300025917 Bacteria 3819
274 Ga0207660_10115673 3300025917 Bacteria 2025
275 Ga0207662_10004796 3300025918 Bacteria 7148
276 Ga0207662_10036635 3300025918 Bacteria 2868
277 Ga0207662_10085916 3300025918 Bacteria 1927
278 Ga0207657_10002826 3300025919 Bacteria 18663
279 Ga0207657_10058352 3300025919 Bacteria 3321
280 Ga0207657_10194924 3300025919 Bacteria 1632
281 Ga0207649_10000052 3300025920 Bacteria 106800
282 Ga0207652_10000508 3300025921 Bacteria 39568
283 Ga0207652_10077681 3300025921 Bacteria 2897
284 Ga0207681_10000035 3300025923 Bacteria 161792
285 Ga0207681_10091313 3300025923 Bacteria 2175
286 Ga0207694_10304962 3300025924 Bacteria 1312
287 Ga0207650_10000843 3300025925 Bacteria 23231
288 Ga0207650_10299777 3300025925 Bacteria 1312
289 Ga0207659_10000027 3300025926 Bacteria 135454
290 Ga0207659_10080425 3300025926 Bacteria 2407
291 Ga0207687_10000231 3300025927 Bacteria 38087
292 Ga0207700_10056459 3300025928 Bacteria 2956
293 Ga0207700_10103773 3300025928 Bacteria 2273
294 Ga0207700_10113292 3300025928 Bacteria 2187
295 Ga0207664_10135847 3300025929 Bacteria 2075
296 Ga0207664_10447261 3300025929 Bacteria 1153
297 Ga0207644_10000676 3300025931 Bacteria 21510
298 Ga0207644_10138860 3300025931 Bacteria 1869
299 Ga0207690_10000148 3300025932 Bacteria 56244
300 Ga0207690_10039516 3300025932 Bacteria 3079
301 Ga0207706_10000261 3300025933 Bacteria 57530
302 Ga0207706_10004416 3300025933 Bacteria 13214
303 Ga0207686_10000171 3300025934 Bacteria 49624
304 Ga0207686_10154470 3300025934 Bacteria 1601
305 Ga0207709_10000087 3300025935 Bacteria 155019
306 Ga0207670_10000169 3300025936 Bacteria 43470
307 Ga0207669_10000351 3300025937 Bacteria 20924
308 Ga0207704_10108023 3300025938 Bacteria 1873
309 Ga0207665_10047303 3300025939 Bacteria 2884
310 Ga0207665_10118141 3300025939 Bacteria 1871
311 Ga0207665_10152955 3300025939 Bacteria 1654
312 Ga0207691_10000106 3300025940 Bacteria 74290
313 Ga0207691_10087419 3300025940 Bacteria 2796
314 Ga0207711_10002556 3300025941 Bacteria 16214
315 Ga0207711_10004928 3300025941 Bacteria 11337
316 Ga0207689_10000031 3300025942 Bacteria 97131
317 Ga0207661_10000219 3300025944 Bacteria 37298
318 Ga0207661_10119454 3300025944 Bacteria 2242
319 Ga0207661_10409559 3300025944 Bacteria 1230
320 Ga0207679_10000493 3300025945 Bacteria 27242
321 Ga0207679_10156400 3300025945 Bacteria 1862
322 Ga0207679_10344975 3300025945 Bacteria 1296
323 Ga0207667_10006216 3300025949 Bacteria 14494
324 Ga0207667_10369955 3300025949 Bacteria 1461
325 Ga0207651_10001402 3300025960 Bacteria 10939
326 Ga0207712_10000176 3300025961 Bacteria 66116
327 Ga0207712_10096789 3300025961 Bacteria 2185
328 Ga0207668_10000191 3300025972 Bacteria 41901
329 Ga0207668_10024956 3300025972 Bacteria 3864
330 Ga0207640_10000126 3300025981 Bacteria 58432
331 Ga0207658_10007487 3300025986 Bacteria 7438
332 Ga0207677_10148612 3300026023 Bacteria 1804
333 Ga0207703_10006871 3300026035 Bacteria 9061
334 Ga0207703_10165806 3300026035 Bacteria 1938
335 Ga0207639_10000515 3300026041 Bacteria 26655
336 Ga0207639_10105661 3300026041 Bacteria 2285
337 Ga0207678_10000137 3300026067 Bacteria 60700
338 Ga0207708_10000250 3300026075 Bacteria 42228
339 Ga0207708_10030828 3300026075 Bacteria 4067
340 Ga0207708_10056648 3300026075 Bacteria 2990
341 Ga0207708_10381057 3300026075 Bacteria 1163
342 Ga0207702_10001067 3300026078 Bacteria 28056
343 Ga0207641_10000937 3300026088 Bacteria 30095
344 Ga0207648_10000125 3300026089 Bacteria 75547
345 Ga0207676_10001547 3300026095 Bacteria 16966
346 Ga0207676_10283061 3300026095 Bacteria 1506
347 Ga0207674_10000095 3300026116 Bacteria 99278
348 Ga0207675_100000140 3300026118 Bacteria 62058
349 Ga0207675_100092410 3300026118 Bacteria 2846
350 Ga0207683_10000178 3300026121 Bacteria 54648
351 Ga0207698_10001736 3300026142 Bacteria 12713
352 Ga0210002_1000669 3300027617 Bacteria 4628
353 Ga0209971_1004192 3300027682 Bacteria 3420
354 Ga0209998_10004186 3300027717 Bacteria 3075
355 Ga0209974_10001253 3300027876 Bacteria 9106
356 Ga0207428_10000037 3300027907 Bacteria 218857
357 Ga0207428_10001468 3300027907 Bacteria 24676
358 Ga0207428_10160821 3300027907 Bacteria 1705
359 Ga0207428_10290318 3300027907 Bacteria 1212
360 Ga0265357_1000316 3300028023 Bacteria 2583
361 Ga0268266_10165528 3300028379 Bacteria 2003
362 Ga0268266_10284625 3300028379 Bacteria 1538
363 Ga0268265_10000774 3300028380 Bacteria 30835
364 Ga0268265_10124096 3300028380 Bacteria 2133
365 Ga0268265_10215496 3300028380 Bacteria 1676
366 Ga0268264_10000467 3300028381 Bacteria 54925
367 Ga0268264_10321074 3300028381 Bacteria 1464
368 Ga0265318_10010190 3300028577 Bacteria 4104
369 Ga0265338_10074675 3300028800 Bacteria 2881
370 Ga0265760_10016365 3300031090 Bacteria 2128
371 Ga0265330_10020216 3300031235 Bacteria 3042
372 Ga0265325_10000049 3300031241 Bacteria 80854
373 Ga0265325_10042630 3300031241 Bacteria 2371
374 Ga0265329_10023207 3300031242 Bacteria 2068
375 Ga0265340_10002924 3300031247 Bacteria 9729
376 Ga0265339_10000269 3300031249 Bacteria 41988
377 Ga0265339_10009320 3300031249 Bacteria 6177
378 Ga0265331_10038705 3300031250 Bacteria 2329
379 Ga0265316_10026116 3300031344 Bacteria 4866
380 Ga0265316_10129965 3300031344 Bacteria 1898
381 Ga0265313_10021626 3300031595 Bacteria 3513
382 Ga0265313_10038029 3300031595 Bacteria 2400
383 Ga0265313_10107202 3300031595 Bacteria 1232
384 Ga0265314_10064629 3300031711 Bacteria 2476
385 Ga0265342_10037995 3300031712 Bacteria 2934
386 Ga0373930_0000027 3300034816 Bacteria 13519
387 Ga0373948_0000257 3300034817 Bacteria 6391
388 Ga0373948_0018042 3300034817 Bacteria 1322
389 Ga0373950_0004090 3300034818 Bacteria 2123
390 Ga0373958_0000466 3300034819 Bacteria 4954
391 Ga0373958_0000674 3300034819 Bacteria 4314
392 Ga0373959_0000673 3300034820 Bacteria 5847
393 Ga0373959_0004580 3300034820 Bacteria 2234
394 Ga0373938_0000020 3300034957 Bacteria 20855
395 Ga0373938_0000687 3300034957 Bacteria 5457
396 Ga0373938_0003245 3300034957 Bacteria 2650
397 Ga0373928_0000298 3300035084 Bacteria 9863
398 Ga0373928_0012217 3300035084 Bacteria 1710
399 Ga0373929_0001530 3300035085 Bacteria 4394
400 Ga0373929_0004695 3300035085 Bacteria 2449
401 Ga0373934_0137276 3300035086 Unclassified 999
402 Ga0373940_0000080 3300035088 Bacteria 11517
403 Ga0373944_0007656 3300035089 Bacteria 2900
404 Ga0373949_0000753 3300035090 Bacteria 10447
405 Ga0373951_0001678 3300035091 Bacteria 5789
406 Ga0373951_0006554 3300035091 Bacteria 2661
407 Ga0373952_0000333 3300035092 Bacteria 7972
408 Ga0373952_0001012 3300035092 Bacteria 5139
409 Ga0373923_0000919 3300035111 Bacteria 7857
410 Ga0373923_0016700 3300035111 Bacteria 2795
411 Ga0373923_0019172 3300035111 Bacteria 2645
412 Ga0373932_0000316 3300035112 Bacteria 14729
413 Ga0373932_0034846 3300035112 Bacteria 1420
414 Ga0373936_0002231 3300035113 Bacteria 7235
415 Ga0373936_0005828 3300035113 Bacteria 4639
416 Ga0373936_0064866 3300035113 Bacteria 1497
417 Ga0373941_0000521 3300035115 Bacteria 7708
418 Ga0373941_0026267 3300035115 Bacteria 1689
419 Ga0373945_0002741 3300035116 Bacteria 5530
420 Ga0373945_0011515 3300035116 Bacteria 2926
421 Ga0373945_0038968 3300035116 Bacteria 1711
422 Ga0373953_0001774 3300035117 Bacteria 6372
423 Ga0373956_0079186 3300035119 Unclassified 1506
424 Ga0373960_0008241 3300035121 Bacteria 2492
425 Ga0373943_0000069 3300035170 Bacteria 36572
426 Ga0373943_0015861 3300035170 Bacteria 3427
427 Ga0373943_0017222 3300035170 Bacteria 3305
428 Ga0373943_0018775 3300035170 Bacteria 3179
429 Ga0373946_0000379 3300035171 Bacteria 14434
430 Ga0373946_0002835 3300035171 Bacteria 6138
431 Ga0373946_0017700 3300035171 Bacteria 2729
432 Ga0373955_0000643 3300035172 Bacteria 14950
433 Ga0373955_0023393 3300035172 Bacteria 3146
434 Ga0373942_0000054 3300035207 Bacteria 23047
435 Ga0373942_0001029 3300035207 Bacteria 7582
436 Ga0373961_0000807 3300035241 Bacteria 10698
437 Ga0373961_0019802 3300035241 Bacteria 1772
438 Ga0373924_0000604 3300035410 Bacteria 11090
439 Ga0373931_0000933 3300035691 Bacteria 12286
440 Ga0373931_0021889 3300035691 Bacteria 3211
441 Ga0373931_0175515 3300035691 Bacteria 1265
442 Ga0373935_0000075 3300035692 Bacteria 42723
443 Ga0373935_0013888 3300035692 Bacteria 4862
444 Ga0373935_0046279 3300035692 Bacteria 2747
445 Ga0373935_0127810 3300035692 Bacteria 1704
446 Ga0373935_0141812 3300035692 Bacteria 1624
447 Ga0373935_0185291 3300035692 Bacteria 1431
448 Ga0373927_0003619 3300035695 Bacteria 11024
449 Ga0373927_0004392 3300035695 Bacteria 9889
450 Ga0373927_0007963 3300035695 Bacteria 7156
451 Ga0373927_0024002 3300035695 Bacteria 3989
452 Ga0373927_0136110 3300035695 Bacteria 1605
453 Ga0373947_0000138 3300035725 Bacteria 37713
454 Ga0373947_0007756 3300035725 Bacteria 6200
455 Ga0373947_0012882 3300035725 Bacteria 4794
456 Ga0373947_0072794 3300035725 Bacteria 2111
457 Ga0373947_0075180 3300035725 Bacteria 2079
458 Ga0373937_0000057 3300036401 Bacteria 99491
459 Ga0373937_0072294 3300036401 Bacteria 3181
460 Ga0373937_0193847 3300036401 Bacteria 1910
461 Ga0373937_0466026 3300036401 Bacteria 1200
462 Ga0373925_0000078 3300037068 Bacteria 105238
463 Ga0373925_0000883 3300037068 Bacteria 27390
464 Ga0373925_0031612 3300037068 Bacteria 3891
465 Ga0373925_0174060 3300037068 Unclassified 1700
466 Ga0373925_0368177 3300037068 Bacteria 1169
467 Ga0436365_0686548 3300039437 Bacteria 4924
468 Ga0436365_1504256 3300039437 Bacteria 1655
469 Ga0436360_0801136 3300039438 Bacteria 2691
470 Ga0436361_0180874 3300039447 Bacteria 4990
471 Ga0436363_0337307 3300039450 Bacteria 2423
472 Ga0439455_0033865 3300042012 Bacteria 1283
473 Ga0439435_0005357 3300042436 Unclassified 2818
474 Ga0439460_0008569 3300042461 Bacteria 2585
475 Ga0451577_0055660 3300042876 Bacteria 3529
476 Ga0466963_0100415 3300044694 Bacteria 1980
477 Ga0466957_0080092 3300044842 Bacteria 2033
478 Ga0451576_0086931 3300045051 Bacteria 3252
479 Ga0495592_0000233 3300046454 Bacteria 48027
480 Ga0495592_0007561 3300046454 Bacteria 8139
481 Ga0495592_0120766 3300046454 Bacteria 1844
482 Ga0495603_0014219 3300046455 Bacteria 4815
483 Ga0495629_0003366 3300046459 Bacteria 12077
484 Ga0495629_0013380 3300046459 Bacteria 5920
485 Ga0495629_0015321 3300046459 Bacteria 5505
486 Ga0495629_0047650 3300046459 Bacteria 3006
487 Ga0495638_0004882 3300046460 Bacteria 10087
488 Ga0495641_0052482 3300046461 Bacteria 1858
489 Ga0495651_0002019 3300046462 Bacteria 15670
490 Ga0495653_0000464 3300046463 Bacteria 31572
491 Ga0495653_0085298 3300046463 Bacteria 2324
492 Ga0495580_0032264 3300046472 Bacteria 3781
493 Ga0495582_0006057 3300046473 Bacteria 6739
494 Ga0495582_0104532 3300046473 Bacteria 1587
495 Ga0495662_0002050 3300046476 Bacteria 10101
496 Ga0495662_0017496 3300046476 Bacteria 3468
497 Ga0495662_0082895 3300046476 Bacteria 1560
498 Ga0495664_0000023 3300046477 Bacteria 126807
499 Ga0495664_0001080 3300046477 Bacteria 14082
500 Ga0495585_0042504 3300046492 Bacteria 2545
501 Ga0495594_0059346 3300046499 Bacteria 2115
502 Ga0495608_0000030 3300046511 Bacteria 145828
503 Ga0495608_0037491 3300046511 Bacteria 3260
504 Ga0495618_0000585 3300046514 Bacteria 25962
505 Ga0495618_0025598 3300046514 Bacteria 3662
506 Ga0495628_0000027 3300046516 Bacteria 126537
507 Ga0495628_0027611 3300046516 Bacteria 4616
508 Ga0495630_0006673 3300046517 Bacteria 8227
509 Ga0495630_0048557 3300046517 Bacteria 3176
510 Ga0495631_0098574 3300046518 Bacteria 1258
511 Ga0495666_0058415 3300046526 Bacteria 1845
512 Ga0495666_0143711 3300046526 Bacteria 1111
513 Ga0495652_0000041 3300046529 Bacteria 126519
514 Ga0495652_0023259 3300046529 Bacteria 5494
515 Ga0495640_0000056 3300046533 Bacteria 62074
516 Ga0495640_0015377 3300046533 Bacteria 5760
517 Ga0495586_0003404 3300046535 Bacteria 8532
518 Ga0495586_0063223 3300046535 Bacteria 2016
519 Ga0495587_0000025 3300046536 Bacteria 147974
520 Ga0495587_0016528 3300046536 Bacteria 4590
521 Ga0495598_0042454 3300046537 Bacteria 1335
522 Ga0495609_0083578 3300046538 Bacteria 1394
523 Ga0495645_0000001 3300046543 Bacteria 657910
524 Ga0495645_0000848 3300046543 Bacteria 20818
525 Ga0495645_0002026 3300046543 Bacteria 13788
526 Ga0495667_0000001 3300046559 Bacteria 834831
527 Ga0495667_0015999 3300046559 Bacteria 5069
528 Ga0495667_0109000 3300046559 Bacteria 1789
529 Ga0495667_0188570 3300046559 Bacteria 1322
530 Ga0495634_0017149 3300046642 Bacteria 5171
531 Ga0495634_0028035 3300046642 Bacteria 3912
532 Ga0495634_0058248 3300046642 Bacteria 2575
533 Ga0495634_0067382 3300046642 Bacteria 2368
534 Ga0495611_0014721 3300046648 Bacteria 3345
535 Ga0495635_0000077 3300046663 Bacteria 60215
536 Ga0495635_0002760 3300046663 Bacteria 12036
537 Ga0495635_0010039 3300046663 Bacteria 6620
538 Ga0495659_0012483 3300046664 Bacteria 2752
539 Ga0495661_0109661 3300046665 Bacteria 1540
540 Ga0495657_0000390 3300046675 Bacteria 40745
541 Ga0495657_0097408 3300046675 Bacteria 1878
542 Ga0495657_0256459 3300046675 Bacteria 1052
543 Ga0495657_0266054 3300046675 Bacteria 1029
544 Ga0495599_0000021 3300046678 Bacteria 127591
545 Ga0495599_0007257 3300046678 Bacteria 6715
546 Ga0495599_0126512 3300046678 Bacteria 1588
547 Ga0495623_0000141 3300046679 Bacteria 44491
548 Ga0495623_0058657 3300046679 Bacteria 2420
549 Ga0495646_0000051 3300046680 Bacteria 60085
550 Ga0495646_0028864 3300046680 Bacteria 3471
551 Ga0495647_0019612 3300046681 Bacteria 2419
552 Ga0495658_0030875 3300046683 Plasmid 2913
553 Ga0495658_0061145 3300046683 Bacteria 2162
554 Ga0495658_0131855 3300046683 Bacteria 1522
555 Ga0495613_0008553 3300046689 Bacteria 7597
556 Ga0495613_0029492 3300046689 Bacteria 4079
557 Ga0495613_0045741 3300046689 Bacteria 3236
558 Ga0495613_0132733 3300046689 Bacteria 1782
559 Ga0495624_0001090 3300046690 Bacteria 21458
560 Ga0495624_0030238 3300046690 Bacteria 3529
561 Ga0495624_0163665 3300046690 Bacteria 1358
562 Ga0495600_0000114 3300046809 Bacteria 44972
563 Ga0495600_0089510 3300046809 Bacteria 2008
564 Ga0495581_0037777 3300047315 Bacteria 2794
565 Ga0495581_0214116 3300047315 Bacteria 1126
566 Ga0495604_0000036 3300047317 Bacteria 126707
567 Ga0495604_0193338 3300047317 Bacteria 1416
568 Ga0495674_0000102 3300047319 Bacteria 62602
569 Ga0495674_0006766 3300047319 Bacteria 10974
570 Ga0495674_0021884 3300047319 Bacteria 5906
571 Ga0495674_0155901 3300047319 Bacteria 1913
572 Ga0495676_0045462 3300047321 Bacteria 3573
573 Ga0495676_0058309 3300047321 Bacteria 3038
574 Ga0495676_0098627 3300047321 Bacteria 2167
575 Ga0495680_0001061 3300047322 Bacteria 30436
576 Ga0495680_0036206 3300047322 Bacteria 3965
577 Ga0495680_0065048 3300047322 Bacteria 2794
578 Ga0495680_0212499 3300047322 Bacteria 1384
579 Ga0495675_0000148 3300047444 Bacteria 49201
580 Ga0495679_026891 3300047446 Bacteria 1905
581 Ga0495684_0000025 3300047471 Bacteria 127037
582 Ga0495684_0002541 3300047471 Bacteria 14533
583 Ga0495684_0006682 3300047471 Bacteria 8948
584 Ga0495684_0045604 3300047471 Plasmid 3355
585 Ga0495684_0062291 3300047471 Unclassified 2837
586 Ga0495593_0011539 3300047673 Bacteria 5072
587 Ga0495602_0000311 3300048088 Bacteria 44943
588 Ga0495602_0033768 3300048088 Bacteria 4795
589 Ga0495602_0149661 3300048088 Bacteria 1837
590 Ga0495614_0097570 3300048089 Bacteria 1282
591 Ga0496100_0000400 3300048903 Bacteria 20959
592 Ga0496100_0003748 3300048903 Bacteria 7959
593 Ga0496101_0000151 3300048904 Bacteria 59751
594 Ga0496101_0001763 3300048904 Bacteria 12984
595 Ga0496102_0002633 3300048905 Bacteria 15255
596 Ga0496102_0011817 3300048905 Bacteria 7536
597 Ga0496102_0100556 3300048905 Bacteria 2686
598 Ga0496102_0241220 3300048905 Unclassified 1704
599 Ga0496102_0272908 3300048905 Bacteria 1594
600 Ga0496103_0000589 3300048906 Bacteria 28631
601 Ga0496103_0165242 3300048906 Bacteria 1420
602 Ga0496104_0000215 3300048907 Bacteria 50960
603 Ga0496104_0002323 3300048907 Bacteria 16428
604 Ga0496104_0032419 3300048907 Bacteria 4862
605 Ga0496104_0039113 3300048907 Bacteria 4440
606 Ga0496105_0005561 3300048908 Bacteria 9570
607 Ga0496105_0013570 3300048908 Bacteria 6470
608 Ga0496105_0181999 3300048908 Bacteria 1720
609 Ga0496105_0188686 3300048908 Bacteria 1686
610 Ga0496106_0005428 3300048909 Bacteria 9431
611 Ga0496106_0060648 3300048909 Bacteria 2867
612 Ga0496106_0061643 3300048909 Bacteria 2846
613 Ga0496106_0073336 3300048909 Bacteria 2619
614 Ga0496107_0000959 3300048910 Bacteria 17091
615 Ga0496107_0010740 3300048910 Bacteria 6369
616 Ga0496108_0008895 3300048911 Bacteria 8140
617 Ga0496108_0010986 3300048911 Bacteria 7354
618 Ga0496108_0099240 3300048911 Bacteria 2482
619 Ga0496109_0000186 3300048912 Bacteria 62084
620 Ga0496109_0009764 3300048912 Bacteria 8191
621 Ga0496109_0012979 3300048912 Bacteria 7201
622 Ga0496109_0016348 3300048912 Bacteria 6484
623 Ga0496109_0030370 3300048912 Bacteria 4844
624 Ga0496109_0133580 3300048912 Bacteria 2317
625 Ga0496110_0002430 3300048913 Bacteria 13955
626 Ga0496110_0008784 3300048913 Bacteria 8141
627 Ga0496110_0013927 3300048913 Bacteria 6663
628 Ga0496110_0022421 3300048913 Bacteria 5361
629 Ga0496110_0469606 3300048913 Bacteria 1146
630 Ga0496111_0003314 3300048914 Bacteria 9963
631 Ga0496112_0008924 3300048915 Bacteria 8999
632 Ga0496112_0016056 3300048915 Bacteria 7001
633 Ga0496112_0150966 3300048915 Bacteria 2291
634 Ga0496113_0001663 3300048916 Bacteria 12569
635 Ga0496113_0017290 3300048916 Bacteria 5002
636 Ga0496113_0057454 3300048916 Bacteria 2924
637 Ga0496114_0005496 3300048917 Bacteria 9922
638 Ga0496114_0225814 3300048917 Bacteria 1644
639 Ga0496115_0000855 3300048918 Bacteria 22097
640 Ga0496115_0002326 3300048918 Bacteria 13618
641 Ga0501031_0014196 3300049568 Bacteria 5183
642 Ga0501033_0017988 3300049570 Bacteria 5336
643 Ga0501037_0014525 3300049573 Bacteria 5792
644 Ga0501038_0154771 3300049574 Bacteria 1867
645 Ga0501039_0018275 3300049575 Bacteria 5380
646 Ga0501040_0173808 3300049576 Bacteria 1526
647 Ga0501042_0153894 3300049578 Bacteria 1658
648 Ga0501046_0014888 3300049580 Bacteria 6545
649 Ga0501048_0006384 3300049582 Bacteria 8963
650 Ga0501067_0051208 3300049583 Bacteria 2289
651 Ga0501068_0002435 3300049584 Bacteria 9877
652 Ga0501069_0001787 3300049585 Bacteria 10754
653 Ga0501070_0097961 3300049586 Bacteria 2425
654 Ga0501071_0015093 3300049587 Bacteria 5297
655 Ga0501073_0251236 3300049589 Bacteria 1220
656 Ga0501074_0012445 3300049590 Bacteria 6184
657 Ga0501076_0021925 3300049592 Bacteria 4905
658 Ga0501077_0054567 3300049593 Bacteria 2538
659 Ga0501077_0119622 3300049593 Bacteria 1669
660 Ga0501079_0077326 3300049741 Bacteria 2574
661 Ga0501083_0076376 3300049744 Bacteria 2223
662 Ga0501035_0043099 3300049822 Bacteria 4067
663 Ga0501044_0097834 3300049823 Bacteria 2955
664 Ga0501044_0226538 3300049823 Bacteria 1818
665 Ga0501045_0023317 3300049824 Bacteria 4436
666 nmdc:mga0yw44_141469_c1 3300050492 Bacteria 1564
667 nmdc:mga06z11_16197_c1 3300050494 Bacteria 3351
668 nmdc:mga08y16_1219_c1 3300050511 Bacteria 25435
669 nmdc:mga08y16_238840_c1 3300050511 Bacteria 1878
670 nmdc:mga08y16_311_c1 3300050511 Bacteria 43954
671 nmdc:mga08y16_395158_c1 3300050511 Bacteria 1416
672 nmdc:mga08y16_63655_c1 3300050511 Unclassified 3852
673 nmdc:mga0n895_127108_c1 3300050512 Bacteria 2573
674 nmdc:mga0n895_150301_c1 3300050512 Bacteria 2359
675 nmdc:mga0n895_2692_c1 3300050512 Bacteria 14019
676 nmdc:mga0n895_30476_c1 3300050512 Bacteria 5156
677 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
678 nmdc:mga0n895_85451_c1 3300050512 Bacteria 3150
679 nmdc:mga0n895_90699_c1 3300050512 Bacteria 3058
680 nmdc:mga0rr50_14446_c1 3300050513 Bacteria 5180
681 nmdc:mga0rr50_62367_c1 3300050513 Bacteria 2812
682 nmdc:mga08x19_4336_c1 3300050514 Bacteria 8405
683 nmdc:mga0a205_153067_c1 3300050515 Bacteria 2205
684 nmdc:mga0a205_2030_c1 3300050515 Bacteria 17685
685 nmdc:mga0a205_317741_c1 3300050515 Bacteria 1428
686 Ga0495601_0000025 3300053077 Bacteria 127736
687 Ga0495601_0000799 3300053077 Bacteria 17005
688 Ga0495601_0010538 3300053077 Bacteria 5504
689 Ga0495601_0039266 3300053077 Bacteria 2964
690 Ga0495601_0041999 3300053077 Bacteria 2868
691 Ga0495601_0101875 3300053077 Bacteria 1855
692 Ga0495612_0000046 3300053078 Bacteria 59912
693 Ga0495612_0000111 3300053078 Bacteria 34638
694 Ga0495612_0006780 3300053078 Bacteria 4691
695 Ga0495655_0006491 3300053083 Bacteria 2128
696 Ga0495595_0000054 3300053084 Bacteria 59828
697 Ga0495595_0045303 3300053084 Bacteria 2023
698 Ga0495595_0049973 3300053084 Bacteria 1935
699 Ga0495595_0133903 3300053084 Bacteria 1213
700 Ga0495619_0000035 3300053085 Bacteria 126262
701 Ga0495619_0027682 3300053085 Bacteria 3653
702 Ga0495619_0042133 3300053085 Bacteria 2988
703 Ga0501082_0209851 3300060353 Bacteria 1694
704 Ga0501082_0244594 3300060353 Bacteria 1561
705 Ga0157380_10185834
706 2214745219
707 ARSoilYngRDRAFT_c00268
708 ARcpr5yngRDRAFT_c000083
709 ARcpr5yngRDRAFT_c000130
710 ARSoilOldRDRAFT_c000077
711 ARCol0yngRDRAFT_1000003
712 JGI24741J21665_1010919
713 JGI24746J21847_1000172
714 JGI24739J22299_10002161
715 JGI24737J22298_10002605
716 JGI24737J22298_10004159
717 JGI24750J21931_1000256
718 JGI24745J21846_1008664
719 JGI24748J21848_1000381
720 JGI24738J21930_10000425
721 JGI24749J21850_1001974
722 JGI24035J26624_1000008
723 JGI24035J26624_1000030
724 JGI24751J29686_10005576
725 JGI25406J46586_10024660
726 JGI26145J50221_1002475
727 JGI25405J52794_10033288
728 Ga0065716_1001562
729 Ga0065704_10079631
730 Ga0065712_10000247
731 Ga0065712_10069581
732 Ga0065715_10090800
733 Ga0070658_10132885
734 Ga0070676_10000036
735 Ga0070676_10020980
736 Ga0070683_100002049
737 Ga0070683_100285309
738 Ga0070690_100001849
739 Ga0070670_100003778
740 Ga0070677_10000104
741 Ga0068869_100000087
742 Ga0068869_100235469
743 Ga0070680_100003276
744 Ga0070680_100105591
745 Ga0070682_100000341
746 Ga0068868_100025389
747 Ga0070660_100006206
748 Ga0070660_100084732
749 Ga0070660_100198860
750 Ga0070689_100000963
751 Ga0070689_100002790
752 Ga0070691_10000518
753 Ga0070691_10060275
754 Ga0070687_100000245
755 Ga0070687_100017541
756 Ga0070687_100078543
757 Ga0070661_100000017
758 Ga0070661_100230987
759 Ga0070692_10003367
760 Ga0070692_10003914
761 Ga0070668_100001356
762 Ga0070668_100096942
763 Ga0070669_100000217
764 Ga0070669_100038543
765 Ga0070675_100000088
766 Ga0070675_100495057
767 Ga0070671_100000768
768 Ga0070671_100100518
769 Ga0070674_100000623
770 Ga0070673_100000239
771 Ga0070688_100000084
772 Ga0070688_100193923
773 Ga0070688_100255013
774 Ga0070659_100000252
775 Ga0070659_100122428
776 Ga0070667_100003023
777 Ga0070709_10010014
778 Ga0070709_10047656
779 Ga0070714_100114788
780 Ga0070713_100002359
781 Ga0070713_100087274
782 Ga0070713_100088931
783 Ga0070713_100111681
784 Ga0070710_10208523
785 Ga0070701_10010531
786 Ga0070701_10026873
787 Ga0070711_100048327
788 Ga0070711_100091039
789 Ga0070711_100093628
790 Ga0070711_100289900
791 Ga0070705_100000425
792 Ga0070705_100036888
793 Ga0070700_100000370
794 Ga0070700_100260020
795 Ga0070694_100000401
796 Ga0070694_100097071
797 Ga0070708_100004439
798 Ga0070708_100098455
799 Ga0070663_100000415
800 Ga0070678_100000053
801 Ga0070662_100003931
802 Ga0070662_100146016
803 Ga0070681_10000493
804 Ga0070681_10004194
805 Ga0070681_10326374
806 Ga0070681_10436233
807 Ga0068867_100001581
808 Ga0070685_10012006
809 Ga0070679_100000679
810 Ga0070679_100009527
811 Ga0070679_100112073
812 Ga0070679_100144710
813 Ga0070684_100000144
814 Ga0068853_100005864
815 Ga0070672_100000014
816 Ga0070672_100121769
817 Ga0070686_100000754
818 Ga0070686_100022707
819 Ga0070695_100000743
820 Ga0070696_100000918
821 Ga0070696_100073748
822 Ga0070693_100000141
823 Ga0070665_100294999
824 Ga0070704_100064769
825 Ga0070704_100096887
826 Ga0068855_100009106
827 Ga0068855_100108304
828 Ga0070664_100000816
829 Ga0070664_100053558
830 Ga0068857_100000567
831 Ga0068854_100000168
832 Ga0068856_100143631
833 Ga0070702_100000857
834 Ga0068852_100002066
835 Ga0068852_100052192
836 Ga0068859_100012990
837 Ga0068859_100162636
838 Ga0068859_100247647
839 Ga0068864_100000980
840 Ga0068866_10000264
841 Ga0068861_100000315
842 Ga0068861_100395829
843 Ga0068870_10000002
844 Ga0068863_100001290
845 Ga0068858_100000356
846 Ga0068858_100150298
847 Ga0068860_100000747
848 Ga0068860_100138100
849 Ga0068860_100379873
850 Ga0068862_100002002
851 Ga0068862_100346524
852 Ga0081455_10000048
853 Ga0081455_10000369
854 Ga0081455_10016383
855 Ga0081540_1006164
856 Ga0081539_10002225
857 Ga0070717_10009878
858 Ga0070717_10093129
859 Ga0070717_10167220
860 Ga0075365_10225635
861 Ga0070715_10000513
862 Ga0070716_100056116
863 Ga0070716_100121550
864 Ga0070712_100029497
865 Ga0070712_100081098
866 Ga0070712_100178419
867 Ga0075367_10012917
868 Ga0097621_100000144
869 Ga0068871_100000110
870 Ga0075428_100084138
871 Ga0075430_100094974
872 Ga0075431_100115216
873 Ga0075433_10026099
874 Ga0075433_10133112
875 Ga0075434_100000084
876 Ga0075434_100043477
877 Ga0075434_100053336
878 Ga0075434_100057142
879 Ga0075434_100145571
880 Ga0075434_100359687
881 Ga0068865_100000066
882 Ga0068865_100078367
883 Ga0075436_100012722
884 Ga0097620_100012990
885 Ga0097620_100162629
886 Ga0097620_100247649
887 Ga0075435_100028540
888 Ga0075435_100077114
889 Ga0075435_100281005
890 Ga0099794_10038178
891 Ga0105240_10408797
892 Ga0111539_10000652
893 Ga0111539_10001255
894 Ga0111539_10030559
895 Ga0111539_10515911
896 Ga0105245_10000287
897 Ga0105247_10001223
898 Ga0105247_10120013
899 Ga0114129_10092448
900 Ga0105243_10000695
901 Ga0105243_10053738
902 Ga0105241_10002331
903 Ga0105241_10106605
904 Ga0105242_10000792
905 Ga0105248_10000535
906 Ga0105237_10002795
907 Ga0105238_10181825
908 Ga0105249_10000279
909 Ga0105249_10003839
910 Ga0105249_10018980
911 Ga0105249_10441238
912 Ga0099796_10004966
913 Ga0105239_10001686
914 Ga0105246_10000095
915 Ga0105246_10302262
916 Ga0157373_10050116
917 Ga0157373_10062875
918 Ga0157371_10148569
919 Ga0157374_10001348
920 Ga0157378_10000956
921 Ga0163162_10003795
922 Ga0163162_10042395
923 Ga0163162_10147815
924 Ga0163162_10354099
925 Ga0157372_10445281
926 Ga0157372_10639429
927 Ga0157375_10001973
928 Ga0163163_10055839
929 Ga0163163_10187980
930 Ga0157380_10000052
931 Ga0157380_10189714
932 Ga0157380_10252784
933 Ga0157380_10537572
934 Ga0157377_10000076
935 Ga0157379_10000060
936 Ga0157379_10364183
937 Ga0157379_10432425
938 Ga0157376_10000141
939 Ga0163161_10000739
940 Ga0163161_10067121
941 Ga0163161_10206041
942 Ga0213876_10044059
943 Ga0213876_10062025
944 Ga0213871_10003427
945 Ga0207666_1000005
946 Ga0207673_1007698
947 Ga0209758_1000569
948 Ga0209758_1040673
949 Ga0207697_10000011
950 Ga0207682_10000051
951 Ga0207692_10235758
952 Ga0207642_10000176
953 Ga0207710_10001284
954 Ga0207688_10000001
955 Ga0207680_10002846
956 Ga0207647_10001714
957 Ga0207647_10037247
958 Ga0207699_10008926
959 Ga0207699_10088943
960 Ga0207699_10269612
961 Ga0207699_10345010
962 Ga0207645_10000121
963 Ga0207645_10023007
964 Ga0207643_10000009
965 Ga0207654_10001894
966 Ga0207707_10000840
967 Ga0207707_10145090
968 Ga0207695_10168202
969 Ga0207671_10007485
970 Ga0207693_10009486
971 Ga0207693_10016164
972 Ga0207693_10086779
973 Ga0207693_10187356
974 Ga0207693_10314300
975 Ga0207660_10000775
976 Ga0207660_10018073
977 Ga0207660_10028511
978 Ga0207660_10115673
979 Ga0207662_10004796
980 Ga0207662_10036635
981 Ga0207662_10085916
982 Ga0207657_10002826
983 Ga0207657_10058352
984 Ga0207657_10194924
985 Ga0207649_10000052
986 Ga0207652_10000508
987 Ga0207652_10077681
988 Ga0207681_10000035
989 Ga0207681_10091313
990 Ga0207694_10304962
991 Ga0207650_10000843
992 Ga0207650_10299777
993 Ga0207659_10000027
994 Ga0207659_10080425
995 Ga0207687_10000231
996 Ga0207700_10056459
997 Ga0207700_10103773
998 Ga0207700_10113292
999 Ga0207664_10135847
1000 Ga0207664_10447261
1001 Ga0207644_10000676
1002 Ga0207644_10138860
1003 Ga0207690_10000148
1004 Ga0207690_10039516
1005 Ga0207706_10000261
1006 Ga0207706_10004416
1007 Ga0207686_10000171
1008 Ga0207686_10154470
1009 Ga0207709_10000087
1010 Ga0207670_10000169
1011 Ga0207669_10000351
1012 Ga0207704_10108023
1013 Ga0207665_10047303
1014 Ga0207665_10118141
1015 Ga0207665_10152955
1016 Ga0207691_10000106
1017 Ga0207691_10087419
1018 Ga0207711_10002556
1019 Ga0207711_10004928
1020 Ga0207689_10000031
1021 Ga0207661_10000219
1022 Ga0207661_10119454
1023 Ga0207661_10409559
1024 Ga0207679_10000493
1025 Ga0207679_10156400
1026 Ga0207679_10344975
1027 Ga0207667_10006216
1028 Ga0207667_10369955
1029 Ga0207651_10001402
1030 Ga0207712_10000176
1031 Ga0207712_10096789
1032 Ga0207668_10000191
1033 Ga0207668_10024956
1034 Ga0207640_10000126
1035 Ga0207658_10007487
1036 Ga0207677_10148612
1037 Ga0207703_10006871
1038 Ga0207703_10165806
1039 Ga0207639_10000515
1040 Ga0207639_10105661
1041 Ga0207678_10000137
1042 Ga0207708_10000250
1043 Ga0207708_10030828
1044 Ga0207708_10056648
1045 Ga0207708_10381057
1046 Ga0207702_10001067
1047 Ga0207641_10000937
1048 Ga0207648_10000125
1049 Ga0207676_10001547
1050 Ga0207676_10283061
1051 Ga0207674_10000095
1052 Ga0207675_100000140
1053 Ga0207675_100092410
1054 Ga0207683_10000178
1055 Ga0207698_10001736
1056 Ga0210002_1000669
1057 Ga0209971_1004192
1058 Ga0209998_10004186
1059 Ga0209974_10001253
1060 Ga0207428_10000037
1061 Ga0207428_10001468
1062 Ga0207428_10160821
1063 Ga0207428_10290318
1064 Ga0265357_1000316
1065 Ga0268266_10165528
1066 Ga0268266_10284625
1067 Ga0268265_10000774
1068 Ga0268265_10124096
1069 Ga0268265_10215496
1070 Ga0268264_10000467
1071 Ga0268264_10321074
1072 Ga0265318_10010190
1073 Ga0265338_10074675
1074 Ga0265760_10016365
1075 Ga0265330_10020216
1076 Ga0265325_10000049
1077 Ga0265325_10042630
1078 Ga0265329_10023207
1079 Ga0265340_10002924
1080 Ga0265339_10000269
1081 Ga0265339_10009320
1082 Ga0265331_10038705
1083 Ga0265316_10026116
1084 Ga0265316_10129965
1085 Ga0265313_10021626
1086 Ga0265313_10038029
1087 Ga0265313_10107202
1088 Ga0265314_10064629
1089 Ga0265342_10037995
1090 Ga0373930_0000027
1091 Ga0373948_0000257
1092 Ga0373948_0018042
1093 Ga0373950_0004090
1094 Ga0373958_0000466
1095 Ga0373958_0000674
1096 Ga0373959_0000673
1097 Ga0373959_0004580
1098 Ga0373938_0000020
1099 Ga0373938_0000687
1100 Ga0373938_0003245
1101 Ga0373928_0000298
1102 Ga0373928_0012217
1103 Ga0373929_0001530
1104 Ga0373929_0004695
1105 Ga0373934_0137276
1106 Ga0373940_0000080
1107 Ga0373944_0007656
1108 Ga0373949_0000753
1109 Ga0373951_0001678
1110 Ga0373951_0006554
1111 Ga0373952_0000333
1112 Ga0373952_0001012
1113 Ga0373923_0000919
1114 Ga0373923_0016700
1115 Ga0373923_0019172
1116 Ga0373932_0000316
1117 Ga0373932_0034846
1118 Ga0373936_0002231
1119 Ga0373936_0005828
1120 Ga0373936_0064866
1121 Ga0373941_0000521
1122 Ga0373941_0026267
1123 Ga0373945_0002741
1124 Ga0373945_0011515
1125 Ga0373945_0038968
1126 Ga0373953_0001774
1127 Ga0373956_0079186
1128 Ga0373960_0008241
1129 Ga0373943_0000069
1130 Ga0373943_0015861
1131 Ga0373943_0017222
1132 Ga0373943_0018775
1133 Ga0373946_0000379
1134 Ga0373946_0002835
1135 Ga0373946_0017700
1136 Ga0373955_0000643
1137 Ga0373955_0023393
1138 Ga0373942_0000054
1139 Ga0373942_0001029
1140 Ga0373961_0000807
1141 Ga0373961_0019802
1142 Ga0373924_0000604
1143 Ga0373931_0000933
1144 Ga0373931_0021889
1145 Ga0373931_0175515
1146 Ga0373935_0000075
1147 Ga0373935_0013888
1148 Ga0373935_0046279
1149 Ga0373935_0127810
1150 Ga0373935_0141812
1151 Ga0373935_0185291
1152 Ga0373927_0003619
1153 Ga0373927_0004392
1154 Ga0373927_0007963
1155 Ga0373927_0024002
1156 Ga0373927_0136110
1157 Ga0373947_0000138
1158 Ga0373947_0007756
1159 Ga0373947_0012882
1160 Ga0373947_0072794
1161 Ga0373947_0075180
1162 Ga0373937_0000057
1163 Ga0373937_0072294
1164 Ga0373937_0193847
1165 Ga0373937_0466026
1166 Ga0373925_0000078
1167 Ga0373925_0000883
1168 Ga0373925_0031612
1169 Ga0373925_0174060
1170 Ga0373925_0368177
1171 Ga0436365_0686548
1172 Ga0436365_1504256
1173 Ga0436360_0801136
1174 Ga0436361_0180874
1175 Ga0436363_0337307
1176 Ga0439455_0033865
1177 Ga0439435_0005357
1178 Ga0439460_0008569
1179 Ga0451577_0055660
1180 Ga0466963_0100415
1181 Ga0466957_0080092
1182 Ga0451576_0086931
1183 Ga0495592_0000233
1184 Ga0495592_0007561
1185 Ga0495592_0120766
1186 Ga0495603_0014219
1187 Ga0495629_0003366
1188 Ga0495629_0013380
1189 Ga0495629_0015321
1190 Ga0495629_0047650
1191 Ga0495638_0004882
1192 Ga0495641_0052482
1193 Ga0495651_0002019
1194 Ga0495653_0000464
1195 Ga0495653_0085298
1196 Ga0495580_0032264
1197 Ga0495582_0006057
1198 Ga0495582_0104532
1199 Ga0495662_0002050
1200 Ga0495662_0017496
1201 Ga0495662_0082895
1202 Ga0495664_0000023
1203 Ga0495664_0001080
1204 Ga0495585_0042504
1205 Ga0495594_0059346
1206 Ga0495608_0000030
1207 Ga0495608_0037491
1208 Ga0495618_0000585
1209 Ga0495618_0025598
1210 Ga0495628_0000027
1211 Ga0495628_0027611
1212 Ga0495630_0006673
1213 Ga0495630_0048557
1214 Ga0495631_0098574
1215 Ga0495666_0058415
1216 Ga0495666_0143711
1217 Ga0495652_0000041
1218 Ga0495652_0023259
1219 Ga0495640_0000056
1220 Ga0495640_0015377
1221 Ga0495586_0003404
1222 Ga0495586_0063223
1223 Ga0495587_0000025
1224 Ga0495587_0016528
1225 Ga0495598_0042454
1226 Ga0495609_0083578
1227 Ga0495645_0000001
1228 Ga0495645_0000848
1229 Ga0495645_0002026
1230 Ga0495667_0000001
1231 Ga0495667_0015999
1232 Ga0495667_0109000
1233 Ga0495667_0188570
1234 Ga0495634_0017149
1235 Ga0495634_0028035
1236 Ga0495634_0058248
1237 Ga0495634_0067382
1238 Ga0495611_0014721
1239 Ga0495635_0000077
1240 Ga0495635_0002760
1241 Ga0495635_0010039
1242 Ga0495659_0012483
1243 Ga0495661_0109661
1244 Ga0495657_0000390
1245 Ga0495657_0097408
1246 Ga0495657_0256459
1247 Ga0495657_0266054
1248 Ga0495599_0000021
1249 Ga0495599_0007257
1250 Ga0495599_0126512
1251 Ga0495623_0000141
1252 Ga0495623_0058657
1253 Ga0495646_0000051
1254 Ga0495646_0028864
1255 Ga0495647_0019612
1256 Ga0495658_0030875
1257 Ga0495658_0061145
1258 Ga0495658_0131855
1259 Ga0495613_0008553
1260 Ga0495613_0029492
1261 Ga0495613_0045741
1262 Ga0495613_0132733
1263 Ga0495624_0001090
1264 Ga0495624_0030238
1265 Ga0495624_0163665
1266 Ga0495600_0000114
1267 Ga0495600_0089510
1268 Ga0495581_0037777
1269 Ga0495581_0214116
1270 Ga0495604_0000036
1271 Ga0495604_0193338
1272 Ga0495674_0000102
1273 Ga0495674_0006766
1274 Ga0495674_0021884
1275 Ga0495674_0155901
1276 Ga0495676_0045462
1277 Ga0495676_0058309
1278 Ga0495676_0098627
1279 Ga0495680_0001061
1280 Ga0495680_0036206
1281 Ga0495680_0065048
1282 Ga0495680_0212499
1283 Ga0495675_0000148
1284 Ga0495679_026891
1285 Ga0495684_0000025
1286 Ga0495684_0002541
1287 Ga0495684_0006682
1288 Ga0495684_0045604
1289 Ga0495684_0062291
1290 Ga0495593_0011539
1291 Ga0495602_0000311
1292 Ga0495602_0033768
1293 Ga0495602_0149661
1294 Ga0495614_0097570
1295 Ga0496100_0000400
1296 Ga0496100_0003748
1297 Ga0496101_0000151
1298 Ga0496101_0001763
1299 Ga0496102_0002633
1300 Ga0496102_0011817
1301 Ga0496102_0100556
1302 Ga0496102_0241220
1303 Ga0496102_0272908
1304 Ga0496103_0000589
1305 Ga0496103_0165242
1306 Ga0496104_0000215
1307 Ga0496104_0002323
1308 Ga0496104_0032419
1309 Ga0496104_0039113
1310 Ga0496105_0005561
1311 Ga0496105_0013570
1312 Ga0496105_0181999
1313 Ga0496105_0188686
1314 Ga0496106_0005428
1315 Ga0496106_0060648
1316 Ga0496106_0061643
1317 Ga0496106_0073336
1318 Ga0496107_0000959
1319 Ga0496107_0010740
1320 Ga0496108_0008895
1321 Ga0496108_0010986
1322 Ga0496108_0099240
1323 Ga0496109_0000186
1324 Ga0496109_0009764
1325 Ga0496109_0012979
1326 Ga0496109_0016348
1327 Ga0496109_0030370
1328 Ga0496109_0133580
1329 Ga0496110_0002430
1330 Ga0496110_0008784
1331 Ga0496110_0013927
1332 Ga0496110_0022421
1333 Ga0496110_0469606
1334 Ga0496111_0003314
1335 Ga0496112_0008924
1336 Ga0496112_0016056
1337 Ga0496112_0150966
1338 Ga0496113_0001663
1339 Ga0496113_0017290
1340 Ga0496113_0057454
1341 Ga0496114_0005496
1342 Ga0496114_0225814
1343 Ga0496115_0000855
1344 Ga0496115_0002326
1345 Ga0501031_0014196
1346 Ga0501033_0017988
1347 Ga0501037_0014525
1348 Ga0501038_0154771
1349 Ga0501039_0018275
1350 Ga0501040_0173808
1351 Ga0501042_0153894
1352 Ga0501046_0014888
1353 Ga0501048_0006384
1354 Ga0501067_0051208
1355 Ga0501068_0002435
1356 Ga0501069_0001787
1357 Ga0501070_0097961
1358 Ga0501071_0015093
1359 Ga0501073_0251236
1360 Ga0501074_0012445
1361 Ga0501076_0021925
1362 Ga0501077_0054567
1363 Ga0501077_0119622
1364 Ga0501079_0077326
1365 Ga0501083_0076376
1366 Ga0501035_0043099
1367 Ga0501044_0097834
1368 Ga0501044_0226538
1369 Ga0501045_0023317
1370 nmdc:mga0yw44_141469_c1
1371 nmdc:mga06z11_16197_c1
1372 nmdc:mga08y16_1219_c1
1373 nmdc:mga08y16_238840_c1
1374 nmdc:mga08y16_311_c1
1375 nmdc:mga08y16_395158_c1
1376 nmdc:mga08y16_63655_c1
1377 nmdc:mga0n895_127108_c1
1378 nmdc:mga0n895_150301_c1
1379 nmdc:mga0n895_2692_c1
1380 nmdc:mga0n895_30476_c1
1381 nmdc:mga0n895_62_c1
1382 nmdc:mga0n895_85451_c1
1383 nmdc:mga0n895_90699_c1
1384 nmdc:mga0rr50_14446_c1
1385 nmdc:mga0rr50_62367_c1
1386 nmdc:mga08x19_4336_c1
1387 nmdc:mga0a205_153067_c1
1388 nmdc:mga0a205_2030_c1
1389 nmdc:mga0a205_317741_c1
1390 Ga0495601_0000025
1391 Ga0495601_0000799
1392 Ga0495601_0010538
1393 Ga0495601_0039266
1394 Ga0495601_0041999
1395 Ga0495601_0101875
1396 Ga0495612_0000046
1397 Ga0495612_0000111
1398 Ga0495612_0006780
1399 Ga0495655_0006491
1400 Ga0495595_0000054
1401 Ga0495595_0045303
1402 Ga0495595_0049973
1403 Ga0495595_0133903
1404 Ga0495619_0000035
1405 Ga0495619_0027682
1406 Ga0495619_0042133
1407 Ga0501082_0209851
1408 Ga0501082_0244594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02239

Cytochrom_D1

Cytochrome D1 heme domain

134

342

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l0q-assembly3.cif.gz_C tandem yvtn beta-propeller and pkd domains from an archaeal surface layer protein 0.8904 21 321
6ah0-assembly1.cif.gz_K the cryo-em structure of the precusor of human pre-catalytic spliceosome (pre-b complex) 0.8836 48 317
8c6j-assembly1.cif.gz_J human spliceosomal pm5 c* complex 0.8768 52 314
7znk-assembly1.cif.gz_C structure of an endogenous human trex complex bound to mrna 0.8739 41 316
5lqw-assembly1.cif.gz_K yeast activated spliceosome 0.8729 56 312
ID Description Score Start End Superfamily
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9092 96 200 2.40.10.500
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9012 96 200 2.40.10.500
af_Q54TV0_1056_1281_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8945 160 311 2.130.10.10
af_Q79FU2_202_331_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.885 94 207 2.40.10.500
1l0qD01 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8809 21 321 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A537L0Q5-F1-model_v4 YncE family protein 0.9934 21 323
AF-A0A537SD20-F1-model_v4 Surface layer protein 0.9855 59 323
AF-A0A537L0Q5-F1-model_v4 YncE family protein 0.9837 21 323
AF-A0A537SD20-F1-model_v4 Surface layer protein 0.9819 59 323
AF-A0A0U3UUZ8-F1-model_v4 WD40 repeat domain-containing protein 0.9744 21 323

Map