F476356

General Info

Members Datasets Scaffolds Average Seq Length
704 347 1408 192

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10152330|Ga0213874_101523301
Length 216
Sequence MLDRREFVNKLLAGRKNLLVVSGLGSPTYDVAACGDHPLNFYLWGAMGSAAMIGLGLALARPAHRVLVLTGDGEALMGLGSLATIGVKQPANLVIVVLDNQHYGETGMQPSHTHAGVDLVAVAKACKFADGLHLSDIAAVSRTKHLVHNGAGPILVQARISNDAAPRVLPIRDGHAIKLRFMEALGRVADQERAPAEAGMSHSHGLPSTDPVCPQG

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
324 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
331 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
332 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
333 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
340 2854911287 Brucella lupini LUP21 Isolate Unclassified
341 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
342 2922368715
343 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
344 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
345 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
346 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
347 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.14
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.65
Nodule 0.43
Rhizoplane 2.7
Rhizosphere 82.39
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10152330 3300021377 Bacteria 807
2 JGI25153J46596_10000042 3300003215 Bacteria 161788
3 JGI25153J46596_10001329 3300003215 Bacteria 14787
4 JGI25405J52794_10004460 3300003911 Bacteria 2500
5 Ga0070683_100711250 3300005329 Bacteria 962
6 Ga0070690_100301168 3300005330 Bacteria 1150
7 Ga0070690_100310171 3300005330 Bacteria 1134
8 Ga0070670_100000018 3300005331 Bacteria 221691
9 Ga0070670_100555938 3300005331 Bacteria 1024
10 Ga0068869_100007064 3300005334 Bacteria 7148
11 Ga0068869_100036456 3300005334 Bacteria 3492
12 Ga0068869_100087591 3300005334 Bacteria 2336
13 Ga0070666_10021080 3300005335 Bacteria 4220
14 Ga0070666_10591036 3300005335 Unclassified 810
15 Ga0070680_100452119 3300005336 Bacteria 1097
16 Ga0070682_100414514 3300005337 Bacteria 1022
17 Ga0068868_100337116 3300005338 Bacteria 1288
18 Ga0070660_100603254 3300005339 Bacteria 918
19 Ga0070687_100035957 3300005343 Unclassified 2464
20 Ga0070668_100036565 3300005347 Bacteria 3748
21 Ga0070669_100036683 3300005353 Bacteria 3554
22 Ga0070675_100075331 3300005354 Bacteria 2805
23 Ga0070675_100080521 3300005354 Bacteria 2715
24 Ga0070671_100000755 3300005355 Bacteria 23162
25 Ga0070674_100023041 3300005356 Bacteria 4023
26 Ga0070674_100138930 3300005356 Bacteria 1821
27 Ga0070674_100291293 3300005356 Bacteria 1298
28 Ga0070673_100289049 3300005364 Bacteria 1440
29 Ga0070673_100479137 3300005364 Bacteria 1123
30 Ga0070688_100065559 3300005365 Bacteria 2308
31 Ga0070667_100000002 3300005367 Bacteria 504831
32 Ga0070667_100221883 3300005367 Bacteria 1683
33 Ga0070667_100575298 3300005367 Bacteria 1037
34 Ga0070667_100985021 3300005367 Unclassified 786
35 Ga0070710_10734946 3300005437 Bacteria 699
36 Ga0070701_10218800 3300005438 Bacteria 1135
37 Ga0070701_10550012 3300005438 Bacteria 757
38 Ga0070705_100179167 3300005440 Bacteria 1434
39 Ga0070705_100212512 3300005440 Bacteria 1334
40 Ga0070700_100007047 3300005441 Bacteria 6041
41 Ga0070700_100886738 3300005441 Unclassified 725
42 Ga0070694_100021492 3300005444 Bacteria 4125
43 Ga0070678_100016422 3300005456 Bacteria 4737
44 Ga0070678_100887020 3300005456 Unclassified 815
45 Ga0070681_10059168 3300005458 Bacteria 3811
46 Ga0068867_100024607 3300005459 Bacteria 4315
47 Ga0068867_100085923 3300005459 Bacteria 2379
48 Ga0070685_10000003 3300005466 Bacteria 283138
49 Ga0070685_10507111 3300005466 Bacteria 855
50 Ga0070706_100203857 3300005467 Bacteria 1847
51 Ga0070698_100661931 3300005471 Bacteria 985
52 Ga0070699_100550293 3300005518 Unclassified 1050
53 Ga0070679_100069186 3300005530 Bacteria 3521
54 Ga0068853_100197880 3300005539 Bacteria 1828
55 Ga0070672_100532019 3300005543 Bacteria 1019
56 Ga0070672_100658314 3300005543 Unclassified 915
57 Ga0070695_100127217 3300005545 Bacteria 1751
58 Ga0070696_100023276 3300005546 Bacteria 4210
59 Ga0070696_100138495 3300005546 Bacteria 1776
60 Ga0070696_100197511 3300005546 Bacteria 1500
61 Ga0070696_100302731 3300005546 Bacteria 1225
62 Ga0070693_100007327 3300005547 Bacteria 5389
63 Ga0070693_100243448 3300005547 Bacteria 1189
64 Ga0070665_100066146 3300005548 Bacteria 3626
65 Ga0070665_100353098 3300005548 Bacteria 1476
66 Ga0070665_100797579 3300005548 Bacteria 957
67 Ga0070665_101087754 3300005548 Unclassified 811
68 Ga0070704_100073604 3300005549 Bacteria 2489
69 Ga0070704_100234269 3300005549 Bacteria 1499
70 Ga0068855_101012907 3300005563 Bacteria 872
71 Ga0070702_100024991 3300005615 Bacteria 3195
72 Ga0068859_100048659 3300005617 Bacteria 4258
73 Ga0068859_100225443 3300005617 Bacteria 1962
74 Ga0068859_100254918 3300005617 Bacteria 1845
75 Ga0068859_100386691 3300005617 Bacteria 1495
76 Ga0068859_101106264 3300005617 Bacteria 872
77 Ga0068864_100000002 3300005618 Bacteria 658857
78 Ga0068864_100198918 3300005618 Bacteria 1840
79 Ga0068866_10036156 3300005718 Bacteria 2418
80 Ga0068861_100002590 3300005719 Bacteria 11835
81 Ga0068870_10030756 3300005840 Bacteria 2716
82 Ga0068863_100021242 3300005841 Bacteria 6197
83 Ga0068863_100087768 3300005841 Bacteria 2947
84 Ga0068863_101509531 3300005841 Unclassified 680
85 Ga0068858_100297610 3300005842 Bacteria 1539
86 Ga0068858_100343790 3300005842 Bacteria 1428
87 Ga0068858_100830391 3300005842 Bacteria 902
88 Ga0068860_100009327 3300005843 Bacteria 9748
89 Ga0068860_100116579 3300005843 Bacteria 2555
90 Ga0068860_100119510 3300005843 Bacteria 2523
91 Ga0068860_100135633 3300005843 Bacteria 2363
92 Ga0068860_100365087 3300005843 Bacteria 1423
93 Ga0068860_100538234 3300005843 Bacteria 1169
94 Ga0068862_100007088 3300005844 Bacteria 9310
95 Ga0068862_100035115 3300005844 Bacteria 4244
96 Ga0068862_100177434 3300005844 Bacteria 1910
97 Ga0068862_100297271 3300005844 Bacteria 1484
98 Ga0068862_101118911 3300005844 Bacteria 783
99 Ga0081455_10006420 3300005937 Bacteria 12604
100 Ga0081455_10007102 3300005937 Bacteria 11861
101 Ga0081455_10117077 3300005937 Bacteria 2106
102 Ga0081540_1000105 3300005983 Bacteria 89863
103 Ga0081540_1046363 3300005983 Bacteria 2195
104 Ga0081540_1082400 3300005983 Bacteria 1443
105 Ga0075365_10004379 3300006038 Bacteria 7469
106 Ga0075365_10040810 3300006038 Bacteria 3028
107 Ga0075365_10114872 3300006038 Bacteria 1852
108 Ga0075365_10197318 3300006038 Bacteria 1409
109 Ga0075368_10009678 3300006042 Bacteria 3471
110 Ga0075363_100019039 3300006048 Bacteria 3427
111 Ga0075363_100286430 3300006048 Bacteria 954
112 Ga0075363_100410714 3300006048 Bacteria 796
113 Ga0075364_10015093 3300006051 Bacteria 4783
114 Ga0075364_10219670 3300006051 Bacteria 1289
115 Ga0070712_100108878 3300006175 Bacteria 2063
116 Ga0075362_10041692 3300006177 Bacteria 2026
117 Ga0075362_10240564 3300006177 Bacteria 888
118 Ga0075367_10070274 3300006178 Bacteria 2104
119 Ga0075367_10070718 3300006178 Bacteria 2098
120 Ga0075367_10071552 3300006178 Bacteria 2086
121 Ga0075367_10149817 3300006178 Unclassified 1447
122 Ga0075367_10186869 3300006178 Bacteria 1292
123 Ga0075367_10231258 3300006178 Bacteria 1158
124 Ga0075369_10031540 3300006186 Bacteria 2238
125 Ga0075369_10102250 3300006186 Bacteria 1286
126 Ga0075366_10000419 3300006195 Bacteria 19896
127 Ga0075366_10034895 3300006195 Bacteria 2964
128 Ga0075370_10033584 3300006353 Bacteria 2873
129 Ga0075370_10040720 3300006353 Bacteria 2621
130 Ga0075370_10317710 3300006353 Bacteria 927
131 Ga0075370_10464003 3300006353 Bacteria 762
132 Ga0068871_100018320 3300006358 Bacteria 5318
133 Ga0068871_100096084 3300006358 Bacteria 2475
134 Ga0068871_100845197 3300006358 Unclassified 846
135 Ga0075428_100105502 3300006844 Unclassified 3073
136 Ga0075428_101206882 3300006844 Unclassified 797
137 Ga0075430_100001420 3300006846 Bacteria 19461
138 Ga0075430_100020445 3300006846 Bacteria 5631
139 Ga0075430_100030403 3300006846 Unclassified 4587
140 Ga0075431_100009614 3300006847 Bacteria 9712
141 Ga0075431_100243867 3300006847 Bacteria 1827
142 Ga0075431_100294334 3300006847 Bacteria 1641
143 Ga0075431_100511636 3300006847 Bacteria 1191
144 Ga0075431_100744434 3300006847 Bacteria 956
145 Ga0075433_10473133 3300006852 Bacteria 1104
146 Ga0075434_100024932 3300006871 Bacteria 5848
147 Ga0075429_100252535 3300006880 Bacteria 1544
148 Ga0068865_100040709 3300006881 Bacteria 3159
149 Ga0068865_100384596 3300006881 Unclassified 1145
150 Ga0068865_100505922 3300006881 Bacteria 1008
151 Ga0068865_100546016 3300006881 Bacteria 972
152 Ga0075436_100101912 3300006914 Bacteria 1999
153 Ga0075436_100257513 3300006914 Bacteria 1244
154 Ga0097620_100048658 3300006931 Bacteria 4258
155 Ga0097620_100225442 3300006931 Bacteria 1962
156 Ga0097620_100254904 3300006931 Bacteria 1845
157 Ga0097620_100386699 3300006931 Bacteria 1495
158 Ga0097620_101106287 3300006931 Bacteria 872
159 Ga0075435_100526362 3300007076 Bacteria 1023
160 Ga0099794_10149970 3300007265 Bacteria 1183
161 Ga0099795_10034637 3300007788 Bacteria 1760
162 Ga0099795_10046864 3300007788 Bacteria 1559
163 Ga0099795_10060089 3300007788 Unclassified 1408
164 Ga0111539_10046715 3300009094 Bacteria 5178
165 Ga0111539_10077136 3300009094 Bacteria 3922
166 Ga0111539_10210183 3300009094 Bacteria 2267
167 Ga0111539_10272100 3300009094 Bacteria 1972
168 Ga0111539_10735722 3300009094 Bacteria 1148
169 Ga0111539_10812727 3300009094 Bacteria 1088
170 Ga0111539_10908570 3300009094 Bacteria 1024
171 Ga0111539_11164698 3300009094 Bacteria 896
172 Ga0105245_10024385 3300009098 Bacteria 5311
173 Ga0105245_10037892 3300009098 Bacteria 4287
174 Ga0105245_10080260 3300009098 Bacteria 2980
175 Ga0105245_10555209 3300009098 Bacteria 1171
176 Ga0105245_11157382 3300009098 Bacteria 821
177 Ga0105247_10087570 3300009101 Bacteria 1972
178 Ga0105247_10355197 3300009101 Bacteria 1032
179 Ga0114129_10125747 3300009147 Bacteria 3525
180 Ga0114129_10324638 3300009147 Unclassified 2045
181 Ga0114129_11111571 3300009147 Bacteria 989
182 Ga0105243_10017997 3300009148 Bacteria 5346
183 Ga0105243_10242982 3300009148 Bacteria 1603
184 Ga0105243_10668464 3300009148 Unclassified 1009
185 Ga0105243_10732806 3300009148 Bacteria 967
186 Ga0105241_10136477 3300009174 Bacteria 1992
187 Ga0105242_10206821 3300009176 Bacteria 1746
188 Ga0105242_11112054 3300009176 Unclassified 805
189 Ga0105248_11501991 3300009177 Bacteria 763
190 Ga0105238_10815752 3300009551 Bacteria 949
191 Ga0105249_10023991 3300009553 Bacteria 5478
192 Ga0105249_10427122 3300009553 Bacteria 1360
193 Ga0105249_10665885 3300009553 Bacteria 1099
194 Ga0099796_10004572 3300010159 Unclassified 3366
195 Ga0099796_10027573 3300010159 Bacteria 1815
196 Ga0157374_10210553 3300013296 Bacteria 1906
197 Ga0157378_10015250 3300013297 Bacteria 6730
198 Ga0157378_10105531 3300013297 Bacteria 2576
199 Ga0157378_10485474 3300013297 Unclassified 1232
200 Ga0163162_10321654 3300013306 Bacteria 1679
201 Ga0157372_10414929 3300013307 Bacteria 1569
202 Ga0157372_12033883 3300013307 Unclassified 660
203 Ga0157375_10105104 3300013308 Bacteria 2913
204 Ga0157375_10218715 3300013308 Bacteria 2063
205 Ga0157375_10317192 3300013308 Bacteria 1723
206 Ga0157375_11222100 3300013308 Bacteria 882
207 Ga0157375_11582495 3300013308 Unclassified 775
208 Ga0163163_10000128 3300014325 Bacteria 78848
209 Ga0163163_10269235 3300014325 Bacteria 1755
210 Ga0163163_10328368 3300014325 Bacteria 1584
211 Ga0163163_11929765 3300014325 Bacteria 650
212 Ga0157380_10017222 3300014326 Bacteria 5345
213 Ga0157380_10030831 3300014326 Bacteria 4110
214 Ga0157380_10174695 3300014326 Unclassified 1881
215 Ga0157380_10521317 3300014326 Bacteria 1159
216 Ga0157379_10009484 3300014968 Bacteria 8477
217 Ga0157379_10034506 3300014968 Bacteria 4511
218 Ga0157379_10061074 3300014968 Bacteria 3370
219 Ga0157379_10177144 3300014968 Bacteria 1926
220 Ga0157376_10102759 3300014969 Bacteria 2501
221 Ga0157376_10131076 3300014969 Bacteria 2237
222 Ga0157376_10276650 3300014969 Bacteria 1579
223 Ga0213872_10048456 3300021361 Bacteria 1931
224 Ga0213875_10048638 3300021388 Bacteria 1989
225 Ga0213875_10101241 3300021388 Bacteria 1345
226 Ga0224572_1005299 3300024225 Bacteria 2294
227 Ga0209758_1000074 3300025297 Bacteria 275577
228 Ga0209758_1000110 3300025297 Bacteria 213110
229 Ga0209758_1031820 3300025297 Bacteria 2156
230 Ga0209758_1037533 3300025297 Bacteria 1871
231 Ga0207426_1042355 3300025302 Bacteria 1405
232 Ga0209257_1065483 3300025304 Bacteria 974
233 Ga0207642_10652870 3300025899 Unclassified 659
234 Ga0207710_10170504 3300025900 Bacteria 1064
235 Ga0207680_10034199 3300025903 Bacteria 2906
236 Ga0207643_10079272 3300025908 Bacteria 1900
237 Ga0207643_10463728 3300025908 Unclassified 807
238 Ga0207684_10306313 3300025910 Bacteria 1369
239 Ga0207707_10193494 3300025912 Bacteria 1774
240 Ga0207693_10867974 3300025915 Bacteria 693
241 Ga0207662_10362612 3300025918 Bacteria 975
242 Ga0207652_10007519 3300025921 Bacteria 8770
243 Ga0207652_10796524 3300025921 Bacteria 839
244 Ga0207681_10012724 3300025923 Bacteria 5197
245 Ga0207681_10141872 3300025923 Bacteria 1790
246 Ga0207681_10568976 3300025923 Bacteria 934
247 Ga0207694_10502984 3300025924 Bacteria 1015
248 Ga0207650_10000002 3300025925 Bacteria 1439222
249 Ga0207659_10365525 3300025926 Bacteria 1200
250 Ga0207659_10684823 3300025926 Bacteria 877
251 Ga0207687_10054184 3300025927 Bacteria 2805
252 Ga0207687_10763870 3300025927 Bacteria 823
253 Ga0207644_10000673 3300025931 Bacteria 21534
254 Ga0207686_10171119 3300025934 Bacteria 1532
255 Ga0207670_10232232 3300025936 Bacteria 1417
256 Ga0207669_10236715 3300025937 Bacteria 1351
257 Ga0207669_10276994 3300025937 Bacteria 1263
258 Ga0207704_10225324 3300025938 Bacteria 1390
259 Ga0207704_10390820 3300025938 Unclassified 1095
260 Ga0207691_10494903 3300025940 Bacteria 1038
261 Ga0207711_10002844 3300025941 Bacteria 15187
262 Ga0207689_10000541 3300025942 Bacteria 35878
263 Ga0207689_10003575 3300025942 Bacteria 14204
264 Ga0207689_10290774 3300025942 Bacteria 1353
265 Ga0207661_10630247 3300025944 Bacteria 985
266 Ga0207679_10673984 3300025945 Bacteria 937
267 Ga0207712_10816133 3300025961 Bacteria 821
268 Ga0207668_10383610 3300025972 Bacteria 1183
269 Ga0207668_10701181 3300025972 Bacteria 890
270 Ga0207668_10772359 3300025972 Bacteria 849
271 Ga0207658_10000001 3300025986 Bacteria 1439333
272 Ga0207658_10590597 3300025986 Bacteria 997
273 Ga0207677_11041171 3300026023 Bacteria 744
274 Ga0207703_10009124 3300026035 Bacteria 7810
275 Ga0207703_10223363 3300026035 Bacteria 1685
276 Ga0207678_10621682 3300026067 Bacteria 948
277 Ga0207708_10005891 3300026075 Bacteria 9065
278 Ga0207708_10273695 3300026075 Bacteria 1366
279 Ga0207708_11199569 3300026075 Unclassified 663
280 Ga0207641_10008813 3300026088 Bacteria 8332
281 Ga0207641_10064460 3300026088 Bacteria 3132
282 Ga0207648_10001650 3300026089 Bacteria 24468
283 Ga0207648_10094198 3300026089 Bacteria 2618
284 Ga0207648_10219069 3300026089 Bacteria 1691
285 Ga0207676_10000001 3300026095 Bacteria 1439222
286 Ga0207676_10240392 3300026095 Bacteria 1624
287 Ga0207676_10464058 3300026095 Bacteria 1196
288 Ga0207675_100026783 3300026118 Bacteria 5365
289 Ga0207675_100244510 3300026118 Bacteria 1735
290 Ga0207675_100369769 3300026118 Bacteria 1408
291 Ga0207683_10127688 3300026121 Bacteria 2286
292 Ga0209179_1019907 3300027512 Bacteria 1297
293 Ga0209179_1021863 3300027512 Bacteria 1252
294 Ga0209998_10040044 3300027717 Bacteria 1062
295 Ga0209813_10014425 3300027866 Bacteria 2127
296 Ga0209813_10203919 3300027866 Unclassified 733
297 Ga0207428_10000045 3300027907 Bacteria 194471
298 Ga0207428_10011354 3300027907 Bacteria 7876
299 Ga0207428_10075842 3300027907 Bacteria 2634
300 Ga0268266_10000411 3300028379 Bacteria 65247
301 Ga0268266_10002792 3300028379 Bacteria 18206
302 Ga0268266_10104839 3300028379 Bacteria 2497
303 Ga0268266_10261819 3300028379 Bacteria 1603
304 Ga0268266_10271064 3300028379 Bacteria 1575
305 Ga0268266_10496141 3300028379 Bacteria 1165
306 Ga0268266_10605462 3300028379 Bacteria 1053
307 Ga0268265_10001905 3300028380 Bacteria 16581
308 Ga0268265_10019337 3300028380 Bacteria 4732
309 Ga0268265_10021737 3300028380 Bacteria 4498
310 Ga0268265_10048900 3300028380 Bacteria 3178
311 Ga0268264_10000004 3300028381 Bacteria 1116842
312 Ga0268264_10112651 3300028381 Bacteria 2385
313 Ga0268264_10419375 3300028381 Bacteria 1290
314 Ga0268264_10519174 3300028381 Bacteria 1164
315 Ga0268264_10821814 3300028381 Bacteria 929
316 Ga0265337_1007492 3300028556 Bacteria 4080
317 Ga0265338_10042050 3300028800 Bacteria 4263
318 Ga0265760_10152691 3300031090 Unclassified 758
319 Ga0265320_10040627 3300031240 Bacteria 2318
320 Ga0265320_10169524 3300031240 Bacteria 981
321 Ga0265313_10117286 3300031595 Bacteria 1164
322 Ga0373926_0166225 3300035083 Unclassified 843
323 Ga0373934_0124639 3300035086 Bacteria 1049
324 Ga0373940_0049575 3300035088 Bacteria 1176
325 Ga0373944_0004476 3300035089 Bacteria 3642
326 Ga0373923_0186909 3300035111 Bacteria 954
327 Ga0373936_0022344 3300035113 Bacteria 2463
328 Ga0373945_0010993 3300035116 Bacteria 2987
329 Ga0373960_0032503 3300035121 Bacteria 1466
330 Ga0373943_0001338 3300035170 Bacteria 11099
331 Ga0373943_0214691 3300035170 Bacteria 1069
332 Ga0373946_0054064 3300035171 Bacteria 1688
333 Ga0373946_0248047 3300035171 Bacteria 868
334 Ga0373955_0308480 3300035172 Bacteria 955
335 Ga0373955_0483492 3300035172 Unclassified 756
336 Ga0373962_0122896 3300035242 Bacteria 829
337 Ga0316574_0000190 3300035398 Bacteria 21103
338 Ga0373931_0050316 3300035691 Bacteria 2217
339 Ga0373931_0068724 3300035691 Bacteria 1929
340 Ga0373931_0099865 3300035691 Bacteria 1631
341 Ga0373931_0136951 3300035691 Bacteria 1414
342 Ga0373935_0026587 3300035692 Bacteria 3573
343 Ga0373935_0115947 3300035692 Bacteria 1783
344 Ga0373935_0258283 3300035692 Bacteria 1221
345 Ga0373927_0000243 3300035695 Bacteria 42834
346 Ga0373927_0123440 3300035695 Bacteria 1690
347 Ga0373927_0323513 3300035695 Bacteria 1015
348 Ga0373927_0707589 3300035695 Unclassified 665
349 Ga0373933_0102133 3300035724 Bacteria 1780
350 Ga0373947_0000613 3300035725 Bacteria 21037
351 Ga0373947_0098827 3300035725 Bacteria 1831
352 Ga0373947_0132587 3300035725 Bacteria 1592
353 Ga0373947_0303891 3300035725 Bacteria 1064
354 Ga0373947_0315026 3300035725 Bacteria 1045
355 Ga0373937_0380042 3300036401 Bacteria 1339
356 Ga0373937_0441562 3300036401 Bacteria 1235
357 Ga0373937_1205552 3300036401 Bacteria 705
358 Ga0373925_0002340 3300037068 Bacteria 15243
359 Ga0373925_0037645 3300037068 Bacteria 3572
360 Ga0373925_0046540 3300037068 Bacteria 3226
361 Ga0373925_0183844 3300037068 Bacteria 1656
362 Ga0373925_0223085 3300037068 Bacteria 1505
363 Ga0373925_0294964 3300037068 Bacteria 1308
364 Ga0373925_0475882 3300037068 Bacteria 1024
365 Ga0373925_0553707 3300037068 Bacteria 946
366 Ga0395898_0177606 3300037466 Bacteria 2035
367 Ga0436364_0080635 3300037853 Bacteria 1790
368 Ga0436364_0253351 3300037853 Bacteria 51722
369 Ga0436364_0969150 3300037853 Bacteria 2112
370 Ga0436364_1105955 3300037853 Bacteria 1634
371 Ga0395901_0172317 3300038443 Bacteria 2270
372 Ga0436365_1223508 3300039437 Bacteria 2928
373 Ga0436365_1268935 3300039437 Bacteria 752
374 Ga0436365_1670037 3300039437 Bacteria 2343
375 Ga0436360_0954589 3300039438 Bacteria 636
376 Ga0436361_0568914 3300039447 Bacteria 18812
377 Ga0436363_0272634 3300039450 Bacteria 1357
378 Ga0436363_0866740 3300039450 Bacteria 880
379 Ga0436362_0314615 3300039453 Bacteria 2445
380 Ga0436362_0768606 3300039453 Bacteria 759
381 Ga0439466_0043237 3300041411 Bacteria 1497
382 Ga0451853_3814068 3300041512 Bacteria 709
383 Ga0451577_0694791 3300042876 Bacteria 922
384 Ga0466966_0036064 3300044684 Bacteria 3194
385 Ga0466963_0048815 3300044694 Bacteria 2798
386 Ga0466957_0071399 3300044842 Bacteria 2147
387 Ga0466960_0179534 3300044901 Bacteria 1147
388 Ga0466959_0367053 3300045049 Bacteria 980
389 Ga0451576_0016900 3300045051 Bacteria 8037
390 Ga0451576_0217486 3300045051 Bacteria 1995
391 Ga0451576_1634491 3300045051 Bacteria 668
392 Ga0466958_0190551 3300045836 Bacteria 1303
393 Ga0495592_0144259 3300046454 Bacteria 1653
394 Ga0495592_0286373 3300046454 Bacteria 1076
395 Ga0495629_0013997 3300046459 Bacteria 5782
396 Ga0495641_0041009 3300046461 Bacteria 2151
397 Ga0495653_0052057 3300046463 Bacteria 3140
398 Ga0495653_0146739 3300046463 Bacteria 1652
399 Ga0495580_0075819 3300046472 Bacteria 2346
400 Ga0495580_0110453 3300046472 Bacteria 1910
401 Ga0495582_0120173 3300046473 Bacteria 1480
402 Ga0495582_0206996 3300046473 Bacteria 1121
403 Ga0495605_0105561 3300046474 Bacteria 1290
404 Ga0495639_0012247 3300046475 Bacteria 3700
405 Ga0495639_0078114 3300046475 Bacteria 1538
406 Ga0495639_0219647 3300046475 Bacteria 934
407 Ga0495662_0006800 3300046476 Bacteria 5691
408 Ga0495664_0000473 3300046477 Bacteria 19941
409 Ga0495584_0135917 3300046491 Bacteria 1248
410 Ga0495584_0215164 3300046491 Bacteria 977
411 Ga0495594_0334677 3300046499 Bacteria 862
412 Ga0495596_0045819 3300046500 Bacteria 1719
413 Ga0495607_0139643 3300046501 Bacteria 1251
414 Ga0495608_0203908 3300046511 Bacteria 1245
415 Ga0495616_0082352 3300046513 Bacteria 1537
416 Ga0495618_0031453 3300046514 Bacteria 3320
417 Ga0495618_0033138 3300046514 Bacteria 3238
418 Ga0495628_0121955 3300046516 Bacteria 1999
419 Ga0495628_0189965 3300046516 Bacteria 1551
420 Ga0495630_0002253 3300046517 Bacteria 13430
421 Ga0495630_0043823 3300046517 Bacteria 3343
422 Ga0495630_0142568 3300046517 Bacteria 1822
423 Ga0495630_0202878 3300046517 Bacteria 1513
424 Ga0495630_0387084 3300046517 Bacteria 1071
425 Ga0495637_0058871 3300046520 Bacteria 1582
426 Ga0495644_0034151 3300046523 Bacteria 1920
427 Ga0495663_0015827 3300046525 Bacteria 2129
428 Ga0495663_0050212 3300046525 Bacteria 1289
429 Ga0495666_0060305 3300046526 Bacteria 1813
430 Ga0495652_0031732 3300046529 Bacteria 4624
431 Ga0495652_0083793 3300046529 Bacteria 2624
432 Ga0495665_0004041 3300046531 Bacteria 7918
433 Ga0495665_0058317 3300046531 Bacteria 2039
434 Ga0495640_0022768 3300046533 Bacteria 4575
435 Ga0495640_0073394 3300046533 Bacteria 2291
436 Ga0495640_0230929 3300046533 Bacteria 1164
437 Ga0495640_0374548 3300046533 Bacteria 876
438 Ga0495586_0037254 3300046535 Bacteria 2611
439 Ga0495586_0186100 3300046535 Bacteria 1176
440 Ga0495586_0384740 3300046535 Bacteria 807
441 Ga0495587_0164400 3300046536 Unclassified 1262
442 Ga0495587_0237852 3300046536 Bacteria 1025
443 Ga0495598_0015798 3300046537 Bacteria 1913
444 Ga0495597_0224561 3300046542 Bacteria 745
445 Ga0495645_0013255 3300046543 Bacteria 5826
446 Ga0495633_0185961 3300046558 Bacteria 956
447 Ga0495633_0360039 3300046558 Bacteria 659
448 Ga0495667_0087063 3300046559 Bacteria 2026
449 Ga0495667_0150687 3300046559 Bacteria 1498
450 Ga0495656_0001227 3300046615 Bacteria 8337
451 Ga0495656_0116394 3300046615 Bacteria 1256
452 Ga0495634_0003099 3300046642 Bacteria 13511
453 Ga0495634_0003391 3300046642 Bacteria 12787
454 Ga0495634_0365828 3300046642 Bacteria 861
455 Ga0495634_0368447 3300046642 Bacteria 858
456 Ga0495635_0000375 3300046663 Bacteria 28276
457 Ga0495635_0132181 3300046663 Bacteria 1701
458 Ga0495659_0222715 3300046664 Bacteria 779
459 Ga0495659_0253445 3300046664 Bacteria 734
460 Ga0495661_0295800 3300046665 Bacteria 812
461 Ga0495588_0118799 3300046674 Bacteria 1393
462 Ga0495646_0071168 3300046680 Bacteria 2047
463 Ga0495647_0031175 3300046681 Bacteria 1982
464 Ga0495658_0030861 3300046683 Bacteria 2914
465 Ga0495658_0065548 3300046683 Bacteria 2096
466 Ga0495658_0235408 3300046683 Bacteria 1149
467 Ga0495613_0107541 3300046689 Bacteria 2012
468 Ga0495613_0202365 3300046689 Bacteria 1399
469 Ga0495613_0256672 3300046689 Bacteria 1219
470 Ga0495613_0380362 3300046689 Bacteria 965
471 Ga0495624_0056315 3300046690 Bacteria 2474
472 Ga0495624_0093478 3300046690 Bacteria 1854
473 Ga0495670_0094998 3300046691 Bacteria 1529
474 Ga0495671_0117247 3300046692 Bacteria 1300
475 Ga0495589_0120925 3300046794 Bacteria 1261
476 Ga0495589_0286020 3300046794 Bacteria 766
477 Ga0495600_0306334 3300046809 Bacteria 1001
478 Ga0495581_0138758 3300047315 Bacteria 1418
479 Ga0495581_0236615 3300047315 Bacteria 1068
480 Ga0495581_0276838 3300047315 Bacteria 981
481 Ga0495581_0304418 3300047315 Bacteria 931
482 Ga0495604_0064933 3300047317 Bacteria 2780
483 Ga0495604_0070541 3300047317 Bacteria 2645
484 Ga0495674_0002065 3300047319 Bacteria 19693
485 Ga0495674_0453304 3300047319 Unclassified 1030
486 Ga0495676_0274940 3300047321 Unclassified 1142
487 Ga0495683_0085809 3300047323 Bacteria 1530
488 Ga0495687_142991 3300047443 Bacteria 829
489 Ga0495677_0330254 3300047445 Bacteria 601
490 Ga0495679_155410 3300047446 Bacteria 613
491 Ga0495684_0002177 3300047471 Bacteria 15689
492 Ga0495684_0033583 3300047471 Bacteria 3934
493 Ga0495684_0224897 3300047471 Bacteria 1374
494 Ga0495686_0147421 3300047472 Bacteria 1384
495 Ga0495686_0268135 3300047472 Bacteria 953
496 Ga0495593_0006727 3300047673 Bacteria 6730
497 Ga0495593_0220321 3300047673 Bacteria 952
498 Ga0495626_0111579 3300048091 Bacteria 1184
499 Ga0496100_0047156 3300048903 Bacteria 2775
500 Ga0496100_0404982 3300048903 Bacteria 1040
501 Ga0496101_0570404 3300048904 Bacteria 895
502 Ga0496102_0282425 3300048905 Bacteria 1565
503 Ga0496104_0125906 3300048907 Bacteria 2460
504 Ga0496106_0049699 3300048909 Bacteria 3160
505 Ga0496107_0253624 3300048910 Bacteria 1309
506 Ga0496108_0599108 3300048911 Bacteria 960
507 Ga0496108_0837720 3300048911 Bacteria 792
508 Ga0496108_1062573 3300048911 Bacteria 689
509 Ga0496109_0506083 3300048912 Bacteria 1140
510 Ga0496110_0326028 3300048913 Bacteria 1399
511 Ga0496111_0516722 3300048914 Bacteria 878
512 Ga0496111_0901723 3300048914 Bacteria 637
513 Ga0496112_0370395 3300048915 Bacteria 1374
514 Ga0496114_0187953 3300048917 Bacteria 1806
515 Ga0496114_0216091 3300048917 Bacteria 1682
516 Ga0496115_0180554 3300048918 Bacteria 1745
517 Ga0496115_0582271 3300048918 Unclassified 891
518 Ga0496118_0217168 3300048921 Bacteria 1116
519 Ga0496124_0469973 3300048927 Unclassified 852
520 Ga0501031_0003098 3300049568 Bacteria 10649
521 Ga0501032_0177905 3300049569 Bacteria 1393
522 Ga0501033_0076980 3300049570 Bacteria 2448
523 Ga0501034_0016043 3300049571 Bacteria 7687
524 Ga0501034_0337160 3300049571 Bacteria 1438
525 Ga0501034_0344081 3300049571 Bacteria 1421
526 Ga0501036_0015520 3300049572 Bacteria 6363
527 Ga0501036_0040053 3300049572 Bacteria 3963
528 Ga0501036_0284779 3300049572 Bacteria 1383
529 Ga0501037_0117856 3300049573 Bacteria 1910
530 Ga0501038_0029365 3300049574 Bacteria 4874
531 Ga0501039_0008830 3300049575 Bacteria 7676
532 Ga0501039_0392138 3300049575 Unclassified 1090
533 Ga0501040_0059731 3300049576 Bacteria 2620
534 Ga0501040_0090022 3300049576 Bacteria 2132
535 Ga0501041_0008199 3300049577 Bacteria 6149
536 Ga0501041_0097995 3300049577 Bacteria 1813
537 Ga0501042_0041914 3300049578 Bacteria 3256
538 Ga0501042_0077458 3300049578 Bacteria 2381
539 Ga0501042_0422542 3300049578 Bacteria 966
540 Ga0501043_0040803 3300049579 Bacteria 3647
541 Ga0501043_0051438 3300049579 Bacteria 3237
542 Ga0501043_0196511 3300049579 Bacteria 1567
543 Ga0501043_0229402 3300049579 Bacteria 1434
544 Ga0501046_0105700 3300049580 Bacteria 2156
545 Ga0501046_0124371 3300049580 Bacteria 1961
546 Ga0501046_0245135 3300049580 Bacteria 1320
547 Ga0501047_0119159 3300049581 Bacteria 2521
548 Ga0501047_0238357 3300049581 Bacteria 1670
549 Ga0501047_0298609 3300049581 Bacteria 1453
550 Ga0501047_0482167 3300049581 Bacteria 1068
551 Ga0501048_0014866 3300049582 Bacteria 5755
552 Ga0501048_0057562 3300049582 Bacteria 2757
553 Ga0501048_0178798 3300049582 Bacteria 1504
554 Ga0501067_0114525 3300049583 Bacteria 1499
555 Ga0501068_0041825 3300049584 Bacteria 2755
556 Ga0501068_0361610 3300049584 Bacteria 933
557 Ga0501069_0065446 3300049585 Bacteria 2032
558 Ga0501069_0225069 3300049585 Bacteria 1091
559 Ga0501070_0127994 3300049586 Bacteria 2098
560 Ga0501070_0171532 3300049586 Bacteria 1787
561 Ga0501070_0275749 3300049586 Bacteria 1373
562 Ga0501070_0882278 3300049586 Unclassified 698
563 Ga0501071_0005481 3300049587 Bacteria 8163
564 Ga0501071_0256198 3300049587 Bacteria 1321
565 Ga0501072_0023459 3300049588 Bacteria 4793
566 Ga0501072_0055333 3300049588 Bacteria 3127
567 Ga0501072_0070070 3300049588 Bacteria 2769
568 Ga0501072_0446112 3300049588 Bacteria 1025
569 Ga0501073_0037620 3300049589 Bacteria 3434
570 Ga0501073_0046409 3300049589 Bacteria 3055
571 Ga0501073_0146457 3300049589 Bacteria 1636
572 Ga0501073_0185327 3300049589 Bacteria 1440
573 Ga0501074_0217802 3300049590 Bacteria 1360
574 Ga0501074_0775974 3300049590 Unclassified 675
575 Ga0501075_0000740 3300049591 Bacteria 20286
576 Ga0501075_0436291 3300049591 Unclassified 999
577 Ga0501076_0003395 3300049592 Bacteria 11182
578 Ga0501076_0303695 3300049592 Bacteria 1309
579 Ga0501077_0113812 3300049593 Bacteria 1715
580 Ga0501077_0114975 3300049593 Bacteria 1706
581 Ga0501077_0479764 3300049593 Bacteria 797
582 Ga0501079_0002572 3300049741 Bacteria 13182
583 Ga0501079_0097586 3300049741 Bacteria 2278
584 Ga0501080_0020198 3300049742 Bacteria 6166
585 Ga0501080_0021063 3300049742 Bacteria 6035
586 Ga0501080_0239277 3300049742 Bacteria 1657
587 Ga0501080_0757594 3300049742 Unclassified 853
588 Ga0501081_0124327 3300049743 Bacteria 1839
589 Ga0501081_0141221 3300049743 Bacteria 1726
590 Ga0501081_0934286 3300049743 Bacteria 654
591 Ga0501083_0047421 3300049744 Bacteria 2903
592 Ga0501083_0171844 3300049744 Bacteria 1416
593 Ga0501035_0107271 3300049822 Bacteria 2448
594 Ga0501035_0119073 3300049822 Bacteria 2310
595 Ga0501035_0267871 3300049822 Bacteria 1446
596 Ga0501035_0381347 3300049822 Bacteria 1176
597 Ga0501044_0094511 3300049823 Bacteria 3014
598 Ga0501044_0176467 3300049823 Bacteria 2105
599 Ga0501044_0199519 3300049823 Bacteria 1959
600 Ga0501044_0319153 3300049823 Bacteria 1478
601 Ga0501045_0032415 3300049824 Bacteria 3787
602 Ga0501045_0066160 3300049824 Bacteria 2654
603 Ga0501045_0303704 3300049824 Bacteria 1188
604 nmdc:mga03683_273026_c1 3300050489 Bacteria 789
605 nmdc:mga03683_49455_c1 3300050489 Bacteria 784
606 nmdc:mga03683_54279_c1 3300050489 Bacteria 1680
607 nmdc:mga03n38_230804_c1 3300050490 Bacteria 970
608 nmdc:mga03n38_276749_c1 3300050490 Bacteria 895
609 nmdc:mga00v17_297124_c1 3300050491 Bacteria 1049
610 nmdc:mga00v17_7218_c1 3300050491 Bacteria 5921
611 nmdc:mga0yw44_121022_c1 3300050492 Unclassified 1686
612 nmdc:mga0yw44_138752_c1 3300050492 Bacteria 1579
613 nmdc:mga0yw44_266_c1 3300050492 Bacteria 16414
614 nmdc:mga0yw44_38525_c1 3300050492 Bacteria 2830
615 nmdc:mga0k408_131027_c1 3300050493 Bacteria 1489
616 nmdc:mga0k408_1847_c1 3300050493 Bacteria 11373
617 nmdc:mga06z11_17067_c1 3300050494 Bacteria 3286
618 nmdc:mga06z11_190034_c1 3300050494 Bacteria 1188
619 nmdc:mga06z11_321208_c1 3300050494 Bacteria 923
620 nmdc:mga06z11_41074_c1 3300050494 Bacteria 2313
621 nmdc:mga06z11_744361_c1 3300050494 Bacteria 597
622 nmdc:mga04h51_56978_c1 3300050495 Bacteria 1328
623 nmdc:mga04h51_7801_c1 3300050495 Bacteria 2841
624 nmdc:mga07m45_183120_c1 3300050496 Bacteria 1218
625 nmdc:mga07m45_35131_c1 3300050496 Bacteria 2788
626 nmdc:mga07m45_418217_c1 3300050496 Bacteria 778
627 nmdc:mga07m45_42921_c1 3300050496 Bacteria 2536
628 nmdc:mga07m45_443431_c1 3300050496 Bacteria 753
629 nmdc:mga05p37_52588_c1 3300050507 Bacteria 5007
630 nmdc:mga05p37_63148_c1 3300050507 Unclassified 4558
631 nmdc:mga09592_139964_c1 3300050508 Bacteria 2085
632 nmdc:mga09592_202294_c1 3300050508 Bacteria 1720
633 nmdc:mga0qj67_144628_c1 3300050509 Bacteria 1928
634 nmdc:mga0qj67_28_c1 3300050509 Bacteria 102760
635 nmdc:mga0qj67_31154_c1 3300050509 Bacteria 4154
636 nmdc:mga0qj67_377762_c1 3300050509 Bacteria 1144
637 nmdc:mga06r32_183163_c1 3300050510 Bacteria 2080
638 nmdc:mga06r32_264012_c1 3300050510 Bacteria 1709
639 nmdc:mga06r32_265153_c1 3300050510 Bacteria 1705
640 nmdc:mga06r32_586708_c1 3300050510 Bacteria 1086
641 nmdc:mga06r32_72599_c1 3300050510 Bacteria 3332
642 nmdc:mga06r32_91171_c1 3300050510 Bacteria 2978
643 nmdc:mga08y16_152573_c1 3300050511 Bacteria 2401
644 nmdc:mga08y16_24876_c1 3300050511 Bacteria 6316
645 nmdc:mga08y16_681540_c1 3300050511 Bacteria 1029
646 nmdc:mga08y16_872092_c1 3300050511 Bacteria 888
647 nmdc:mga0n895_232714_c1 3300050512 Bacteria 1870
648 nmdc:mga0n895_368754_c1 3300050512 Bacteria 1454
649 nmdc:mga0rr50_221606_c1 3300050513 Bacteria 1562
650 nmdc:mga08x19_231786_c1 3300050514 Bacteria 1271
651 nmdc:mga08x19_90586_c1 3300050514 Bacteria 2018
652 nmdc:mga0a205_214923_c1 3300050515 Bacteria 1810
653 nmdc:mga0sz30_11359_c1 3300050516 Bacteria 3437
654 nmdc:mga0sz30_202465_c1 3300050516 Bacteria 881
655 Ga0495601_0000197 3300053077 Bacteria 32031
656 Ga0495601_0014700 3300053077 Bacteria 4721
657 Ga0495601_0090097 3300053077 Bacteria 1973
658 Ga0495612_0000652 3300053078 Bacteria 13953
659 Ga0495612_0022364 3300053078 Bacteria 2535
660 Ga0500610_0092865 3300053079 Bacteria 1567
661 Ga0495595_0110772 3300053084 Unclassified 1331
662 Ga0495595_0306236 3300053084 Bacteria 799
663 Ga0495619_0000160 3300053085 Bacteria 49417
664 Ga0495619_0022526 3300053085 Bacteria 4032
665 Ga0495619_0130120 3300053085 Bacteria 1729
666 Ga0500578_0028704 3300053086 Bacteria 3573
667 Ga0500644_0111899 3300053088 Bacteria 1053
668 Ga0500641_0007679 3300053096 Bacteria 3844
669 Ga0500650_0000263 3300053098 Bacteria 12670
670 Ga0500650_0052773 3300053098 Bacteria 1891
671 Ga0500555_010280 3300053103 Bacteria 2680
672 Ga0500562_021847 3300053108 Bacteria 1667
673 Ga0500569_012966 3300053109 Bacteria 2028
674 Ga0500595_122106 3300053119 Bacteria 736
675 Ga0500642_0028675 3300053130 Bacteria 2299
676 Ga0500658_0208404 3300053134 Bacteria 895
677 Ga0500568_0061382 3300053139 Bacteria 1454
678 Ga0500568_0212839 3300053139 Bacteria 707
679 Ga0500588_0003596 3300053146 Bacteria 3286
680 Ga0500604_0000718 3300053151 Bacteria 9054
681 Ga0500616_0090359 3300053153 Bacteria 1518
682 Ga0500616_0120891 3300053153 Bacteria 1251
683 Ga0500611_032178 3300053727 Bacteria 1095
684 Ga0501084_0057287 3300054114 Bacteria 3261
685 Ga0501084_0118375 3300054114 Bacteria 2227
686 Ga0501084_0395130 3300054114 Bacteria 1168
687 Ga0501082_0006109 3300060353 Bacteria 10454
688 Ga0501082_0102934 3300060353 Bacteria 2470
689 Ga0501082_0445319 3300060353 Bacteria 1131
690 Ga0501082_0492326 3300060353 Bacteria 1072
691 Ga0501082_0883705 3300060353 Bacteria 782
692 Ga0530510_0004360 3300061734 Bacteria 9796
693 Ga0530510_0367734 3300061734 Bacteria 1081
694 Ga0530510_0594447 3300061734 Bacteria 841
695 Ga0530510_0627839 3300061734 Bacteria 818
696 2509370319 2509276018 Bacteria 6910194
697 2854911800 2854911287 Bacteria 5582813
698 2883579201 2883577096 Bacteria 4709178
699 2922370939
700 2929200290 2929199973 Bacteria 7260745
701 3004340654 3004334049 Bacteria 8449246
702 649864843 649633066 Bacteria 6690028
703 8004698639 8004695233 Bacteria 6731676
704 8055912531 8055909800 Bacteria 7278581
705 Ga0213874_10152330
706 JGI25153J46596_10000042
707 JGI25153J46596_10001329
708 JGI25405J52794_10004460
709 Ga0070683_100711250
710 Ga0070690_100301168
711 Ga0070690_100310171
712 Ga0070670_100000018
713 Ga0070670_100555938
714 Ga0068869_100007064
715 Ga0068869_100036456
716 Ga0068869_100087591
717 Ga0070666_10021080
718 Ga0070666_10591036
719 Ga0070680_100452119
720 Ga0070682_100414514
721 Ga0068868_100337116
722 Ga0070660_100603254
723 Ga0070687_100035957
724 Ga0070668_100036565
725 Ga0070669_100036683
726 Ga0070675_100075331
727 Ga0070675_100080521
728 Ga0070671_100000755
729 Ga0070674_100023041
730 Ga0070674_100138930
731 Ga0070674_100291293
732 Ga0070673_100289049
733 Ga0070673_100479137
734 Ga0070688_100065559
735 Ga0070667_100000002
736 Ga0070667_100221883
737 Ga0070667_100575298
738 Ga0070667_100985021
739 Ga0070710_10734946
740 Ga0070701_10218800
741 Ga0070701_10550012
742 Ga0070705_100179167
743 Ga0070705_100212512
744 Ga0070700_100007047
745 Ga0070700_100886738
746 Ga0070694_100021492
747 Ga0070678_100016422
748 Ga0070678_100887020
749 Ga0070681_10059168
750 Ga0068867_100024607
751 Ga0068867_100085923
752 Ga0070685_10000003
753 Ga0070685_10507111
754 Ga0070706_100203857
755 Ga0070698_100661931
756 Ga0070699_100550293
757 Ga0070679_100069186
758 Ga0068853_100197880
759 Ga0070672_100532019
760 Ga0070672_100658314
761 Ga0070695_100127217
762 Ga0070696_100023276
763 Ga0070696_100138495
764 Ga0070696_100197511
765 Ga0070696_100302731
766 Ga0070693_100007327
767 Ga0070693_100243448
768 Ga0070665_100066146
769 Ga0070665_100353098
770 Ga0070665_100797579
771 Ga0070665_101087754
772 Ga0070704_100073604
773 Ga0070704_100234269
774 Ga0068855_101012907
775 Ga0070702_100024991
776 Ga0068859_100048659
777 Ga0068859_100225443
778 Ga0068859_100254918
779 Ga0068859_100386691
780 Ga0068859_101106264
781 Ga0068864_100000002
782 Ga0068864_100198918
783 Ga0068866_10036156
784 Ga0068861_100002590
785 Ga0068870_10030756
786 Ga0068863_100021242
787 Ga0068863_100087768
788 Ga0068863_101509531
789 Ga0068858_100297610
790 Ga0068858_100343790
791 Ga0068858_100830391
792 Ga0068860_100009327
793 Ga0068860_100116579
794 Ga0068860_100119510
795 Ga0068860_100135633
796 Ga0068860_100365087
797 Ga0068860_100538234
798 Ga0068862_100007088
799 Ga0068862_100035115
800 Ga0068862_100177434
801 Ga0068862_100297271
802 Ga0068862_101118911
803 Ga0081455_10006420
804 Ga0081455_10007102
805 Ga0081455_10117077
806 Ga0081540_1000105
807 Ga0081540_1046363
808 Ga0081540_1082400
809 Ga0075365_10004379
810 Ga0075365_10040810
811 Ga0075365_10114872
812 Ga0075365_10197318
813 Ga0075368_10009678
814 Ga0075363_100019039
815 Ga0075363_100286430
816 Ga0075363_100410714
817 Ga0075364_10015093
818 Ga0075364_10219670
819 Ga0070712_100108878
820 Ga0075362_10041692
821 Ga0075362_10240564
822 Ga0075367_10070274
823 Ga0075367_10070718
824 Ga0075367_10071552
825 Ga0075367_10149817
826 Ga0075367_10186869
827 Ga0075367_10231258
828 Ga0075369_10031540
829 Ga0075369_10102250
830 Ga0075366_10000419
831 Ga0075366_10034895
832 Ga0075370_10033584
833 Ga0075370_10040720
834 Ga0075370_10317710
835 Ga0075370_10464003
836 Ga0068871_100018320
837 Ga0068871_100096084
838 Ga0068871_100845197
839 Ga0075428_100105502
840 Ga0075428_101206882
841 Ga0075430_100001420
842 Ga0075430_100020445
843 Ga0075430_100030403
844 Ga0075431_100009614
845 Ga0075431_100243867
846 Ga0075431_100294334
847 Ga0075431_100511636
848 Ga0075431_100744434
849 Ga0075433_10473133
850 Ga0075434_100024932
851 Ga0075429_100252535
852 Ga0068865_100040709
853 Ga0068865_100384596
854 Ga0068865_100505922
855 Ga0068865_100546016
856 Ga0075436_100101912
857 Ga0075436_100257513
858 Ga0097620_100048658
859 Ga0097620_100225442
860 Ga0097620_100254904
861 Ga0097620_100386699
862 Ga0097620_101106287
863 Ga0075435_100526362
864 Ga0099794_10149970
865 Ga0099795_10034637
866 Ga0099795_10046864
867 Ga0099795_10060089
868 Ga0111539_10046715
869 Ga0111539_10077136
870 Ga0111539_10210183
871 Ga0111539_10272100
872 Ga0111539_10735722
873 Ga0111539_10812727
874 Ga0111539_10908570
875 Ga0111539_11164698
876 Ga0105245_10024385
877 Ga0105245_10037892
878 Ga0105245_10080260
879 Ga0105245_10555209
880 Ga0105245_11157382
881 Ga0105247_10087570
882 Ga0105247_10355197
883 Ga0114129_10125747
884 Ga0114129_10324638
885 Ga0114129_11111571
886 Ga0105243_10017997
887 Ga0105243_10242982
888 Ga0105243_10668464
889 Ga0105243_10732806
890 Ga0105241_10136477
891 Ga0105242_10206821
892 Ga0105242_11112054
893 Ga0105248_11501991
894 Ga0105238_10815752
895 Ga0105249_10023991
896 Ga0105249_10427122
897 Ga0105249_10665885
898 Ga0099796_10004572
899 Ga0099796_10027573
900 Ga0157374_10210553
901 Ga0157378_10015250
902 Ga0157378_10105531
903 Ga0157378_10485474
904 Ga0163162_10321654
905 Ga0157372_10414929
906 Ga0157372_12033883
907 Ga0157375_10105104
908 Ga0157375_10218715
909 Ga0157375_10317192
910 Ga0157375_11222100
911 Ga0157375_11582495
912 Ga0163163_10000128
913 Ga0163163_10269235
914 Ga0163163_10328368
915 Ga0163163_11929765
916 Ga0157380_10017222
917 Ga0157380_10030831
918 Ga0157380_10174695
919 Ga0157380_10521317
920 Ga0157379_10009484
921 Ga0157379_10034506
922 Ga0157379_10061074
923 Ga0157379_10177144
924 Ga0157376_10102759
925 Ga0157376_10131076
926 Ga0157376_10276650
927 Ga0213872_10048456
928 Ga0213875_10048638
929 Ga0213875_10101241
930 Ga0224572_1005299
931 Ga0209758_1000074
932 Ga0209758_1000110
933 Ga0209758_1031820
934 Ga0209758_1037533
935 Ga0207426_1042355
936 Ga0209257_1065483
937 Ga0207642_10652870
938 Ga0207710_10170504
939 Ga0207680_10034199
940 Ga0207643_10079272
941 Ga0207643_10463728
942 Ga0207684_10306313
943 Ga0207707_10193494
944 Ga0207693_10867974
945 Ga0207662_10362612
946 Ga0207652_10007519
947 Ga0207652_10796524
948 Ga0207681_10012724
949 Ga0207681_10141872
950 Ga0207681_10568976
951 Ga0207694_10502984
952 Ga0207650_10000002
953 Ga0207659_10365525
954 Ga0207659_10684823
955 Ga0207687_10054184
956 Ga0207687_10763870
957 Ga0207644_10000673
958 Ga0207686_10171119
959 Ga0207670_10232232
960 Ga0207669_10236715
961 Ga0207669_10276994
962 Ga0207704_10225324
963 Ga0207704_10390820
964 Ga0207691_10494903
965 Ga0207711_10002844
966 Ga0207689_10000541
967 Ga0207689_10003575
968 Ga0207689_10290774
969 Ga0207661_10630247
970 Ga0207679_10673984
971 Ga0207712_10816133
972 Ga0207668_10383610
973 Ga0207668_10701181
974 Ga0207668_10772359
975 Ga0207658_10000001
976 Ga0207658_10590597
977 Ga0207677_11041171
978 Ga0207703_10009124
979 Ga0207703_10223363
980 Ga0207678_10621682
981 Ga0207708_10005891
982 Ga0207708_10273695
983 Ga0207708_11199569
984 Ga0207641_10008813
985 Ga0207641_10064460
986 Ga0207648_10001650
987 Ga0207648_10094198
988 Ga0207648_10219069
989 Ga0207676_10000001
990 Ga0207676_10240392
991 Ga0207676_10464058
992 Ga0207675_100026783
993 Ga0207675_100244510
994 Ga0207675_100369769
995 Ga0207683_10127688
996 Ga0209179_1019907
997 Ga0209179_1021863
998 Ga0209998_10040044
999 Ga0209813_10014425
1000 Ga0209813_10203919
1001 Ga0207428_10000045
1002 Ga0207428_10011354
1003 Ga0207428_10075842
1004 Ga0268266_10000411
1005 Ga0268266_10002792
1006 Ga0268266_10104839
1007 Ga0268266_10261819
1008 Ga0268266_10271064
1009 Ga0268266_10496141
1010 Ga0268266_10605462
1011 Ga0268265_10001905
1012 Ga0268265_10019337
1013 Ga0268265_10021737
1014 Ga0268265_10048900
1015 Ga0268264_10000004
1016 Ga0268264_10112651
1017 Ga0268264_10419375
1018 Ga0268264_10519174
1019 Ga0268264_10821814
1020 Ga0265337_1007492
1021 Ga0265338_10042050
1022 Ga0265760_10152691
1023 Ga0265320_10040627
1024 Ga0265320_10169524
1025 Ga0265313_10117286
1026 Ga0373926_0166225
1027 Ga0373934_0124639
1028 Ga0373940_0049575
1029 Ga0373944_0004476
1030 Ga0373923_0186909
1031 Ga0373936_0022344
1032 Ga0373945_0010993
1033 Ga0373960_0032503
1034 Ga0373943_0001338
1035 Ga0373943_0214691
1036 Ga0373946_0054064
1037 Ga0373946_0248047
1038 Ga0373955_0308480
1039 Ga0373955_0483492
1040 Ga0373962_0122896
1041 Ga0316574_0000190
1042 Ga0373931_0050316
1043 Ga0373931_0068724
1044 Ga0373931_0099865
1045 Ga0373931_0136951
1046 Ga0373935_0026587
1047 Ga0373935_0115947
1048 Ga0373935_0258283
1049 Ga0373927_0000243
1050 Ga0373927_0123440
1051 Ga0373927_0323513
1052 Ga0373927_0707589
1053 Ga0373933_0102133
1054 Ga0373947_0000613
1055 Ga0373947_0098827
1056 Ga0373947_0132587
1057 Ga0373947_0303891
1058 Ga0373947_0315026
1059 Ga0373937_0380042
1060 Ga0373937_0441562
1061 Ga0373937_1205552
1062 Ga0373925_0002340
1063 Ga0373925_0037645
1064 Ga0373925_0046540
1065 Ga0373925_0183844
1066 Ga0373925_0223085
1067 Ga0373925_0294964
1068 Ga0373925_0475882
1069 Ga0373925_0553707
1070 Ga0395898_0177606
1071 Ga0436364_0080635
1072 Ga0436364_0253351
1073 Ga0436364_0969150
1074 Ga0436364_1105955
1075 Ga0395901_0172317
1076 Ga0436365_1223508
1077 Ga0436365_1268935
1078 Ga0436365_1670037
1079 Ga0436360_0954589
1080 Ga0436361_0568914
1081 Ga0436363_0272634
1082 Ga0436363_0866740
1083 Ga0436362_0314615
1084 Ga0436362_0768606
1085 Ga0439466_0043237
1086 Ga0451853_3814068
1087 Ga0451577_0694791
1088 Ga0466966_0036064
1089 Ga0466963_0048815
1090 Ga0466957_0071399
1091 Ga0466960_0179534
1092 Ga0466959_0367053
1093 Ga0451576_0016900
1094 Ga0451576_0217486
1095 Ga0451576_1634491
1096 Ga0466958_0190551
1097 Ga0495592_0144259
1098 Ga0495592_0286373
1099 Ga0495629_0013997
1100 Ga0495641_0041009
1101 Ga0495653_0052057
1102 Ga0495653_0146739
1103 Ga0495580_0075819
1104 Ga0495580_0110453
1105 Ga0495582_0120173
1106 Ga0495582_0206996
1107 Ga0495605_0105561
1108 Ga0495639_0012247
1109 Ga0495639_0078114
1110 Ga0495639_0219647
1111 Ga0495662_0006800
1112 Ga0495664_0000473
1113 Ga0495584_0135917
1114 Ga0495584_0215164
1115 Ga0495594_0334677
1116 Ga0495596_0045819
1117 Ga0495607_0139643
1118 Ga0495608_0203908
1119 Ga0495616_0082352
1120 Ga0495618_0031453
1121 Ga0495618_0033138
1122 Ga0495628_0121955
1123 Ga0495628_0189965
1124 Ga0495630_0002253
1125 Ga0495630_0043823
1126 Ga0495630_0142568
1127 Ga0495630_0202878
1128 Ga0495630_0387084
1129 Ga0495637_0058871
1130 Ga0495644_0034151
1131 Ga0495663_0015827
1132 Ga0495663_0050212
1133 Ga0495666_0060305
1134 Ga0495652_0031732
1135 Ga0495652_0083793
1136 Ga0495665_0004041
1137 Ga0495665_0058317
1138 Ga0495640_0022768
1139 Ga0495640_0073394
1140 Ga0495640_0230929
1141 Ga0495640_0374548
1142 Ga0495586_0037254
1143 Ga0495586_0186100
1144 Ga0495586_0384740
1145 Ga0495587_0164400
1146 Ga0495587_0237852
1147 Ga0495598_0015798
1148 Ga0495597_0224561
1149 Ga0495645_0013255
1150 Ga0495633_0185961
1151 Ga0495633_0360039
1152 Ga0495667_0087063
1153 Ga0495667_0150687
1154 Ga0495656_0001227
1155 Ga0495656_0116394
1156 Ga0495634_0003099
1157 Ga0495634_0003391
1158 Ga0495634_0365828
1159 Ga0495634_0368447
1160 Ga0495635_0000375
1161 Ga0495635_0132181
1162 Ga0495659_0222715
1163 Ga0495659_0253445
1164 Ga0495661_0295800
1165 Ga0495588_0118799
1166 Ga0495646_0071168
1167 Ga0495647_0031175
1168 Ga0495658_0030861
1169 Ga0495658_0065548
1170 Ga0495658_0235408
1171 Ga0495613_0107541
1172 Ga0495613_0202365
1173 Ga0495613_0256672
1174 Ga0495613_0380362
1175 Ga0495624_0056315
1176 Ga0495624_0093478
1177 Ga0495670_0094998
1178 Ga0495671_0117247
1179 Ga0495589_0120925
1180 Ga0495589_0286020
1181 Ga0495600_0306334
1182 Ga0495581_0138758
1183 Ga0495581_0236615
1184 Ga0495581_0276838
1185 Ga0495581_0304418
1186 Ga0495604_0064933
1187 Ga0495604_0070541
1188 Ga0495674_0002065
1189 Ga0495674_0453304
1190 Ga0495676_0274940
1191 Ga0495683_0085809
1192 Ga0495687_142991
1193 Ga0495677_0330254
1194 Ga0495679_155410
1195 Ga0495684_0002177
1196 Ga0495684_0033583
1197 Ga0495684_0224897
1198 Ga0495686_0147421
1199 Ga0495686_0268135
1200 Ga0495593_0006727
1201 Ga0495593_0220321
1202 Ga0495626_0111579
1203 Ga0496100_0047156
1204 Ga0496100_0404982
1205 Ga0496101_0570404
1206 Ga0496102_0282425
1207 Ga0496104_0125906
1208 Ga0496106_0049699
1209 Ga0496107_0253624
1210 Ga0496108_0599108
1211 Ga0496108_0837720
1212 Ga0496108_1062573
1213 Ga0496109_0506083
1214 Ga0496110_0326028
1215 Ga0496111_0516722
1216 Ga0496111_0901723
1217 Ga0496112_0370395
1218 Ga0496114_0187953
1219 Ga0496114_0216091
1220 Ga0496115_0180554
1221 Ga0496115_0582271
1222 Ga0496118_0217168
1223 Ga0496124_0469973
1224 Ga0501031_0003098
1225 Ga0501032_0177905
1226 Ga0501033_0076980
1227 Ga0501034_0016043
1228 Ga0501034_0337160
1229 Ga0501034_0344081
1230 Ga0501036_0015520
1231 Ga0501036_0040053
1232 Ga0501036_0284779
1233 Ga0501037_0117856
1234 Ga0501038_0029365
1235 Ga0501039_0008830
1236 Ga0501039_0392138
1237 Ga0501040_0059731
1238 Ga0501040_0090022
1239 Ga0501041_0008199
1240 Ga0501041_0097995
1241 Ga0501042_0041914
1242 Ga0501042_0077458
1243 Ga0501042_0422542
1244 Ga0501043_0040803
1245 Ga0501043_0051438
1246 Ga0501043_0196511
1247 Ga0501043_0229402
1248 Ga0501046_0105700
1249 Ga0501046_0124371
1250 Ga0501046_0245135
1251 Ga0501047_0119159
1252 Ga0501047_0238357
1253 Ga0501047_0298609
1254 Ga0501047_0482167
1255 Ga0501048_0014866
1256 Ga0501048_0057562
1257 Ga0501048_0178798
1258 Ga0501067_0114525
1259 Ga0501068_0041825
1260 Ga0501068_0361610
1261 Ga0501069_0065446
1262 Ga0501069_0225069
1263 Ga0501070_0127994
1264 Ga0501070_0171532
1265 Ga0501070_0275749
1266 Ga0501070_0882278
1267 Ga0501071_0005481
1268 Ga0501071_0256198
1269 Ga0501072_0023459
1270 Ga0501072_0055333
1271 Ga0501072_0070070
1272 Ga0501072_0446112
1273 Ga0501073_0037620
1274 Ga0501073_0046409
1275 Ga0501073_0146457
1276 Ga0501073_0185327
1277 Ga0501074_0217802
1278 Ga0501074_0775974
1279 Ga0501075_0000740
1280 Ga0501075_0436291
1281 Ga0501076_0003395
1282 Ga0501076_0303695
1283 Ga0501077_0113812
1284 Ga0501077_0114975
1285 Ga0501077_0479764
1286 Ga0501079_0002572
1287 Ga0501079_0097586
1288 Ga0501080_0020198
1289 Ga0501080_0021063
1290 Ga0501080_0239277
1291 Ga0501080_0757594
1292 Ga0501081_0124327
1293 Ga0501081_0141221
1294 Ga0501081_0934286
1295 Ga0501083_0047421
1296 Ga0501083_0171844
1297 Ga0501035_0107271
1298 Ga0501035_0119073
1299 Ga0501035_0267871
1300 Ga0501035_0381347
1301 Ga0501044_0094511
1302 Ga0501044_0176467
1303 Ga0501044_0199519
1304 Ga0501044_0319153
1305 Ga0501045_0032415
1306 Ga0501045_0066160
1307 Ga0501045_0303704
1308 nmdc:mga03683_273026_c1
1309 nmdc:mga03683_49455_c1
1310 nmdc:mga03683_54279_c1
1311 nmdc:mga03n38_230804_c1
1312 nmdc:mga03n38_276749_c1
1313 nmdc:mga00v17_297124_c1
1314 nmdc:mga00v17_7218_c1
1315 nmdc:mga0yw44_121022_c1
1316 nmdc:mga0yw44_138752_c1
1317 nmdc:mga0yw44_266_c1
1318 nmdc:mga0yw44_38525_c1
1319 nmdc:mga0k408_131027_c1
1320 nmdc:mga0k408_1847_c1
1321 nmdc:mga06z11_17067_c1
1322 nmdc:mga06z11_190034_c1
1323 nmdc:mga06z11_321208_c1
1324 nmdc:mga06z11_41074_c1
1325 nmdc:mga06z11_744361_c1
1326 nmdc:mga04h51_56978_c1
1327 nmdc:mga04h51_7801_c1
1328 nmdc:mga07m45_183120_c1
1329 nmdc:mga07m45_35131_c1
1330 nmdc:mga07m45_418217_c1
1331 nmdc:mga07m45_42921_c1
1332 nmdc:mga07m45_443431_c1
1333 nmdc:mga05p37_52588_c1
1334 nmdc:mga05p37_63148_c1
1335 nmdc:mga09592_139964_c1
1336 nmdc:mga09592_202294_c1
1337 nmdc:mga0qj67_144628_c1
1338 nmdc:mga0qj67_28_c1
1339 nmdc:mga0qj67_31154_c1
1340 nmdc:mga0qj67_377762_c1
1341 nmdc:mga06r32_183163_c1
1342 nmdc:mga06r32_264012_c1
1343 nmdc:mga06r32_265153_c1
1344 nmdc:mga06r32_586708_c1
1345 nmdc:mga06r32_72599_c1
1346 nmdc:mga06r32_91171_c1
1347 nmdc:mga08y16_152573_c1
1348 nmdc:mga08y16_24876_c1
1349 nmdc:mga08y16_681540_c1
1350 nmdc:mga08y16_872092_c1
1351 nmdc:mga0n895_232714_c1
1352 nmdc:mga0n895_368754_c1
1353 nmdc:mga0rr50_221606_c1
1354 nmdc:mga08x19_231786_c1
1355 nmdc:mga08x19_90586_c1
1356 nmdc:mga0a205_214923_c1
1357 nmdc:mga0sz30_11359_c1
1358 nmdc:mga0sz30_202465_c1
1359 Ga0495601_0000197
1360 Ga0495601_0014700
1361 Ga0495601_0090097
1362 Ga0495612_0000652
1363 Ga0495612_0022364
1364 Ga0500610_0092865
1365 Ga0495595_0110772
1366 Ga0495595_0306236
1367 Ga0495619_0000160
1368 Ga0495619_0022526
1369 Ga0495619_0130120
1370 Ga0500578_0028704
1371 Ga0500644_0111899
1372 Ga0500641_0007679
1373 Ga0500650_0000263
1374 Ga0500650_0052773
1375 Ga0500555_010280
1376 Ga0500562_021847
1377 Ga0500569_012966
1378 Ga0500595_122106
1379 Ga0500642_0028675
1380 Ga0500658_0208404
1381 Ga0500568_0061382
1382 Ga0500568_0212839
1383 Ga0500588_0003596
1384 Ga0500604_0000718
1385 Ga0500616_0090359
1386 Ga0500616_0120891
1387 Ga0500611_032178
1388 Ga0501084_0057287
1389 Ga0501084_0118375
1390 Ga0501084_0395130
1391 Ga0501082_0006109
1392 Ga0501082_0102934
1393 Ga0501082_0445319
1394 Ga0501082_0492326
1395 Ga0501082_0883705
1396 Ga0530510_0004360
1397 Ga0530510_0367734
1398 Ga0530510_0594447
1399 Ga0530510_0627839
1400 2509370319
1401 2854911800
1402 2883579201
1403 2922370939
1404 2929200290
1405 3004340654
1406 649864843
1407 8004698639
1408 8055912531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

24

158

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jud-assembly1.cif.gz_X crystal structure of the ser26thr mutant of benzoylformate decarboxylase from pseudomonas putida 0.8352 4 169
4k9n-assembly1.cif.gz_C crystal structure of the ala460ile mutant of benzoylformate decarboxylase from pseudomonas putida 0.8278 4 168
4jub-assembly1.cif.gz_C crystal structure of the his70thr mutant of benzoylformate decarboxylase from pseudomonas putida 0.8266 4 168
2v3w-assembly1.cif.gz_A crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida 0.8242 4 170
4k9k-assembly1.cif.gz_A crystal structure of the his281tyr mutant of benzoylformate decarboxylase from pseudomonas putida 0.821 4 168
ID Description Score Start End Superfamily
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9277 10 181 3.40.50.970
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9174 10 181 3.40.50.970
af_A4I3N7_199_405_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8796 2 184 3.40.50.970
af_Q4D595_238_443_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8706 2 184 3.40.50.970
af_Q58077_321_493_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.84 8 175 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A536SBB7-F1-model_v4 Aldehyde dehydrogenase 0.9882 6 106 GO:0016831
GO:0030976
GO:0044281
AF-A0A536XYS1-F1-model_v4 Aldehyde dehydrogenase 0.9773 5 92 GO:0016020
GO:0016831
GO:0030976
GO:0044281
AF-A0A527HE55-F1-model_v4 Aldehyde dehydrogenase 0.974 5 196 GO:0016020
GO:0016831
GO:0030976
GO:0044281
AF-A0A0F4XSL0-F1-model_v4 Aldehyde dehydrogenase 0.9702 1 196 GO:0016831
GO:0030976
GO:0044281
AF-A0A2G2IMF7-F1-model_v4 deleted 0.9698 3 196

Map