F476362

General Info

Members Datasets Scaffolds Average Seq Length
704 251 1408 230

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10532585|Ga0268264_105325851
Length 267
Sequence LHLSNFPYHTQRTFGLSDFSSYFRFMLHLRKIFFTGMLVSFLGSLPLGTLNIAAMQISISDGVTSAALFSVGSLLAEIIYVRLSLVAMDWIRKKEKIFKVLEWVTLAIVLALAASSFYSALHPSQTKNVILSSTTLPHIVLGFVMSAVNPVQIPFWFGWSTVLFTKKILLPRSDHYNAYIVGIGIGTFVGNCVFIFGGLLIASKINKNQHILNWVIGGIFTITALIQIWKMSKKKSAVHHLEHPEEMTHGLEDKVIEMAEPAKHKNP

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
173 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
215 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
220 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
221 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
222 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
223 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
224 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
229 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
230 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
233 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
237 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
238 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
239 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
240 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
241 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 0.14
Rhizosphere 99.01
Stem 0
Stem Tuber 0
Unclassified 14.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_10532585 3300028381 Bacteria 1150
2 JGI24736J21556_1011511 3300001904 Bacteria 1439
3 rootL2_10305178 3300003322 Unclassified 2235
4 Ga0065712_10006174 3300005290 Bacteria 3145
5 Ga0065712_10086124 3300005290 Bacteria 2654
6 Ga0065707_10097497 3300005295 Bacteria 3169
7 Ga0070658_10014938 3300005327 Bacteria 6218
8 Ga0070658_10035406 3300005327 Bacteria 4021
9 Ga0070658_10242927 3300005327 Bacteria 1526
10 Ga0070658_10337646 3300005327 Bacteria 1288
11 Ga0070676_10008849 3300005328 Bacteria 5437
12 Ga0070676_10045790 3300005328 Bacteria 2548
13 Ga0070676_10054138 3300005328 Bacteria 2365
14 Ga0070676_10069609 3300005328 Unclassified 2109
15 Ga0070676_10089757 3300005328 Bacteria 1880
16 Ga0070676_10205855 3300005328 Unclassified 1292
17 Ga0070683_100000211 3300005329 Bacteria 39486
18 Ga0070683_100002694 3300005329 Bacteria 14195
19 Ga0070683_100027240 3300005329 Bacteria 5153
20 Ga0070683_100080319 3300005329 Bacteria 3053
21 Ga0070690_100021753 3300005330 Bacteria 3919
22 Ga0070690_100056837 3300005330 Bacteria 2510
23 Ga0070690_100261553 3300005330 Bacteria 1228
24 Ga0070670_100138562 3300005331 Unclassified 2103
25 Ga0070677_10053045 3300005333 Bacteria 1647
26 Ga0070677_10217793 3300005333 Bacteria 931
27 Ga0068869_100028632 3300005334 Bacteria 3896
28 Ga0068869_100032131 3300005334 Bacteria 3697
29 Ga0068869_100157579 3300005334 Unclassified 1765
30 Ga0068869_100176988 3300005334 Bacteria 1670
31 Ga0068869_100207353 3300005334 Unclassified 1548
32 Ga0068869_100249908 3300005334 Bacteria 1416
33 Ga0070666_10007048 3300005335 Bacteria 6929
34 Ga0070666_10211846 3300005335 Bacteria 1365
35 Ga0070680_100029490 3300005336 Bacteria 4407
36 Ga0070680_100107735 3300005336 Bacteria 2318
37 Ga0070680_100426520 3300005336 Unclassified 1131
38 Ga0070682_100000839 3300005337 Bacteria 17934
39 Ga0070682_100010328 3300005337 Bacteria 5298
40 Ga0070682_100292729 3300005337 Bacteria 1191
41 Ga0068868_100006735 3300005338 Bacteria 8157
42 Ga0068868_100015118 3300005338 Bacteria 5702
43 Ga0068868_100032447 3300005338 Bacteria 4018
44 Ga0068868_100111272 3300005338 Bacteria 2226
45 Ga0068868_100118990 3300005338 Bacteria 2153
46 Ga0068868_100376771 3300005338 Bacteria 1220
47 Ga0070660_100036738 3300005339 Bacteria 3712
48 Ga0070660_100046199 3300005339 Bacteria 3337
49 Ga0070660_100046555 3300005339 Bacteria 3325
50 Ga0070660_100084642 3300005339 Bacteria 2493
51 Ga0070660_100122669 3300005339 Bacteria 2074
52 Ga0070660_100314810 3300005339 Bacteria 1285
53 Ga0070660_100316142 3300005339 Bacteria 1282
54 Ga0070689_100013502 3300005340 Bacteria 5913
55 Ga0070689_100060607 3300005340 Bacteria 2943
56 Ga0070689_100067798 3300005340 Unclassified 2782
57 Ga0070689_100166944 3300005340 Bacteria 1782
58 Ga0070689_100241631 3300005340 Bacteria 1487
59 Ga0070689_100535043 3300005340 Bacteria 1008
60 Ga0070687_100080775 3300005343 Bacteria 1773
61 Ga0070661_100006697 3300005344 Bacteria 7947
62 Ga0070661_100024352 3300005344 Unclassified 4342
63 Ga0070661_100217290 3300005344 Bacteria 1465
64 Ga0070661_100267953 3300005344 Bacteria 1322
65 Ga0070692_10514874 3300005345 Bacteria 778
66 Ga0070668_100052593 3300005347 Bacteria 3139
67 Ga0070668_100108673 3300005347 Bacteria 2206
68 Ga0070668_100158409 3300005347 Bacteria 1835
69 Ga0070669_100002091 3300005353 Bacteria 14439
70 Ga0070669_100124009 3300005353 Bacteria 1975
71 Ga0070669_100170733 3300005353 Bacteria 1695
72 Ga0070675_100005696 3300005354 Bacteria 9539
73 Ga0070675_100064719 3300005354 Unclassified 3023
74 Ga0070675_100078413 3300005354 Unclassified 2751
75 Ga0070675_100693650 3300005354 Bacteria 927
76 Ga0070675_100705630 3300005354 Bacteria 919
77 Ga0070671_100010922 3300005355 Bacteria 7293
78 Ga0070671_100026325 3300005355 Bacteria 4779
79 Ga0070671_100558443 3300005355 Bacteria 988
80 Ga0070674_100008256 3300005356 Bacteria 6189
81 Ga0070673_100007156 3300005364 Bacteria 7331
82 Ga0070673_100011359 3300005364 Bacteria 6077
83 Ga0070673_100039356 3300005364 Bacteria 3617
84 Ga0070673_100124476 3300005364 Bacteria 2155
85 Ga0070673_100141946 3300005364 Bacteria 2027
86 Ga0070688_100006223 3300005365 Bacteria 6359
87 Ga0070688_100037373 3300005365 Bacteria 2958
88 Ga0070688_100054830 3300005365 Unclassified 2498
89 Ga0070688_100106085 3300005365 Bacteria 1861
90 Ga0070659_100016082 3300005366 Bacteria 5613
91 Ga0070659_100036241 3300005366 Unclassified 3844
92 Ga0070659_100071881 3300005366 Bacteria 2752
93 Ga0070659_100097277 3300005366 Bacteria 2365
94 Ga0070667_100035865 3300005367 Bacteria 4156
95 Ga0070667_100087143 3300005367 Bacteria 2680
96 Ga0070667_100176434 3300005367 Unclassified 1889
97 Ga0070667_100399998 3300005367 Bacteria 1250
98 Ga0070701_10113494 3300005438 Bacteria 1517
99 Ga0070701_10230422 3300005438 Bacteria 1109
100 Ga0070705_100313642 3300005440 Bacteria 1129
101 Ga0070705_100391494 3300005440 Bacteria 1026
102 Ga0070663_100033484 3300005455 Unclassified 3550
103 Ga0070663_100224027 3300005455 Bacteria 1477
104 Ga0070678_100038101 3300005456 Bacteria 3381
105 Ga0070678_100152920 3300005456 Bacteria 1861
106 Ga0070662_100002963 3300005457 Bacteria 10548
107 Ga0070662_100028580 3300005457 Bacteria 3881
108 Ga0070662_100046564 3300005457 Bacteria 3116
109 Ga0070662_100057224 3300005457 Bacteria 2833
110 Ga0070662_100230909 3300005457 Bacteria 1480
111 Ga0070681_10058368 3300005458 Bacteria 3838
112 Ga0070681_10078835 3300005458 Bacteria 3251
113 Ga0070681_10090375 3300005458 Bacteria 3013
114 Ga0070681_10351971 3300005458 Bacteria 1383
115 Ga0070681_10360495 3300005458 Bacteria 1364
116 Ga0070681_10878516 3300005458 Bacteria 815
117 Ga0068867_100033160 3300005459 Bacteria 3738
118 Ga0068867_100195774 3300005459 Bacteria 1615
119 Ga0068867_100564181 3300005459 Bacteria 988
120 Ga0068867_100588338 3300005459 Bacteria 969
121 Ga0070685_10042825 3300005466 Bacteria 2585
122 Ga0070685_10208402 3300005466 Bacteria 1274
123 Ga0070706_100328064 3300005467 Bacteria 1427
124 Ga0070698_100013615 3300005471 Bacteria 8611
125 Ga0070698_100025763 3300005471 Bacteria 6127
126 Ga0070698_100378893 3300005471 Unclassified 1347
127 Ga0070699_100096309 3300005518 Bacteria 2592
128 Ga0070679_100000723 3300005530 Bacteria 28502
129 Ga0070679_100001843 3300005530 Bacteria 19045
130 Ga0070679_100011352 3300005530 Bacteria 8489
131 Ga0070679_100112459 3300005530 Bacteria 2709
132 Ga0070679_100192850 3300005530 Bacteria 2006
133 Ga0070679_100616838 3300005530 Bacteria 1028
134 Ga0070679_100763912 3300005530 Unclassified 909
135 Ga0070684_100000568 3300005535 Bacteria 25497
136 Ga0070684_100006331 3300005535 Bacteria 9149
137 Ga0070684_100011376 3300005535 Bacteria 7088
138 Ga0070684_100181359 3300005535 Bacteria 1915
139 Ga0070684_100234902 3300005535 Bacteria 1675
140 Ga0070684_100442748 3300005535 Bacteria 1200
141 Ga0068853_100032600 3300005539 Bacteria 4414
142 Ga0068853_100040732 3300005539 Bacteria 3965
143 Ga0068853_100060886 3300005539 Unclassified 3263
144 Ga0068853_100145941 3300005539 Bacteria 2126
145 Ga0070672_100032139 3300005543 Bacteria 3958
146 Ga0070672_100049424 3300005543 Unclassified 3272
147 Ga0070672_100089633 3300005543 Bacteria 2478
148 Ga0070672_100175821 3300005543 Bacteria 1782
149 Ga0070686_100013257 3300005544 Bacteria 4715
150 Ga0070665_100052269 3300005548 Unclassified 4099
151 Ga0070665_100089780 3300005548 Bacteria 3079
152 Ga0070704_100357289 3300005549 Bacteria 1235
153 Ga0070704_100548266 3300005549 Bacteria 1010
154 Ga0068855_100004190 3300005563 Bacteria 17595
155 Ga0068855_100053098 3300005563 Bacteria 4769
156 Ga0068855_100084661 3300005563 Bacteria 3670
157 Ga0068855_100178558 3300005563 Bacteria 2401
158 Ga0068855_100300670 3300005563 Bacteria 1777
159 Ga0068855_100417991 3300005563 Bacteria 1467
160 Ga0068855_100431322 3300005563 Bacteria 1441
161 Ga0070664_100003902 3300005564 Bacteria 12033
162 Ga0070664_100008242 3300005564 Bacteria 8425
163 Ga0070664_100026204 3300005564 Bacteria 4835
164 Ga0070664_100106912 3300005564 Unclassified 2438
165 Ga0070664_100312696 3300005564 Bacteria 1422
166 Ga0068857_100019417 3300005577 Bacteria 5967
167 Ga0068857_100028509 3300005577 Bacteria 4927
168 Ga0068857_100067965 3300005577 Unclassified 3172
169 Ga0068857_100069046 3300005577 Bacteria 3146
170 Ga0068857_100265526 3300005577 Bacteria 1576
171 Ga0068857_100269077 3300005577 Bacteria 1566
172 Ga0068857_100480156 3300005577 Bacteria 1165
173 Ga0068854_100010782 3300005578 Bacteria 5930
174 Ga0068854_100249378 3300005578 Unclassified 1417
175 Ga0068854_100273094 3300005578 Bacteria 1358
176 Ga0068856_100021551 3300005614 Bacteria 6263
177 Ga0068856_100359251 3300005614 Bacteria 1475
178 Ga0070702_100006061 3300005615 Bacteria 5695
179 Ga0070702_100231125 3300005615 Bacteria 1243
180 Ga0068852_100000563 3300005616 Bacteria 24454
181 Ga0068852_100014576 3300005616 Bacteria 6058
182 Ga0068852_100046492 3300005616 Bacteria 3699
183 Ga0068852_100059679 3300005616 Bacteria 3309
184 Ga0068852_100210613 3300005616 Bacteria 1844
185 Ga0068852_100325583 3300005616 Bacteria 1494
186 Ga0068859_100012192 3300005617 Bacteria 8641
187 Ga0068859_100014826 3300005617 Bacteria 7828
188 Ga0068859_100029379 3300005617 Bacteria 5516
189 Ga0068859_100082264 3300005617 Unclassified 3262
190 Ga0068859_100085891 3300005617 Bacteria 3192
191 Ga0068859_100662986 3300005617 Unclassified 1135
192 Ga0068864_100049456 3300005618 Unclassified 3617
193 Ga0068864_100058367 3300005618 Bacteria 3335
194 Ga0068864_100139403 3300005618 Unclassified 2186
195 Ga0068864_100139841 3300005618 Bacteria 2183
196 Ga0068864_100269443 3300005618 Bacteria 1586
197 Ga0068864_100507916 3300005618 Bacteria 1161
198 Ga0068864_100638701 3300005618 Bacteria 1036
199 Ga0068866_10046820 3300005718 Unclassified 2177
200 Ga0068861_100015284 3300005719 Bacteria 5406
201 Ga0068861_100018566 3300005719 Bacteria 4954
202 Ga0068861_100027622 3300005719 Bacteria 4136
203 Ga0068861_100616141 3300005719 Bacteria 998
204 Ga0068870_10009615 3300005840 Unclassified 4406
205 Ga0068870_10062134 3300005840 Unclassified 2010
206 Ga0068870_10067538 3300005840 Bacteria 1940
207 Ga0068863_100042285 3300005841 Bacteria 4330
208 Ga0068863_100054149 3300005841 Bacteria 3802
209 Ga0068863_100141320 3300005841 Bacteria 2301
210 Ga0068863_100148941 3300005841 Unclassified 2239
211 Ga0068863_100448338 3300005841 Bacteria 1266
212 Ga0068863_100550765 3300005841 Bacteria 1139
213 Ga0068858_100020473 3300005842 Bacteria 6183
214 Ga0068858_100056539 3300005842 Unclassified 3626
215 Ga0068858_100140139 3300005842 Bacteria 2270
216 Ga0068860_100061503 3300005843 Bacteria 3568
217 Ga0068860_100471290 3300005843 Bacteria 1251
218 Ga0068862_100008262 3300005844 Bacteria 8611
219 Ga0068862_100062893 3300005844 Bacteria 3193
220 Ga0081539_10201225 3300005985 Unclassified 920
221 Ga0075366_10079329 3300006195 Bacteria 1959
222 Ga0097621_100016613 3300006237 Bacteria 5568
223 Ga0097621_100025791 3300006237 Bacteria 4602
224 Ga0097621_100188635 3300006237 Bacteria 1784
225 Ga0068871_100176023 3300006358 Bacteria 1837
226 Ga0068871_100190674 3300006358 Bacteria 1766
227 Ga0068871_100295487 3300006358 Bacteria 1420
228 Ga0068871_100407581 3300006358 Unclassified 1212
229 Ga0075434_100093141 3300006871 Bacteria 3016
230 Ga0075434_100692158 3300006871 Bacteria 1037
231 Ga0075429_100356897 3300006880 Bacteria 1280
232 Ga0068865_100195465 3300006881 Bacteria 1567
233 Ga0097620_100012190 3300006931 Bacteria 8641
234 Ga0097620_100014825 3300006931 Bacteria 7828
235 Ga0097620_100029379 3300006931 Bacteria 5516
236 Ga0097620_100082265 3300006931 Unclassified 3262
237 Ga0097620_100085883 3300006931 Bacteria 3192
238 Ga0097620_100662950 3300006931 Unclassified 1135
239 Ga0097620_101168887 3300006931 Bacteria 847
240 Ga0105240_10298832 3300009093 Bacteria 1842
241 Ga0105240_10661630 3300009093 Bacteria 1144
242 Ga0111539_10003454 3300009094 Bacteria 20812
243 Ga0111539_10057975 3300009094 Bacteria 4596
244 Ga0111539_10098124 3300009094 Bacteria 3441
245 Ga0111539_10110494 3300009094 Bacteria 3226
246 Ga0111539_10471860 3300009094 Unclassified 1461
247 Ga0111539_11139685 3300009094 Bacteria 906
248 Ga0105247_10003642 3300009101 Bacteria 10008
249 Ga0105247_10223518 3300009101 Bacteria 1275
250 Ga0105247_10233248 3300009101 Bacteria 1251
251 Ga0114129_10697868 3300009147 Bacteria 1305
252 Ga0114129_10822389 3300009147 Bacteria 1183
253 Ga0105243_10200242 3300009148 Unclassified 1751
254 Ga0105243_10348682 3300009148 Bacteria 1359
255 Ga0105241_10012438 3300009174 Bacteria 6238
256 Ga0105241_10078751 3300009174 Unclassified 2575
257 Ga0105241_10366145 3300009174 Unclassified 1255
258 Ga0105241_10536516 3300009174 Unclassified 1048
259 Ga0105241_10862696 3300009174 Bacteria 838
260 Ga0105242_10016017 3300009176 Bacteria 5824
261 Ga0105242_10037252 3300009176 Bacteria 3906
262 Ga0105242_10603711 3300009176 Bacteria 1060
263 Ga0105248_10698601 3300009177 Bacteria 1144
264 Ga0105237_10102756 3300009545 Bacteria 2850
265 Ga0105237_10256652 3300009545 Bacteria 1750
266 Ga0105249_10004716 3300009553 Bacteria 11769
267 Ga0105249_10061837 3300009553 Unclassified 3436
268 Ga0105249_10070430 3300009553 Unclassified 3228
269 Ga0105249_10115394 3300009553 Unclassified 2544
270 Ga0105249_10123616 3300009553 Bacteria 2462
271 Ga0105249_10227034 3300009553 Bacteria 1840
272 Ga0105249_10527276 3300009553 Bacteria 1229
273 Ga0105249_10667624 3300009553 Unclassified 1098
274 Ga0105249_10894867 3300009553 Unclassified 954
275 Ga0105246_10094086 3300011119 Bacteria 2166
276 Ga0105246_10204258 3300011119 Bacteria 1538
277 Ga0157373_10019799 3300013100 Bacteria 4895
278 Ga0157373_10021980 3300013100 Bacteria 4629
279 Ga0157373_10088688 3300013100 Bacteria 2179
280 Ga0157373_10121183 3300013100 Bacteria 1838
281 Ga0157373_10228810 3300013100 Bacteria 1313
282 Ga0157373_10465652 3300013100 Bacteria 911
283 Ga0157371_10000932 3300013102 Bacteria 32766
284 Ga0157371_10003421 3300013102 Bacteria 14416
285 Ga0157371_10003608 3300013102 Bacteria 13948
286 Ga0157371_10003924 3300013102 Bacteria 13232
287 Ga0157371_10022360 3300013102 Bacteria 4635
288 Ga0157371_10029795 3300013102 Bacteria 3942
289 Ga0157371_10031297 3300013102 Bacteria 3832
290 Ga0157371_10038495 3300013102 Bacteria 3421
291 Ga0157371_10124806 3300013102 Bacteria 1831
292 Ga0157371_10216548 3300013102 Bacteria 1375
293 Ga0157371_10238221 3300013102 Bacteria 1308
294 Ga0157371_10274204 3300013102 Unclassified 1218
295 Ga0157371_10363777 3300013102 Bacteria 1054
296 Ga0157370_10001951 3300013104 Bacteria 25406
297 Ga0157370_10001963 3300013104 Bacteria 25346
298 Ga0157370_10003393 3300013104 Bacteria 18718
299 Ga0157370_10095369 3300013104 Bacteria 2791
300 Ga0157370_10456136 3300013104 Bacteria 1175
301 Ga0157370_10528474 3300013104 Unclassified 1082
302 Ga0157370_10619547 3300013104 Bacteria 990
303 Ga0157370_10842886 3300013104 Bacteria 833
304 Ga0157369_10025473 3300013105 Bacteria 6568
305 Ga0157369_10159172 3300013105 Bacteria 2384
306 Ga0157369_10201026 3300013105 Bacteria 2092
307 Ga0157369_10523038 3300013105 Bacteria 1227
308 Ga0157374_10008376 3300013296 Bacteria 8829
309 Ga0157374_10024342 3300013296 Bacteria 5427
310 Ga0157374_10147256 3300013296 Bacteria 2288
311 Ga0157374_10326026 3300013296 Bacteria 1522
312 Ga0157378_10038744 3300013297 Bacteria 4226
313 Ga0157378_10411694 3300013297 Bacteria 1334
314 Ga0157378_10511793 3300013297 Bacteria 1201
315 Ga0157378_10864864 3300013297 Bacteria 933
316 Ga0163162_10004586 3300013306 Bacteria 13309
317 Ga0163162_10011486 3300013306 Bacteria 8637
318 Ga0163162_10016353 3300013306 Bacteria 7252
319 Ga0163162_10145927 3300013306 Bacteria 2482
320 Ga0163162_10251140 3300013306 Bacteria 1900
321 Ga0163162_10422596 3300013306 Bacteria 1465
322 Ga0163162_10538221 3300013306 Bacteria 1297
323 Ga0157372_10053058 3300013307 Unclassified 4517
324 Ga0157372_10070768 3300013307 Bacteria 3926
325 Ga0157372_10098352 3300013307 Bacteria 3338
326 Ga0157372_10101571 3300013307 Bacteria 3283
327 Ga0157372_10111875 3300013307 Unclassified 3128
328 Ga0157372_10338337 3300013307 Bacteria 1753
329 Ga0157372_10646331 3300013307 Bacteria 1232
330 Ga0157372_10701681 3300013307 Bacteria 1177
331 Ga0157372_10703940 3300013307 Bacteria 1175
332 Ga0157372_10717127 3300013307 Bacteria 1163
333 Ga0157372_10766132 3300013307 Bacteria 1122
334 Ga0157372_11074321 3300013307 Bacteria 931
335 Ga0157372_11129351 3300013307 Unclassified 906
336 Ga0157372_11382353 3300013307 Bacteria 812
337 Ga0157375_10052671 3300013308 Bacteria 4002
338 Ga0157375_10090325 3300013308 Bacteria 3121
339 Ga0157375_10105077 3300013308 Bacteria 2913
340 Ga0157375_10105994 3300013308 Unclassified 2902
341 Ga0157375_10128941 3300013308 Bacteria 2648
342 Ga0157375_10223186 3300013308 Bacteria 2043
343 Ga0157375_10261405 3300013308 Bacteria 1892
344 Ga0157375_10523706 3300013308 Bacteria 1348
345 Ga0157375_10734400 3300013308 Unclassified 1139
346 Ga0157375_11104452 3300013308 Bacteria 928
347 Ga0163163_10013146 3300014325 Bacteria 7565
348 Ga0163163_10067486 3300014325 Unclassified 3556
349 Ga0163163_10249510 3300014325 Bacteria 1825
350 Ga0163163_10286864 3300014325 Bacteria 1698
351 Ga0163163_10545084 3300014325 Bacteria 1222
352 Ga0163163_10673818 3300014325 Bacteria 1098
353 Ga0157380_10003319 3300014326 Bacteria 11040
354 Ga0157380_10025275 3300014326 Bacteria 4502
355 Ga0157380_10028924 3300014326 Bacteria 4232
356 Ga0157380_10197704 3300014326 Bacteria 1781
357 Ga0157377_10003164 3300014745 Bacteria 7422
358 Ga0157377_10018358 3300014745 Bacteria 3634
359 Ga0157377_10056717 3300014745 Unclassified 2225
360 Ga0157377_10113526 3300014745 Bacteria 1632
361 Ga0157377_10188759 3300014745 Bacteria 1301
362 Ga0157379_10185304 3300014968 Unclassified 1881
363 Ga0157376_10112762 3300014969 Bacteria 2396
364 Ga0157376_10165272 3300014969 Unclassified 2010
365 Ga0157376_10632811 3300014969 Bacteria 1068
366 Ga0163161_10038330 3300017792 Bacteria 3438
367 Ga0163161_10166406 3300017792 Bacteria 1684
368 Ga0163161_10176623 3300017792 Bacteria 1635
369 Ga0163161_10189639 3300017792 Bacteria 1580
370 Ga0163161_10269428 3300017792 Bacteria 1332
371 Ga0207666_1010645 3300025271 Bacteria 1261
372 Ga0207697_10023296 3300025315 Unclassified 2535
373 Ga0207682_10033900 3300025893 Bacteria 2056
374 Ga0207642_10020522 3300025899 Bacteria 2581
375 Ga0207642_10174642 3300025899 Bacteria 1165
376 Ga0207710_10036557 3300025900 Unclassified 2165
377 Ga0207710_10087534 3300025900 Bacteria 1453
378 Ga0207680_10031226 3300025903 Unclassified 3015
379 Ga0207647_10006080 3300025904 Bacteria 8796
380 Ga0207645_10008581 3300025907 Bacteria 7119
381 Ga0207645_10020979 3300025907 Bacteria 4267
382 Ga0207645_10030236 3300025907 Bacteria 3490
383 Ga0207645_10124052 3300025907 Unclassified 1678
384 Ga0207645_10155298 3300025907 Bacteria 1495
385 Ga0207643_10009259 3300025908 Bacteria 5291
386 Ga0207643_10089450 3300025908 Bacteria 1793
387 Ga0207705_10003539 3300025909 Bacteria 11893
388 Ga0207705_10023722 3300025909 Bacteria 4377
389 Ga0207705_10046351 3300025909 Unclassified 3124
390 Ga0207705_10056772 3300025909 Unclassified 2824
391 Ga0207705_10068973 3300025909 Bacteria 2560
392 Ga0207707_10176178 3300025912 Bacteria 1868
393 Ga0207707_10180504 3300025912 Bacteria 1843
394 Ga0207707_10281061 3300025912 Bacteria 1442
395 Ga0207695_10042677 3300025913 Bacteria 4840
396 Ga0207660_10028247 3300025917 Bacteria 3836
397 Ga0207662_10107103 3300025918 Bacteria 1739
398 Ga0207657_10061191 3300025919 Bacteria 3229
399 Ga0207657_10087157 3300025919 Bacteria 2612
400 Ga0207657_10101126 3300025919 Bacteria 2393
401 Ga0207657_10169888 3300025919 Bacteria 1767
402 Ga0207657_10186121 3300025919 Bacteria 1677
403 Ga0207657_10374395 3300025919 Bacteria 1122
404 Ga0207649_10005653 3300025920 Bacteria 6769
405 Ga0207649_10038938 3300025920 Unclassified 2881
406 Ga0207649_10039137 3300025920 Bacteria 2873
407 Ga0207649_10234468 3300025920 Bacteria 1314
408 Ga0207652_10000546 3300025921 Bacteria 38083
409 Ga0207652_10000697 3300025921 Bacteria 32555
410 Ga0207652_10001189 3300025921 Bacteria 23425
411 Ga0207652_10017232 3300025921 Bacteria 5910
412 Ga0207652_10114646 3300025921 Bacteria 2393
413 Ga0207652_10478917 3300025921 Bacteria 1121
414 Ga0207681_10043448 3300025923 Bacteria 3008
415 Ga0207681_10176910 3300025923 Bacteria 1622
416 Ga0207650_10054299 3300025925 Bacteria 2971
417 Ga0207650_10070709 3300025925 Bacteria 2624
418 Ga0207650_10275254 3300025925 Bacteria 1369
419 Ga0207650_10397431 3300025925 Bacteria 1140
420 Ga0207659_10051205 3300025926 Unclassified 2936
421 Ga0207659_10193506 3300025926 Bacteria 1619
422 Ga0207644_10092567 3300025931 Bacteria 2256
423 Ga0207644_10527077 3300025931 Bacteria 976
424 Ga0207690_10005226 3300025932 Bacteria 7657
425 Ga0207706_10012046 3300025933 Bacteria 7880
426 Ga0207706_10022666 3300025933 Bacteria 5636
427 Ga0207706_10075785 3300025933 Unclassified 2959
428 Ga0207706_10076473 3300025933 Bacteria 2944
429 Ga0207706_10272413 3300025933 Bacteria 1477
430 Ga0207686_10001727 3300025934 Bacteria 12163
431 Ga0207686_10038900 3300025934 Bacteria 2882
432 Ga0207709_10223908 3300025935 Unclassified 1358
433 Ga0207670_10043689 3300025936 Unclassified 2961
434 Ga0207670_10045588 3300025936 Bacteria 2907
435 Ga0207670_10596207 3300025936 Bacteria 907
436 Ga0207669_10481598 3300025937 Bacteria 989
437 Ga0207669_10569063 3300025937 Unclassified 917
438 Ga0207704_10067150 3300025938 Bacteria 2255
439 Ga0207704_10331957 3300025938 Bacteria 1177
440 Ga0207691_10007169 3300025940 Bacteria 10754
441 Ga0207691_10055970 3300025940 Bacteria 3594
442 Ga0207691_10056174 3300025940 Bacteria 3587
443 Ga0207691_10060609 3300025940 Bacteria 3438
444 Ga0207691_10289913 3300025940 Bacteria 1408
445 Ga0207711_10367428 3300025941 Bacteria 1334
446 Ga0207711_10402995 3300025941 Bacteria 1271
447 Ga0207689_10005785 3300025942 Bacteria 10979
448 Ga0207689_10010494 3300025942 Bacteria 7978
449 Ga0207689_10013015 3300025942 Bacteria 7104
450 Ga0207689_10022434 3300025942 Bacteria 5309
451 Ga0207689_10028065 3300025942 Bacteria 4708
452 Ga0207689_10043720 3300025942 Bacteria 3703
453 Ga0207689_10064671 3300025942 Bacteria 3009
454 Ga0207689_10078905 3300025942 Bacteria 2706
455 Ga0207689_10242134 3300025942 Bacteria 1491
456 Ga0207661_10003519 3300025944 Bacteria 10883
457 Ga0207661_10013659 3300025944 Bacteria 5929
458 Ga0207661_10029870 3300025944 Unclassified 4191
459 Ga0207661_10049574 3300025944 Bacteria 3343
460 Ga0207661_10144819 3300025944 Bacteria 2049
461 Ga0207679_10058371 3300025945 Unclassified 2859
462 Ga0207679_10059402 3300025945 Bacteria 2837
463 Ga0207679_10072155 3300025945 Unclassified 2607
464 Ga0207679_10137953 3300025945 Bacteria 1967
465 Ga0207679_10194033 3300025945 Bacteria 1691
466 Ga0207679_10217202 3300025945 Bacteria 1607
467 Ga0207667_10058892 3300025949 Bacteria 4026
468 Ga0207667_10060111 3300025949 Bacteria 3978
469 Ga0207667_10075413 3300025949 Bacteria 3502
470 Ga0207667_10085396 3300025949 Bacteria 3267
471 Ga0207667_10641435 3300025949 Bacteria 1068
472 Ga0207667_11141393 3300025949 Unclassified 761
473 Ga0207651_10012448 3300025960 Bacteria 4816
474 Ga0207651_10036214 3300025960 Bacteria 3219
475 Ga0207651_10128574 3300025960 Bacteria 1935
476 Ga0207651_10494717 3300025960 Bacteria 1056
477 Ga0207651_10566352 3300025960 Bacteria 990
478 Ga0207712_10005567 3300025961 Bacteria 7949
479 Ga0207712_10066953 3300025961 Bacteria 2569
480 Ga0207712_10070844 3300025961 Bacteria 2506
481 Ga0207712_10174174 3300025961 Bacteria 1684
482 Ga0207712_10452575 3300025961 Bacteria 1089
483 Ga0207668_10025827 3300025972 Bacteria 3806
484 Ga0207668_10483231 3300025972 Bacteria 1063
485 Ga0207640_10026340 3300025981 Bacteria 3529
486 Ga0207640_10136711 3300025981 Unclassified 1780
487 Ga0207640_10141488 3300025981 Bacteria 1754
488 Ga0207658_10058769 3300025986 Bacteria 2863
489 Ga0207658_10118103 3300025986 Bacteria 2109
490 Ga0207658_10137299 3300025986 Bacteria 1974
491 Ga0207658_10284315 3300025986 Bacteria 1419
492 Ga0207658_10517071 3300025986 Bacteria 1065
493 Ga0207677_10026875 3300026023 Unclassified 3615
494 Ga0207677_10075912 3300026023 Bacteria 2391
495 Ga0207677_10210670 3300026023 Bacteria 1552
496 Ga0207677_10333818 3300026023 Bacteria 1264
497 Ga0207703_10026562 3300026035 Unclassified 4558
498 Ga0207703_10028962 3300026035 Bacteria 4370
499 Ga0207703_10229688 3300026035 Bacteria 1663
500 Ga0207639_10041374 3300026041 Unclassified 3447
501 Ga0207639_10082021 3300026041 Bacteria 2556
502 Ga0207639_10085189 3300026041 Bacteria 2513
503 Ga0207639_10110375 3300026041 Bacteria 2240
504 Ga0207639_10195342 3300026041 Bacteria 1731
505 Ga0207639_10309815 3300026041 Bacteria 1398
506 Ga0207678_10008521 3300026067 Bacteria 9034
507 Ga0207678_10148835 3300026067 Unclassified 1999
508 Ga0207678_10668968 3300026067 Bacteria 913
509 Ga0207708_10162289 3300026075 Bacteria 1765
510 Ga0207702_10132760 3300026078 Bacteria 2242
511 Ga0207702_10934800 3300026078 Bacteria 860
512 Ga0207641_10023102 3300026088 Bacteria 5123
513 Ga0207641_10094151 3300026088 Bacteria 2627
514 Ga0207641_10110982 3300026088 Bacteria 2431
515 Ga0207641_10424271 3300026088 Bacteria 1281
516 Ga0207648_10003655 3300026089 Bacteria 16101
517 Ga0207648_10006979 3300026089 Bacteria 11173
518 Ga0207648_10025642 3300026089 Bacteria 5248
519 Ga0207648_10044247 3300026089 Bacteria 3906
520 Ga0207648_10046998 3300026089 Bacteria 3784
521 Ga0207648_10101713 3300026089 Bacteria 2518
522 Ga0207648_10655322 3300026089 Bacteria 971
523 Ga0207676_10012502 3300026095 Bacteria 6085
524 Ga0207676_10123272 3300026095 Bacteria 2189
525 Ga0207676_10138322 3300026095 Bacteria 2081
526 Ga0207676_10149868 3300026095 Bacteria 2008
527 Ga0207676_10169581 3300026095 Bacteria 1900
528 Ga0207676_10948680 3300026095 Bacteria 846
529 Ga0207674_10004509 3300026116 Bacteria 16740
530 Ga0207674_10020530 3300026116 Bacteria 7134
531 Ga0207674_10024037 3300026116 Bacteria 6517
532 Ga0207674_10044776 3300026116 Unclassified 4557
533 Ga0207674_10048047 3300026116 Bacteria 4371
534 Ga0207674_10222690 3300026116 Bacteria 1835
535 Ga0207674_10232372 3300026116 Bacteria 1792
536 Ga0207674_10278066 3300026116 Bacteria 1622
537 Ga0207675_100000359 3300026118 Bacteria 43729
538 Ga0207675_100008546 3300026118 Bacteria 9630
539 Ga0207675_100014275 3300026118 Bacteria 7403
540 Ga0207675_100020892 3300026118 Bacteria 6104
541 Ga0207675_100062813 3300026118 Bacteria 3470
542 Ga0207675_100117854 3300026118 Bacteria 2510
543 Ga0207683_10077919 3300026121 Bacteria 2936
544 Ga0207683_10230677 3300026121 Bacteria 1688
545 Ga0207698_10086896 3300026142 Bacteria 2545
546 Ga0207698_10229795 3300026142 Bacteria 1683
547 Ga0207698_10249632 3300026142 Bacteria 1623
548 Ga0207698_10383831 3300026142 Bacteria 1337
549 Ga0207698_10573283 3300026142 Bacteria 1109
550 Ga0209999_1029698 3300027543 Unclassified 1014
551 Ga0207428_10074585 3300027907 Bacteria 2660
552 Ga0207428_10110233 3300027907 Bacteria 2119
553 Ga0207428_10145231 3300027907 Bacteria 1808
554 Ga0268266_10883970 3300028379 Bacteria 864
555 Ga0268265_10004817 3300028380 Bacteria 9303
556 Ga0268265_10091305 3300028380 Bacteria 2435
557 Ga0268265_10099902 3300028380 Unclassified 2340
558 Ga0268265_10841897 3300028380 Unclassified 897
559 Ga0268264_10030386 3300028381 Bacteria 4428
560 Ga0268264_10037701 3300028381 Bacteria 3986
561 Ga0268264_10082050 3300028381 Bacteria 2758
562 Ga0307515_10000001 3300028794 Bacteria 4259510
563 Ga0307408_100339616 3300031548 Bacteria 1271
564 Ga0307408_100706222 3300031548 Bacteria 907
565 Ga0307407_10527991 3300031903 Unclassified 869
566 Ga0307414_10105384 3300032004 Bacteria 2132
567 Ga0373944_0024518 3300035089 Bacteria 1769
568 Ga0373957_0154540 3300035120 Bacteria 943
569 Ga0373937_0016236 3300036401 Bacteria 6607
570 Ga0373937_0425299 3300036401 Bacteria 1261
571 Ga0395899_0001590 3300037312 Bacteria 19085
572 Ga0395899_0109957 3300037312 Bacteria 1982
573 Ga0395899_0200560 3300037312 Bacteria 1391
574 Ga0395899_0444366 3300037312 Bacteria 850
575 Ga0395900_0004139 3300037418 Bacteria 15441
576 Ga0395900_0005994 3300037418 Bacteria 12692
577 Ga0395900_0124956 3300037418 Bacteria 2638
578 Ga0395900_0127076 3300037418 Bacteria 2614
579 Ga0395898_0001279 3300037466 Bacteria 37056
580 Ga0395898_0017027 3300037466 Bacteria 7422
581 Ga0395898_0049581 3300037466 Bacteria 4113
582 Ga0395898_0599119 3300037466 Bacteria 1044
583 Ga0395905_0092989 3300037471 Bacteria 2828
584 Ga0395905_0205672 3300037471 Unclassified 1845
585 Ga0395901_0004694 3300038443 Bacteria 13783
586 Ga0395901_0007368 3300038443 Bacteria 11099
587 Ga0395901_0082713 3300038443 Bacteria 3354
588 Ga0395901_0132932 3300038443 Bacteria 2615
589 Ga0395901_1098349 3300038443 Bacteria 766
590 Ga0451804_0679079 3300041463 Unclassified 827
591 Ga0439441_003317 3300042001 Unclassified 2364
592 Ga0439445_0017559 3300042004 Bacteria 1769
593 Ga0439449_0047558 3300042007 Bacteria 1588
594 Ga0439457_008873 3300042014 Bacteria 2357
595 Ga0450899_014755 3300042135 Bacteria 889
596 Ga0450918_014091 3300042531 Unclassified 1390
597 Ga0451577_0552929 3300042876 Bacteria 1045
598 Ga0466972_0000108 3300044658 Bacteria 71610
599 Ga0453683_0039870 3300044673 Unclassified 2951
600 Ga0466968_0008074 3300044735 Bacteria 4025
601 Ga0466957_0010733 3300044842 Bacteria 5268
602 Ga0466959_0092150 3300045049 Bacteria 2176
603 Ga0466967_0808439 3300045976 Bacteria 931
604 Ga0495594_0070596 3300046499 Bacteria 1942
605 Ga0495608_0016709 3300046511 Bacteria 5077
606 Ga0495618_0089411 3300046514 Bacteria 1969
607 Ga0495628_0029414 3300046516 Bacteria 4454
608 Ga0495630_0025276 3300046517 Bacteria 4390
609 Ga0495643_0067779 3300046522 Bacteria 1879
610 Ga0495587_0037278 3300046536 Bacteria 2920
611 Ga0495635_0035766 3300046663 Bacteria 3444
612 Ga0495600_0236927 3300046809 Bacteria 1164
613 Ga0495604_0072311 3300047317 Bacteria 2607
614 Ga0495672_0018066 3300047320 Bacteria 4695
615 Ga0495680_0160318 3300047322 Bacteria 1634
616 Ga0495686_0177984 3300047472 Bacteria 1234
617 Ga0501297_003902 3300049520 Bacteria 1507
618 Ga0501298_002958 3300049521 Unclassified 2610
619 Ga0501299_013863 3300049522 Bacteria 1395
620 Ga0501031_0013518 3300049568 Bacteria 5320
621 Ga0501032_0006173 3300049569 Bacteria 8820
622 Ga0501032_0071351 3300049569 Bacteria 2315
623 Ga0501033_0069713 3300049570 Bacteria 2584
624 Ga0501034_0000017 3300049571 Bacteria 285938
625 Ga0501034_0006987 3300049571 Bacteria 12053
626 Ga0501034_0030530 3300049571 Bacteria 5478
627 Ga0501034_0125120 3300049571 Bacteria 2556
628 Ga0501036_0154217 3300049572 Bacteria 1937
629 Ga0501036_0250519 3300049572 Bacteria 1484
630 Ga0501037_0006114 3300049573 Bacteria 8795
631 Ga0501037_0049571 3300049573 Bacteria 3075
632 Ga0501038_0032285 3300049574 Unclassified 4621
633 Ga0501038_0043745 3300049574 Bacteria 3893
634 Ga0501038_0069401 3300049574 Bacteria 2994
635 Ga0501039_0022777 3300049575 Bacteria 4804
636 Ga0501043_0004526 3300049579 Bacteria 11298
637 Ga0501043_0047980 3300049579 Bacteria 3357
638 Ga0501043_0148734 3300049579 Bacteria 1833
639 Ga0501046_0003983 3300049580 Bacteria 13485
640 Ga0501046_0037402 3300049580 Bacteria 3900
641 Ga0501047_0011642 3300049581 Bacteria 8320
642 Ga0501047_0167280 3300049581 Unclassified 2069
643 Ga0501048_0013528 3300049582 Bacteria 6055
644 Ga0501067_0268276 3300049583 Bacteria 950
645 Ga0501070_0021578 3300049586 Bacteria 5403
646 Ga0501070_0837307 3300049586 Bacteria 720
647 Ga0501072_0048925 3300049588 Bacteria 3328
648 Ga0501073_0000371 3300049589 Bacteria 30293
649 Ga0501074_0016939 3300049590 Bacteria 5286
650 Ga0501198_006254 3300049649 Unclassified 1690
651 Ga0501202_000244 3300049652 Bacteria 7207
652 Ga0501217_023609 3300049661 Unclassified 1466
653 Ga0501217_033783 3300049661 Unclassified 1272
654 Ga0501222_010654 3300049662 Bacteria 1214
655 Ga0501223_001309 3300049663 Bacteria 5778
656 Ga0501223_007753 3300049663 Bacteria 2192
657 Ga0501224_002616 3300049664 Bacteria 2468
658 Ga0501233_018242 3300049668 Unclassified 1474
659 Ga0501233_028054 3300049668 Bacteria 1254
660 Ga0501235_003848 3300049669 Bacteria 3239
661 Ga0501236_017332 3300049670 Bacteria 1029
662 Ga0501240_004209 3300049673 Unclassified 1657
663 Ga0501243_000557 3300049675 Bacteria 5005
664 Ga0501243_014570 3300049675 Bacteria 1257
665 Ga0501249_020021 3300049679 Bacteria 1454
666 Ga0501252_009404 3300049682 Bacteria 1138
667 Ga0501257_006945 3300049686 Unclassified 2521
668 Ga0501257_015187 3300049686 Bacteria 1777
669 Ga0501259_000124 3300049688 Bacteria 11295
670 Ga0501259_000844 3300049688 Bacteria 5041
671 Ga0501261_002605 3300049690 Bacteria 2213
672 Ga0501221_000484 3300049704 Bacteria 6247
673 Ga0501221_006176 3300049704 Unclassified 2019
674 Ga0501225_0021030 3300049705 Bacteria 1803
675 Ga0501225_0052519 3300049705 Bacteria 1136
676 Ga0501234_009378 3300049707 Unclassified 1526
677 Ga0501245_001763 3300049708 Bacteria 2841
678 Ga0501080_0036173 3300049742 Bacteria 4609
679 Ga0501080_0106781 3300049742 Bacteria 2595
680 Ga0501083_0050395 3300049744 Bacteria 2802
681 Ga0501266_000169 3300049763 Bacteria 8335
682 Ga0501269_023733 3300049766 Bacteria 770
683 Ga0501273_004972 3300049770 Bacteria 1485
684 Ga0501274_003712 3300049771 Unclassified 1240
685 Ga0501280_019341 3300049776 Bacteria 1002
686 Ga0501281_02638 3300049777 Bacteria 1303
687 Ga0501035_0027229 3300049822 Bacteria 5225
688 Ga0501044_0006481 3300049823 Bacteria 12930
689 Ga0501044_0010337 3300049823 Bacteria 10132
690 Ga0501044_0038669 3300049823 Bacteria 4982
691 Ga0501044_0042475 3300049823 Bacteria 4728
692 Ga0501044_0062657 3300049823 Bacteria 3801
693 nmdc:mga09592_456136_c1 3300050508 Bacteria 1102
694 nmdc:mga08y16_1008685_c1 3300050511 Unclassified 812
695 nmdc:mga08y16_106935_c1 3300050511 Bacteria 2912
696 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
697 nmdc:mga08y16_413986_c1 3300050511 Bacteria 1378
698 nmdc:mga08y16_90693_c1 3300050511 Bacteria 3186
699 nmdc:mga0n895_863283_c1 3300050512 Bacteria 892
700 Ga0500641_0040983 3300053096 Bacteria 1872
701 Ga0500568_0000562 3300053139 Bacteria 27303
702 Ga0500611_000092 3300053727 Bacteria 25966
703 Ga0501084_0526986 3300054114 Bacteria 999
704 Ga0501082_0181995 3300060353 Bacteria 1828
705 Ga0268264_10532585
706 JGI24736J21556_1011511
707 rootL2_10305178
708 Ga0065712_10006174
709 Ga0065712_10086124
710 Ga0065707_10097497
711 Ga0070658_10014938
712 Ga0070658_10035406
713 Ga0070658_10242927
714 Ga0070658_10337646
715 Ga0070676_10008849
716 Ga0070676_10045790
717 Ga0070676_10054138
718 Ga0070676_10069609
719 Ga0070676_10089757
720 Ga0070676_10205855
721 Ga0070683_100000211
722 Ga0070683_100002694
723 Ga0070683_100027240
724 Ga0070683_100080319
725 Ga0070690_100021753
726 Ga0070690_100056837
727 Ga0070690_100261553
728 Ga0070670_100138562
729 Ga0070677_10053045
730 Ga0070677_10217793
731 Ga0068869_100028632
732 Ga0068869_100032131
733 Ga0068869_100157579
734 Ga0068869_100176988
735 Ga0068869_100207353
736 Ga0068869_100249908
737 Ga0070666_10007048
738 Ga0070666_10211846
739 Ga0070680_100029490
740 Ga0070680_100107735
741 Ga0070680_100426520
742 Ga0070682_100000839
743 Ga0070682_100010328
744 Ga0070682_100292729
745 Ga0068868_100006735
746 Ga0068868_100015118
747 Ga0068868_100032447
748 Ga0068868_100111272
749 Ga0068868_100118990
750 Ga0068868_100376771
751 Ga0070660_100036738
752 Ga0070660_100046199
753 Ga0070660_100046555
754 Ga0070660_100084642
755 Ga0070660_100122669
756 Ga0070660_100314810
757 Ga0070660_100316142
758 Ga0070689_100013502
759 Ga0070689_100060607
760 Ga0070689_100067798
761 Ga0070689_100166944
762 Ga0070689_100241631
763 Ga0070689_100535043
764 Ga0070687_100080775
765 Ga0070661_100006697
766 Ga0070661_100024352
767 Ga0070661_100217290
768 Ga0070661_100267953
769 Ga0070692_10514874
770 Ga0070668_100052593
771 Ga0070668_100108673
772 Ga0070668_100158409
773 Ga0070669_100002091
774 Ga0070669_100124009
775 Ga0070669_100170733
776 Ga0070675_100005696
777 Ga0070675_100064719
778 Ga0070675_100078413
779 Ga0070675_100693650
780 Ga0070675_100705630
781 Ga0070671_100010922
782 Ga0070671_100026325
783 Ga0070671_100558443
784 Ga0070674_100008256
785 Ga0070673_100007156
786 Ga0070673_100011359
787 Ga0070673_100039356
788 Ga0070673_100124476
789 Ga0070673_100141946
790 Ga0070688_100006223
791 Ga0070688_100037373
792 Ga0070688_100054830
793 Ga0070688_100106085
794 Ga0070659_100016082
795 Ga0070659_100036241
796 Ga0070659_100071881
797 Ga0070659_100097277
798 Ga0070667_100035865
799 Ga0070667_100087143
800 Ga0070667_100176434
801 Ga0070667_100399998
802 Ga0070701_10113494
803 Ga0070701_10230422
804 Ga0070705_100313642
805 Ga0070705_100391494
806 Ga0070663_100033484
807 Ga0070663_100224027
808 Ga0070678_100038101
809 Ga0070678_100152920
810 Ga0070662_100002963
811 Ga0070662_100028580
812 Ga0070662_100046564
813 Ga0070662_100057224
814 Ga0070662_100230909
815 Ga0070681_10058368
816 Ga0070681_10078835
817 Ga0070681_10090375
818 Ga0070681_10351971
819 Ga0070681_10360495
820 Ga0070681_10878516
821 Ga0068867_100033160
822 Ga0068867_100195774
823 Ga0068867_100564181
824 Ga0068867_100588338
825 Ga0070685_10042825
826 Ga0070685_10208402
827 Ga0070706_100328064
828 Ga0070698_100013615
829 Ga0070698_100025763
830 Ga0070698_100378893
831 Ga0070699_100096309
832 Ga0070679_100000723
833 Ga0070679_100001843
834 Ga0070679_100011352
835 Ga0070679_100112459
836 Ga0070679_100192850
837 Ga0070679_100616838
838 Ga0070679_100763912
839 Ga0070684_100000568
840 Ga0070684_100006331
841 Ga0070684_100011376
842 Ga0070684_100181359
843 Ga0070684_100234902
844 Ga0070684_100442748
845 Ga0068853_100032600
846 Ga0068853_100040732
847 Ga0068853_100060886
848 Ga0068853_100145941
849 Ga0070672_100032139
850 Ga0070672_100049424
851 Ga0070672_100089633
852 Ga0070672_100175821
853 Ga0070686_100013257
854 Ga0070665_100052269
855 Ga0070665_100089780
856 Ga0070704_100357289
857 Ga0070704_100548266
858 Ga0068855_100004190
859 Ga0068855_100053098
860 Ga0068855_100084661
861 Ga0068855_100178558
862 Ga0068855_100300670
863 Ga0068855_100417991
864 Ga0068855_100431322
865 Ga0070664_100003902
866 Ga0070664_100008242
867 Ga0070664_100026204
868 Ga0070664_100106912
869 Ga0070664_100312696
870 Ga0068857_100019417
871 Ga0068857_100028509
872 Ga0068857_100067965
873 Ga0068857_100069046
874 Ga0068857_100265526
875 Ga0068857_100269077
876 Ga0068857_100480156
877 Ga0068854_100010782
878 Ga0068854_100249378
879 Ga0068854_100273094
880 Ga0068856_100021551
881 Ga0068856_100359251
882 Ga0070702_100006061
883 Ga0070702_100231125
884 Ga0068852_100000563
885 Ga0068852_100014576
886 Ga0068852_100046492
887 Ga0068852_100059679
888 Ga0068852_100210613
889 Ga0068852_100325583
890 Ga0068859_100012192
891 Ga0068859_100014826
892 Ga0068859_100029379
893 Ga0068859_100082264
894 Ga0068859_100085891
895 Ga0068859_100662986
896 Ga0068864_100049456
897 Ga0068864_100058367
898 Ga0068864_100139403
899 Ga0068864_100139841
900 Ga0068864_100269443
901 Ga0068864_100507916
902 Ga0068864_100638701
903 Ga0068866_10046820
904 Ga0068861_100015284
905 Ga0068861_100018566
906 Ga0068861_100027622
907 Ga0068861_100616141
908 Ga0068870_10009615
909 Ga0068870_10062134
910 Ga0068870_10067538
911 Ga0068863_100042285
912 Ga0068863_100054149
913 Ga0068863_100141320
914 Ga0068863_100148941
915 Ga0068863_100448338
916 Ga0068863_100550765
917 Ga0068858_100020473
918 Ga0068858_100056539
919 Ga0068858_100140139
920 Ga0068860_100061503
921 Ga0068860_100471290
922 Ga0068862_100008262
923 Ga0068862_100062893
924 Ga0081539_10201225
925 Ga0075366_10079329
926 Ga0097621_100016613
927 Ga0097621_100025791
928 Ga0097621_100188635
929 Ga0068871_100176023
930 Ga0068871_100190674
931 Ga0068871_100295487
932 Ga0068871_100407581
933 Ga0075434_100093141
934 Ga0075434_100692158
935 Ga0075429_100356897
936 Ga0068865_100195465
937 Ga0097620_100012190
938 Ga0097620_100014825
939 Ga0097620_100029379
940 Ga0097620_100082265
941 Ga0097620_100085883
942 Ga0097620_100662950
943 Ga0097620_101168887
944 Ga0105240_10298832
945 Ga0105240_10661630
946 Ga0111539_10003454
947 Ga0111539_10057975
948 Ga0111539_10098124
949 Ga0111539_10110494
950 Ga0111539_10471860
951 Ga0111539_11139685
952 Ga0105247_10003642
953 Ga0105247_10223518
954 Ga0105247_10233248
955 Ga0114129_10697868
956 Ga0114129_10822389
957 Ga0105243_10200242
958 Ga0105243_10348682
959 Ga0105241_10012438
960 Ga0105241_10078751
961 Ga0105241_10366145
962 Ga0105241_10536516
963 Ga0105241_10862696
964 Ga0105242_10016017
965 Ga0105242_10037252
966 Ga0105242_10603711
967 Ga0105248_10698601
968 Ga0105237_10102756
969 Ga0105237_10256652
970 Ga0105249_10004716
971 Ga0105249_10061837
972 Ga0105249_10070430
973 Ga0105249_10115394
974 Ga0105249_10123616
975 Ga0105249_10227034
976 Ga0105249_10527276
977 Ga0105249_10667624
978 Ga0105249_10894867
979 Ga0105246_10094086
980 Ga0105246_10204258
981 Ga0157373_10019799
982 Ga0157373_10021980
983 Ga0157373_10088688
984 Ga0157373_10121183
985 Ga0157373_10228810
986 Ga0157373_10465652
987 Ga0157371_10000932
988 Ga0157371_10003421
989 Ga0157371_10003608
990 Ga0157371_10003924
991 Ga0157371_10022360
992 Ga0157371_10029795
993 Ga0157371_10031297
994 Ga0157371_10038495
995 Ga0157371_10124806
996 Ga0157371_10216548
997 Ga0157371_10238221
998 Ga0157371_10274204
999 Ga0157371_10363777
1000 Ga0157370_10001951
1001 Ga0157370_10001963
1002 Ga0157370_10003393
1003 Ga0157370_10095369
1004 Ga0157370_10456136
1005 Ga0157370_10528474
1006 Ga0157370_10619547
1007 Ga0157370_10842886
1008 Ga0157369_10025473
1009 Ga0157369_10159172
1010 Ga0157369_10201026
1011 Ga0157369_10523038
1012 Ga0157374_10008376
1013 Ga0157374_10024342
1014 Ga0157374_10147256
1015 Ga0157374_10326026
1016 Ga0157378_10038744
1017 Ga0157378_10411694
1018 Ga0157378_10511793
1019 Ga0157378_10864864
1020 Ga0163162_10004586
1021 Ga0163162_10011486
1022 Ga0163162_10016353
1023 Ga0163162_10145927
1024 Ga0163162_10251140
1025 Ga0163162_10422596
1026 Ga0163162_10538221
1027 Ga0157372_10053058
1028 Ga0157372_10070768
1029 Ga0157372_10098352
1030 Ga0157372_10101571
1031 Ga0157372_10111875
1032 Ga0157372_10338337
1033 Ga0157372_10646331
1034 Ga0157372_10701681
1035 Ga0157372_10703940
1036 Ga0157372_10717127
1037 Ga0157372_10766132
1038 Ga0157372_11074321
1039 Ga0157372_11129351
1040 Ga0157372_11382353
1041 Ga0157375_10052671
1042 Ga0157375_10090325
1043 Ga0157375_10105077
1044 Ga0157375_10105994
1045 Ga0157375_10128941
1046 Ga0157375_10223186
1047 Ga0157375_10261405
1048 Ga0157375_10523706
1049 Ga0157375_10734400
1050 Ga0157375_11104452
1051 Ga0163163_10013146
1052 Ga0163163_10067486
1053 Ga0163163_10249510
1054 Ga0163163_10286864
1055 Ga0163163_10545084
1056 Ga0163163_10673818
1057 Ga0157380_10003319
1058 Ga0157380_10025275
1059 Ga0157380_10028924
1060 Ga0157380_10197704
1061 Ga0157377_10003164
1062 Ga0157377_10018358
1063 Ga0157377_10056717
1064 Ga0157377_10113526
1065 Ga0157377_10188759
1066 Ga0157379_10185304
1067 Ga0157376_10112762
1068 Ga0157376_10165272
1069 Ga0157376_10632811
1070 Ga0163161_10038330
1071 Ga0163161_10166406
1072 Ga0163161_10176623
1073 Ga0163161_10189639
1074 Ga0163161_10269428
1075 Ga0207666_1010645
1076 Ga0207697_10023296
1077 Ga0207682_10033900
1078 Ga0207642_10020522
1079 Ga0207642_10174642
1080 Ga0207710_10036557
1081 Ga0207710_10087534
1082 Ga0207680_10031226
1083 Ga0207647_10006080
1084 Ga0207645_10008581
1085 Ga0207645_10020979
1086 Ga0207645_10030236
1087 Ga0207645_10124052
1088 Ga0207645_10155298
1089 Ga0207643_10009259
1090 Ga0207643_10089450
1091 Ga0207705_10003539
1092 Ga0207705_10023722
1093 Ga0207705_10046351
1094 Ga0207705_10056772
1095 Ga0207705_10068973
1096 Ga0207707_10176178
1097 Ga0207707_10180504
1098 Ga0207707_10281061
1099 Ga0207695_10042677
1100 Ga0207660_10028247
1101 Ga0207662_10107103
1102 Ga0207657_10061191
1103 Ga0207657_10087157
1104 Ga0207657_10101126
1105 Ga0207657_10169888
1106 Ga0207657_10186121
1107 Ga0207657_10374395
1108 Ga0207649_10005653
1109 Ga0207649_10038938
1110 Ga0207649_10039137
1111 Ga0207649_10234468
1112 Ga0207652_10000546
1113 Ga0207652_10000697
1114 Ga0207652_10001189
1115 Ga0207652_10017232
1116 Ga0207652_10114646
1117 Ga0207652_10478917
1118 Ga0207681_10043448
1119 Ga0207681_10176910
1120 Ga0207650_10054299
1121 Ga0207650_10070709
1122 Ga0207650_10275254
1123 Ga0207650_10397431
1124 Ga0207659_10051205
1125 Ga0207659_10193506
1126 Ga0207644_10092567
1127 Ga0207644_10527077
1128 Ga0207690_10005226
1129 Ga0207706_10012046
1130 Ga0207706_10022666
1131 Ga0207706_10075785
1132 Ga0207706_10076473
1133 Ga0207706_10272413
1134 Ga0207686_10001727
1135 Ga0207686_10038900
1136 Ga0207709_10223908
1137 Ga0207670_10043689
1138 Ga0207670_10045588
1139 Ga0207670_10596207
1140 Ga0207669_10481598
1141 Ga0207669_10569063
1142 Ga0207704_10067150
1143 Ga0207704_10331957
1144 Ga0207691_10007169
1145 Ga0207691_10055970
1146 Ga0207691_10056174
1147 Ga0207691_10060609
1148 Ga0207691_10289913
1149 Ga0207711_10367428
1150 Ga0207711_10402995
1151 Ga0207689_10005785
1152 Ga0207689_10010494
1153 Ga0207689_10013015
1154 Ga0207689_10022434
1155 Ga0207689_10028065
1156 Ga0207689_10043720
1157 Ga0207689_10064671
1158 Ga0207689_10078905
1159 Ga0207689_10242134
1160 Ga0207661_10003519
1161 Ga0207661_10013659
1162 Ga0207661_10029870
1163 Ga0207661_10049574
1164 Ga0207661_10144819
1165 Ga0207679_10058371
1166 Ga0207679_10059402
1167 Ga0207679_10072155
1168 Ga0207679_10137953
1169 Ga0207679_10194033
1170 Ga0207679_10217202
1171 Ga0207667_10058892
1172 Ga0207667_10060111
1173 Ga0207667_10075413
1174 Ga0207667_10085396
1175 Ga0207667_10641435
1176 Ga0207667_11141393
1177 Ga0207651_10012448
1178 Ga0207651_10036214
1179 Ga0207651_10128574
1180 Ga0207651_10494717
1181 Ga0207651_10566352
1182 Ga0207712_10005567
1183 Ga0207712_10066953
1184 Ga0207712_10070844
1185 Ga0207712_10174174
1186 Ga0207712_10452575
1187 Ga0207668_10025827
1188 Ga0207668_10483231
1189 Ga0207640_10026340
1190 Ga0207640_10136711
1191 Ga0207640_10141488
1192 Ga0207658_10058769
1193 Ga0207658_10118103
1194 Ga0207658_10137299
1195 Ga0207658_10284315
1196 Ga0207658_10517071
1197 Ga0207677_10026875
1198 Ga0207677_10075912
1199 Ga0207677_10210670
1200 Ga0207677_10333818
1201 Ga0207703_10026562
1202 Ga0207703_10028962
1203 Ga0207703_10229688
1204 Ga0207639_10041374
1205 Ga0207639_10082021
1206 Ga0207639_10085189
1207 Ga0207639_10110375
1208 Ga0207639_10195342
1209 Ga0207639_10309815
1210 Ga0207678_10008521
1211 Ga0207678_10148835
1212 Ga0207678_10668968
1213 Ga0207708_10162289
1214 Ga0207702_10132760
1215 Ga0207702_10934800
1216 Ga0207641_10023102
1217 Ga0207641_10094151
1218 Ga0207641_10110982
1219 Ga0207641_10424271
1220 Ga0207648_10003655
1221 Ga0207648_10006979
1222 Ga0207648_10025642
1223 Ga0207648_10044247
1224 Ga0207648_10046998
1225 Ga0207648_10101713
1226 Ga0207648_10655322
1227 Ga0207676_10012502
1228 Ga0207676_10123272
1229 Ga0207676_10138322
1230 Ga0207676_10149868
1231 Ga0207676_10169581
1232 Ga0207676_10948680
1233 Ga0207674_10004509
1234 Ga0207674_10020530
1235 Ga0207674_10024037
1236 Ga0207674_10044776
1237 Ga0207674_10048047
1238 Ga0207674_10222690
1239 Ga0207674_10232372
1240 Ga0207674_10278066
1241 Ga0207675_100000359
1242 Ga0207675_100008546
1243 Ga0207675_100014275
1244 Ga0207675_100020892
1245 Ga0207675_100062813
1246 Ga0207675_100117854
1247 Ga0207683_10077919
1248 Ga0207683_10230677
1249 Ga0207698_10086896
1250 Ga0207698_10229795
1251 Ga0207698_10249632
1252 Ga0207698_10383831
1253 Ga0207698_10573283
1254 Ga0209999_1029698
1255 Ga0207428_10074585
1256 Ga0207428_10110233
1257 Ga0207428_10145231
1258 Ga0268266_10883970
1259 Ga0268265_10004817
1260 Ga0268265_10091305
1261 Ga0268265_10099902
1262 Ga0268265_10841897
1263 Ga0268264_10030386
1264 Ga0268264_10037701
1265 Ga0268264_10082050
1266 Ga0307515_10000001
1267 Ga0307408_100339616
1268 Ga0307408_100706222
1269 Ga0307407_10527991
1270 Ga0307414_10105384
1271 Ga0373944_0024518
1272 Ga0373957_0154540
1273 Ga0373937_0016236
1274 Ga0373937_0425299
1275 Ga0395899_0001590
1276 Ga0395899_0109957
1277 Ga0395899_0200560
1278 Ga0395899_0444366
1279 Ga0395900_0004139
1280 Ga0395900_0005994
1281 Ga0395900_0124956
1282 Ga0395900_0127076
1283 Ga0395898_0001279
1284 Ga0395898_0017027
1285 Ga0395898_0049581
1286 Ga0395898_0599119
1287 Ga0395905_0092989
1288 Ga0395905_0205672
1289 Ga0395901_0004694
1290 Ga0395901_0007368
1291 Ga0395901_0082713
1292 Ga0395901_0132932
1293 Ga0395901_1098349
1294 Ga0451804_0679079
1295 Ga0439441_003317
1296 Ga0439445_0017559
1297 Ga0439449_0047558
1298 Ga0439457_008873
1299 Ga0450899_014755
1300 Ga0450918_014091
1301 Ga0451577_0552929
1302 Ga0466972_0000108
1303 Ga0453683_0039870
1304 Ga0466968_0008074
1305 Ga0466957_0010733
1306 Ga0466959_0092150
1307 Ga0466967_0808439
1308 Ga0495594_0070596
1309 Ga0495608_0016709
1310 Ga0495618_0089411
1311 Ga0495628_0029414
1312 Ga0495630_0025276
1313 Ga0495643_0067779
1314 Ga0495587_0037278
1315 Ga0495635_0035766
1316 Ga0495600_0236927
1317 Ga0495604_0072311
1318 Ga0495672_0018066
1319 Ga0495680_0160318
1320 Ga0495686_0177984
1321 Ga0501297_003902
1322 Ga0501298_002958
1323 Ga0501299_013863
1324 Ga0501031_0013518
1325 Ga0501032_0006173
1326 Ga0501032_0071351
1327 Ga0501033_0069713
1328 Ga0501034_0000017
1329 Ga0501034_0006987
1330 Ga0501034_0030530
1331 Ga0501034_0125120
1332 Ga0501036_0154217
1333 Ga0501036_0250519
1334 Ga0501037_0006114
1335 Ga0501037_0049571
1336 Ga0501038_0032285
1337 Ga0501038_0043745
1338 Ga0501038_0069401
1339 Ga0501039_0022777
1340 Ga0501043_0004526
1341 Ga0501043_0047980
1342 Ga0501043_0148734
1343 Ga0501046_0003983
1344 Ga0501046_0037402
1345 Ga0501047_0011642
1346 Ga0501047_0167280
1347 Ga0501048_0013528
1348 Ga0501067_0268276
1349 Ga0501070_0021578
1350 Ga0501070_0837307
1351 Ga0501072_0048925
1352 Ga0501073_0000371
1353 Ga0501074_0016939
1354 Ga0501198_006254
1355 Ga0501202_000244
1356 Ga0501217_023609
1357 Ga0501217_033783
1358 Ga0501222_010654
1359 Ga0501223_001309
1360 Ga0501223_007753
1361 Ga0501224_002616
1362 Ga0501233_018242
1363 Ga0501233_028054
1364 Ga0501235_003848
1365 Ga0501236_017332
1366 Ga0501240_004209
1367 Ga0501243_000557
1368 Ga0501243_014570
1369 Ga0501249_020021
1370 Ga0501252_009404
1371 Ga0501257_006945
1372 Ga0501257_015187
1373 Ga0501259_000124
1374 Ga0501259_000844
1375 Ga0501261_002605
1376 Ga0501221_000484
1377 Ga0501221_006176
1378 Ga0501225_0021030
1379 Ga0501225_0052519
1380 Ga0501234_009378
1381 Ga0501245_001763
1382 Ga0501080_0036173
1383 Ga0501080_0106781
1384 Ga0501083_0050395
1385 Ga0501266_000169
1386 Ga0501269_023733
1387 Ga0501273_004972
1388 Ga0501274_003712
1389 Ga0501280_019341
1390 Ga0501281_02638
1391 Ga0501035_0027229
1392 Ga0501044_0006481
1393 Ga0501044_0010337
1394 Ga0501044_0038669
1395 Ga0501044_0042475
1396 Ga0501044_0062657
1397 nmdc:mga09592_456136_c1
1398 nmdc:mga08y16_1008685_c1
1399 nmdc:mga08y16_106935_c1
1400 nmdc:mga08y16_3350_c1
1401 nmdc:mga08y16_413986_c1
1402 nmdc:mga08y16_90693_c1
1403 nmdc:mga0n895_863283_c1
1404 Ga0500641_0040983
1405 Ga0500568_0000562
1406 Ga0500611_000092
1407 Ga0501084_0526986
1408 Ga0501082_0181995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

41

229

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g9x-assembly1.cif.gz_A crystal structure of a mfs transporter at 2.54 angstroem resolution 0.4612 1 201
6w4s-assembly1.cif.gz_F structure of apo human ferroportin in lipid nanodisc 0.4391 6 208
5ayn-assembly1.cif.gz_A crystal structure of a bacterial homologue of iron transporter ferroportin in outward-facing state 0.4286 3 203
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.4148 3 202
6wbv-assembly1.cif.gz_A structure of human ferroportin bound to hepcidin and cobalt in lipid nanodisc 0.414 11 211
ID Description Score Start End Superfamily
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6098 8 204 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5506 35 196 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5343 35 196 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5302 8 204 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4884 3 200 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5B8VGC1-F1-model_v4 Lysine transporter LysE 0.9496 1 208 GO:0005886
GO:0006865
AF-A0A259HLW1-F1-model_v4 Lysine transporter LysE 0.9425 3 206 GO:0005886
GO:0006865
AF-A0A7J5WM12-F1-model_v4 Lysine transporter LysE 0.9399 3 209 GO:0005886
GO:0006865
AF-A0A4V5UVE0-F1-model_v4 Lysine transporter LysE 0.9231 3 205 GO:0005886
GO:0006865
AF-A0A7J5WM12-F1-model_v4 Lysine transporter LysE 0.9187 3 209 GO:0005886
GO:0006865

Map