F476364

General Info

Members Datasets Scaffolds Average Seq Length
704 372 625 112

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10197771|Ga0307413_101977712
Length 110
Sequence MKSSVLTRYRVMAYVTAVMLLVLCVCMIFKYGFDKGEGLTLVVSQVHGVLYIIYLIFAFDLGSKAKWPFGKLLWVLVSGTIPTAAFFVERKVVREVEPLITDGSPVTAKA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2643221714 Streptomyces sp. Root264 Isolate Unclassified
13 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
18 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
19 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
20 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
21 2808606448 Streptomyces sp. 193411 Isolate Unclassified
22 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
25 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
26 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
27 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
28 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
29 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
30 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
31 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
32 2862574272 Streptomyces sp. AcE210 Isolate Nodule
33 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
34 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
35 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
36 2867369537 Streptomyces sp. Z26 Isolate Unclassified
37 2867428634 Streptomyces sp. RP5T Isolate Unclassified
38 2867475112 Streptomyces sp. TM32 Isolate Unclassified
39 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
40 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
41 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
42 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
43 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
44 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
45 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
46 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
47 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
48 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
49 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
50 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
51 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
52 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
53 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
54 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
55 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
56 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
57 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
58 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
59 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
60 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
61 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
62 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
63 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
64 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
65 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
66 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
67 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
68 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
69 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
70 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
71 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
157 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
168 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
169 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
170 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
171 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
172 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
173 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
271 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
284 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
332 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
333 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
334 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
335 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
336 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
339 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
340 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
341 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
342 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
346 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
347 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
348 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
351 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
352 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
353 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
359 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
360 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
361 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
362 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
363 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
364 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
365 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
366 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
367 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
368 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
369 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
370 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
371 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
372 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 0.28
Isolates 11.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.67
Nodule 0.43
Rhizoplane 1.14
Rhizosphere 80.26
Stem 0
Stem Tuber 0
Unclassified 10.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015480 3300001989 Bacteria 2772
2 JGI24737J22298_10047793 3300001990 Bacteria 1304
3 JGI24735J21928_10030103 3300002067 Bacteria 1613
4 JGI24738J21930_10098346 3300002075 Bacteria 623
5 rootH1_10016340 3300003316 Bacteria 8453
6 rootH1_10016340 3300003323 Bacteria 11100
7 rootH2_10108408 3300003320 Bacteria 5563
8 rootL2_10011295 3300003322 Bacteria 4559
9 rootH1_10003211 3300003323 Bacteria 1150
10 rootH1_10025281 3300003323 Bacteria 8817
11 rootH1_10025282 3300003323 Bacteria 4240
12 JGI25160J50197_1011015 3300003354 Bacteria 3234
13 JGI25160J50197_1011075 3300003354 Bacteria 3220
14 Ga0006562J51391_1157409 3300003578 Bacteria 5811
15 Ga0006562J51391_1157410 3300003578 Bacteria 5640
16 Ga0070711_101434341 3300005439 Bacteria 601
17 Ga0070698_101222930 3300005471 Bacteria 701
18 Ga0068853_100054136 3300005539 Bacteria 3458
19 Ga0070672_101240266 3300005543 Bacteria 665
20 Ga0070665_102167319 3300005548 Bacteria 560
21 Ga0068856_100223398 3300005614 Bacteria 1899
22 Ga0068852_102419579 3300005616 Bacteria 546
23 Ga0068858_101722765 3300005842 Bacteria 619
24 Ga0081455_10100897 3300005937 Bacteria 2318
25 Ga0075365_10147713 3300006038 Bacteria 1634
26 Ga0075368_10050013 3300006042 Bacteria 1659
27 Ga0075363_100693062 3300006048 Bacteria 615
28 Ga0075367_10001932 3300006178 Bacteria 9195
29 Ga0075370_10530982 3300006353 Bacteria 711
30 Ga0105251_10013900 3300009011 Bacteria 4477
31 Ga0105244_10078114 3300009036 Bacteria 1641
32 Ga0105250_10032581 3300009092 Bacteria 2093
33 Ga0105245_10214889 3300009098 Bacteria 1852
34 Ga0105247_10156622 3300009101 Bacteria 1505
35 Ga0105243_10154889 3300009148 Bacteria 1970
36 Ga0105238_10203850 3300009551 Bacteria 1954
37 Ga0105238_10477877 3300009551 Bacteria 1245
38 Ga0105238_11100643 3300009551 Bacteria 817
39 Ga0105249_10728011 3300009553 Bacteria 1053
40 Ga0105239_10510121 3300010375 Bacteria 1368
41 Ga0105239_10580632 3300010375 Bacteria 1278
42 Ga0105239_11605999 3300010375 Bacteria 752
43 Ga0105246_10088014 3300011119 Bacteria 2230
44 Ga0105246_11043860 3300011119 Bacteria 743
45 Ga0157369_10170298 3300013105 Bacteria 2295
46 Ga0163162_12525273 3300013306 Bacteria 591
47 Ga0157372_10498816 3300013307 Bacteria 1419
48 Ga0157375_10442088 3300013308 Bacteria 1466
49 Ga0182008_10001944 3300014497 Bacteria 13339
50 Ga0157376_11137994 3300014969 Bacteria 807
51 Ga0182006_1037051 3300015261 Bacteria 1936
52 Ga0182007_10001129 3300015262 Bacteria 14468
53 Ga0182005_1074634 3300015265 Bacteria 933
54 Ga0183367_1002 3300015688 Bacteria 1101531
55 Ga0213875_10003336 3300021388 Bacteria 9163
56 Ga0207426_1001554 3300025302 Bacteria 18646
57 Ga0207426_1002336 3300025302 Bacteria 12383
58 Ga0207426_1027307 3300025302 Bacteria 1902
59 Ga0207426_1033574 3300025302 Bacteria 1653
60 Ga0209051_1106818 3300025303 Bacteria 739
61 Ga0207713_1064791 3300025735 Bacteria 1374
62 Ga0207647_10007368 3300025904 Bacteria 7953
63 Ga0207694_10193779 3300025924 Bacteria 1652
64 Ga0207687_10366757 3300025927 Bacteria 1177
65 Ga0207686_11158651 3300025934 Bacteria 632
66 Ga0207709_10023263 3300025935 Bacteria 3525
67 Ga0207691_10235481 3300025940 Bacteria 1584
68 Ga0207691_10439237 3300025940 Bacteria 1111
69 Ga0207661_10138649 3300025944 Bacteria 2091
70 Ga0207712_10947704 3300025961 Bacteria 762
71 Ga0207640_10395393 3300025981 Bacteria 1124
72 Ga0207703_11564188 3300026035 Bacteria 634
73 Ga0207639_12114117 3300026041 Bacteria 524
74 Ga0207702_10686557 3300026078 Bacteria 1008
75 Ga0207674_10613722 3300026116 Bacteria 1050
76 Ga0209371_1021550 3300027312 Bacteria 1559
77 Ga0209371_1087523 3300027312 Bacteria 529
78 Ga0209813_10027210 3300027866 Bacteria 1659
79 Ga0268266_11715056 3300028379 Bacteria 603
80 Ga0307515_10000813 3300028794 Bacteria 71821
81 Ga0307515_10109395 3300028794 Bacteria 3246
82 Ga0268256_1024205 3300030500 Bacteria 1562
83 Ga0268256_1046663 3300030500 Bacteria 937
84 Ga0307511_10051211 3300030521 Bacteria 3314
85 Ga0307511_10118501 3300030521 Bacteria 1649
86 Ga0307512_10051020 3300030522 Bacteria 3315
87 Ga0307512_10070649 3300030522 Bacteria 2598
88 Ga0307512_10091748 3300030522 Bacteria 2111
89 Ga0307513_10017828 3300031456 Bacteria 8505
90 Ga0307513_10028725 3300031456 Bacteria 6353
91 Ga0307509_10016921 3300031507 Bacteria 8410
92 Ga0307509_10116000 3300031507 Bacteria 2668
93 Ga0307408_100962615 3300031548 Bacteria 785
94 Ga0307508_10005950 3300031616 Bacteria 11506
95 Ga0307508_10034247 3300031616 Bacteria 4579
96 Ga0307508_10132356 3300031616 Bacteria 2097
97 Ga0307514_10053823 3300031649 Bacteria 3103
98 Ga0307514_10060014 3300031649 Bacteria 2903
99 Ga0307514_10115022 3300031649 Bacteria 1895
100 Ga0307516_10001694 3300031730 Bacteria 30318
101 Ga0307516_10049439 3300031730 Bacteria 4132
102 Ga0307516_10093686 3300031730 Bacteria 2829
103 Ga0307516_10634288 3300031730 Bacteria 723
104 Ga0307413_10197771 3300031824 Bacteria 1449
105 Ga0307518_10100969 3300031838 Bacteria 2065
106 Ga0307410_10242895 3300031852 Bacteria 1396
107 Ga0307416_101014213 3300032002 Bacteria 933
108 Ga0307416_102314849 3300032002 Bacteria 637
109 Ga0307415_100937274 3300032126 Bacteria 801
110 Ga0307507_10011491 3300033179 Bacteria 11153
111 Ga0307507_10141433 3300033179 Bacteria 1844
112 Ga0307507_10274813 3300033179 Bacteria 1060
113 Ga0307510_10027859 3300033180 Bacteria 6463
114 Ga0307510_10203628 3300033180 Bacteria 1510
115 Ga0307510_10255793 3300033180 Bacteria 1235
116 Ga0395900_0251801 3300037418 Bacteria 1767
117 Ga0395898_0014941 3300037466 Bacteria 7972
118 Ga0395898_0552728 3300037466 Bacteria 1093
119 Ga0395898_1485671 3300037466 Bacteria 604
120 Ga0395905_0113761 3300037471 Bacteria 2543
121 Ga0436364_0894301 3300037853 Bacteria 12265
122 Ga0395901_0004321 3300038443 Bacteria 14345
123 Ga0439436_0000864 3300041404 Bacteria 8271
124 Ga0439436_0019699 3300041404 Bacteria 2012
125 Ga0439439_0001188 3300041406 Bacteria 5026
126 Ga0439439_0017456 3300041406 Bacteria 1764
127 Ga0439439_0079580 3300041406 Bacteria 885
128 Ga0451795_1596757 3300041456 Bacteria 1125
129 Ga0451807_1292668 3300041486 Bacteria 750
130 Ga0451833_1452990 3300041491 Bacteria 669
131 Ga0451835_0932778 3300041492 Bacteria 1081
132 Ga0451837_0652012 3300041494 Bacteria 5344
133 Ga0451839_0729921 3300041496 Bacteria 549
134 Ga0451853_0696848 3300041512 Bacteria 3054
135 Ga0451853_3795338 3300041512 Bacteria 3707
136 Ga0439448_0002802 3300042005 Bacteria 4774
137 Ga0439448_0022472 3300042005 Bacteria 1961
138 Ga0439449_0009106 3300042007 Bacteria 3765
139 Ga0439449_0027188 3300042007 Bacteria 2135
140 Ga0439449_0245857 3300042007 Bacteria 672
141 Ga0439450_021872 3300042008 Bacteria 1377
142 Ga0439455_0007163 3300042012 Bacteria 2350
143 Ga0439455_0127537 3300042012 Bacteria 716
144 Ga0439457_000919 3300042014 Bacteria 8873
145 Ga0439457_034554 3300042014 Bacteria 1123
146 Ga0439462_0006442 3300042015 Bacteria 2917
147 Ga0450890_006905 3300042127 Bacteria 1447
148 Ga0450894_000089 3300042131 Bacteria 15201
149 Ga0450898_000428 3300042134 Bacteria 4890
150 Ga0450898_036956 3300042134 Bacteria 914
151 Ga0450899_000458 3300042135 Bacteria 4578
152 Ga0450902_073162 3300042137 Bacteria 599
153 Ga0450903_000025 3300042138 Bacteria 29994
154 Ga0450906_000226 3300042145 Bacteria 10823
155 Ga0439458_0000750 3300042157 Bacteria 8302
156 Ga0466969_0157280 3300044656 Bacteria 1045
157 Ga0466972_0002962 3300044658 Bacteria 8405
158 Ga0466972_0004174 3300044658 Bacteria 7214
159 Ga0466972_0007163 3300044658 Bacteria 5600
160 Ga0466972_0122071 3300044658 Bacteria 1228
161 Ga0466965_0077772 3300044683 Bacteria 1675
162 Ga0466965_0905607 3300044683 Bacteria 515
163 Ga0466966_0006232 3300044684 Bacteria 7887
164 Ga0466966_0020981 3300044684 Bacteria 4293
165 Ga0466966_0616634 3300044684 Bacteria 653
166 Ga0466961_0003621 3300044693 Bacteria 9622
167 Ga0466961_0020002 3300044693 Bacteria 4307
168 Ga0466961_0045500 3300044693 Bacteria 2808
169 Ga0466961_0243983 3300044693 Bacteria 1104
170 Ga0466961_0638181 3300044693 Bacteria 639
171 Ga0466963_0012012 3300044694 Bacteria 5289
172 Ga0466963_0634558 3300044694 Bacteria 754
173 Ga0466964_0004533 3300044706 Bacteria 5130
174 Ga0466964_0066014 3300044706 Bacteria 1518
175 Ga0466971_0023423 3300044719 Bacteria 2752
176 Ga0466971_0077987 3300044719 Bacteria 1509
177 Ga0466968_0027810 3300044735 Bacteria 2328
178 Ga0466968_0039702 3300044735 Bacteria 1982
179 Ga0466970_0001226 3300044765 Bacteria 12417
180 Ga0466970_0004495 3300044765 Bacteria 6875
181 Ga0466970_0093768 3300044765 Bacteria 1631
182 Ga0466970_0383813 3300044765 Bacteria 800
183 Ga0466957_0002870 3300044842 Bacteria 9335
184 Ga0466957_0221321 3300044842 Bacteria 1250
185 Ga0466960_0021297 3300044901 Bacteria 2884
186 Ga0466959_0003319 3300045049 Bacteria 10505
187 Ga0466959_0892016 3300045049 Bacteria 593
188 Ga0466958_0004341 3300045836 Bacteria 7471
189 Ga0466958_0257236 3300045836 Bacteria 1117
190 Ga0466967_0001968 3300045976 Bacteria 12446
191 Ga0466967_0090406 3300045976 Bacteria 2781
192 Ga0466967_0142885 3300045976 Bacteria 2230
193 Ga0466967_0267553 3300045976 Bacteria 1637
194 Ga0466967_0444308 3300045976 Bacteria 1267
195 Ga0466967_0693257 3300045976 Bacteria 1008
196 Ga0495617_067526 3300046452 Bacteria 1177
197 Ga0495617_153465 3300046452 Bacteria 732
198 Ga0495627_044652 3300046453 Bacteria 1352
199 Ga0495592_0002770 3300046454 Bacteria 12421
200 Ga0495592_0033022 3300046454 Bacteria 3905
201 Ga0495592_0080563 3300046454 Bacteria 2355
202 Ga0495603_0001170 3300046455 Bacteria 15283
203 Ga0495603_0001759 3300046455 Bacteria 12757
204 Ga0495603_0012358 3300046455 Bacteria 5170
205 Ga0495603_0022648 3300046455 Bacteria 3801
206 Ga0495603_0042651 3300046455 Bacteria 2711
207 Ga0495603_0043852 3300046455 Bacteria 2669
208 Ga0495603_0418772 3300046455 Bacteria 767
209 Ga0495590_0217666 3300046457 Bacteria 705
210 Ga0495629_0001224 3300046459 Bacteria 20148
211 Ga0495629_0008001 3300046459 Bacteria 7779
212 Ga0495629_0011473 3300046459 Bacteria 6436
213 Ga0495629_0012969 3300046459 Bacteria 6027
214 Ga0495629_0016650 3300046459 Bacteria 5276
215 Ga0495629_0023384 3300046459 Bacteria 4404
216 Ga0495629_0044605 3300046459 Bacteria 3111
217 Ga0495629_0426537 3300046459 Bacteria 899
218 Ga0495629_0543301 3300046459 Bacteria 780
219 Ga0495629_0789378 3300046459 Bacteria 627
220 Ga0495638_0082604 3300046460 Bacteria 1948
221 Ga0495638_0149916 3300046460 Bacteria 1353
222 Ga0495638_0152079 3300046460 Bacteria 1342
223 Ga0495638_0196277 3300046460 Bacteria 1142
224 Ga0495638_0271331 3300046460 Bacteria 926
225 Ga0495651_0001653 3300046462 Bacteria 17272
226 Ga0495651_0005532 3300046462 Bacteria 9635
227 Ga0495651_0051354 3300046462 Bacteria 3179
228 Ga0495653_0146595 3300046463 Bacteria 1653
229 Ga0495580_0139522 3300046472 Bacteria 1680
230 Ga0495582_0017157 3300046473 Bacteria 3962
231 Ga0495582_0122037 3300046473 Bacteria 1469
232 Ga0495582_0311540 3300046473 Bacteria 905
233 Ga0495605_0031015 3300046474 Bacteria 2733
234 Ga0495639_0064589 3300046475 Bacteria 1682
235 Ga0495639_0247075 3300046475 Bacteria 882
236 Ga0495662_0003171 3300046476 Bacteria 8304
237 Ga0495662_0019058 3300046476 Bacteria 3320
238 Ga0495662_0143790 3300046476 Bacteria 1174
239 Ga0495662_0233158 3300046476 Bacteria 907
240 Ga0495662_0567010 3300046476 Bacteria 556
241 Ga0495664_0000282 3300046477 Bacteria 24266
242 Ga0495664_0053517 3300046477 Bacteria 2400
243 Ga0495664_0075260 3300046477 Bacteria 2020
244 Ga0495584_0181036 3300046491 Bacteria 1071
245 Ga0495585_0035662 3300046492 Bacteria 2809
246 Ga0495585_0054957 3300046492 Bacteria 2201
247 Ga0495585_0111160 3300046492 Bacteria 1457
248 Ga0495585_0210924 3300046492 Bacteria 984
249 Ga0495585_0474836 3300046492 Bacteria 596
250 Ga0495585_0480161 3300046492 Bacteria 592
251 Ga0495594_0011637 3300046499 Bacteria 4575
252 Ga0495594_0032639 3300046499 Bacteria 2827
253 Ga0495594_0117308 3300046499 Bacteria 1503
254 Ga0495594_0219797 3300046499 Bacteria 1083
255 Ga0495594_0371088 3300046499 Bacteria 814
256 Ga0495594_0388072 3300046499 Bacteria 794
257 Ga0495596_0024281 3300046500 Bacteria 2456
258 Ga0495607_0012696 3300046501 Bacteria 5547
259 Ga0495607_0102530 3300046501 Bacteria 1530
260 Ga0495606_0064381 3300046507 Bacteria 2333
261 Ga0495610_0054597 3300046512 Bacteria 1929
262 Ga0495610_0259406 3300046512 Bacteria 685
263 Ga0495616_0006140 3300046513 Bacteria 7315
264 Ga0495618_0025172 3300046514 Bacteria 3692
265 Ga0495618_0031655 3300046514 Bacteria 3310
266 Ga0495618_0127295 3300046514 Bacteria 1630
267 Ga0495620_0085339 3300046515 Bacteria 1272
268 Ga0495620_0161817 3300046515 Bacteria 869
269 Ga0495628_0022296 3300046516 Bacteria 5203
270 Ga0495628_0023269 3300046516 Bacteria 5087
271 Ga0495628_0167442 3300046516 Bacteria 1667
272 Ga0495630_0025860 3300046517 Bacteria 4343
273 Ga0495631_0018251 3300046518 Bacteria 3305
274 Ga0495631_0034970 3300046518 Bacteria 2250
275 Ga0495631_0234821 3300046518 Bacteria 782
276 Ga0495632_0195749 3300046519 Bacteria 922
277 Ga0495637_0120558 3300046520 Bacteria 1009
278 Ga0495643_0001554 3300046522 Bacteria 20479
279 Ga0495643_0015860 3300046522 Bacteria 4438
280 Ga0495643_0217214 3300046522 Bacteria 909
281 Ga0495644_0032456 3300046523 Bacteria 1973
282 Ga0495644_0232160 3300046523 Bacteria 714
283 Ga0495648_0078644 3300046524 Bacteria 1885
284 Ga0495666_0048633 3300046526 Bacteria 2042
285 Ga0495666_0412287 3300046526 Bacteria 606
286 Ga0495642_0129576 3300046528 Bacteria 1085
287 Ga0495652_0028026 3300046529 Bacteria 4960
288 Ga0495652_0158430 3300046529 Bacteria 1760
289 Ga0495654_0042557 3300046530 Bacteria 2254
290 Ga0495640_0013523 3300046533 Bacteria 6204
291 Ga0495640_0030666 3300046533 Bacteria 3847
292 Ga0495640_0030868 3300046533 Bacteria 3832
293 Ga0495640_0150123 3300046533 Bacteria 1498
294 Ga0495586_0027579 3300046535 Bacteria 3038
295 Ga0495587_0029688 3300046536 Bacteria 3318
296 Ga0495587_0093009 3300046536 Bacteria 1741
297 Ga0495609_0032050 3300046538 Bacteria 2388
298 Ga0495597_0202467 3300046542 Bacteria 794
299 Ga0495645_0007346 3300046543 Bacteria 7666
300 Ga0495645_0412377 3300046543 Bacteria 859
301 Ga0495622_0012385 3300046557 Bacteria 3948
302 Ga0495622_0130595 3300046557 Bacteria 1144
303 Ga0495633_0018654 3300046558 Bacteria 3520
304 Ga0495633_0330178 3300046558 Bacteria 692
305 Ga0495667_0074258 3300046559 Bacteria 2214
306 Ga0495656_0042215 3300046615 Bacteria 1909
307 Ga0495668_0070198 3300046616 Bacteria 1925
308 Ga0495634_0004963 3300046642 Bacteria 10282
309 Ga0495634_0006932 3300046642 Bacteria 8559
310 Ga0495634_0394030 3300046642 Bacteria 823
311 Ga0495611_0031653 3300046648 Bacteria 2329
312 Ga0495611_0036080 3300046648 Bacteria 2192
313 Ga0495611_0049366 3300046648 Bacteria 1893
314 Ga0495611_0269004 3300046648 Bacteria 788
315 Ga0495611_0279660 3300046648 Bacteria 771
316 Ga0495625_0016470 3300046660 Bacteria 5817
317 Ga0495625_0020466 3300046660 Bacteria 5108
318 Ga0495625_0121946 3300046660 Bacteria 1773
319 Ga0495625_0220917 3300046660 Bacteria 1242
320 Ga0495635_0000593 3300046663 Bacteria 23305
321 Ga0495635_0062632 3300046663 Bacteria 2554
322 Ga0495659_0071711 3300046664 Bacteria 1299
323 Ga0495661_0133290 3300046665 Bacteria 1359
324 Ga0495588_0006697 3300046674 Bacteria 5204
325 Ga0495588_0009714 3300046674 Bacteria 4458
326 Ga0495588_0029177 3300046674 Bacteria 2766
327 Ga0495588_0115849 3300046674 Bacteria 1412
328 Ga0495588_0218376 3300046674 Bacteria 1006
329 Ga0495588_0710693 3300046674 Bacteria 525
330 Ga0495657_0002382 3300046675 Bacteria 15814
331 Ga0495657_0004529 3300046675 Bacteria 11116
332 Ga0495657_0019119 3300046675 Bacteria 4946
333 Ga0495657_0134556 3300046675 Bacteria 1545
334 Ga0495599_0075685 3300046678 Bacteria 2102
335 Ga0495623_0049744 3300046679 Bacteria 2656
336 Ga0495646_0002399 3300046680 Bacteria 11495
337 Ga0495646_0053865 3300046680 Bacteria 2423
338 Ga0495647_0157000 3300046681 Bacteria 978
339 Ga0495658_0020193 3300046683 Bacteria 3492
340 Ga0495658_0064135 3300046683 Bacteria 2116
341 Ga0495613_0007902 3300046689 Bacteria 7912
342 Ga0495613_0014939 3300046689 Bacteria 5762
343 Ga0495613_0026062 3300046689 Bacteria 4356
344 Ga0495613_0218330 3300046689 Bacteria 1339
345 Ga0495613_0333107 3300046689 Bacteria 1046
346 Ga0495613_0457863 3300046689 Bacteria 863
347 Ga0495613_0470347 3300046689 Bacteria 849
348 Ga0495624_0021164 3300046690 Bacteria 4317
349 Ga0495624_0063478 3300046690 Bacteria 2309
350 Ga0495624_0324856 3300046690 Bacteria 926
351 Ga0495624_0391535 3300046690 Bacteria 834
352 Ga0495670_0021308 3300046691 Bacteria 3196
353 Ga0495670_0021532 3300046691 Bacteria 3180
354 Ga0495670_0132012 3300046691 Bacteria 1302
355 Ga0495670_0338762 3300046691 Bacteria 809
356 Ga0495671_0007806 3300046692 Bacteria 6057
357 Ga0495671_0076828 3300046692 Bacteria 1637
358 Ga0495649_0085127 3300046694 Bacteria 1688
359 Ga0495649_0138439 3300046694 Bacteria 1282
360 Ga0495649_0282398 3300046694 Bacteria 848
361 Ga0495589_0018231 3300046794 Bacteria 3601
362 Ga0495589_0024586 3300046794 Bacteria 3061
363 Ga0495589_0059042 3300046794 Bacteria 1886
364 Ga0495589_0078783 3300046794 Bacteria 1604
365 Ga0495589_0096008 3300046794 Bacteria 1437
366 Ga0495589_0098553 3300046794 Bacteria 1415
367 Ga0495589_0103568 3300046794 Bacteria 1376
368 Ga0495589_0129480 3300046794 Bacteria 1212
369 Ga0495589_0147737 3300046794 Bacteria 1123
370 Ga0495600_0004771 3300046809 Bacteria 8135
371 Ga0495600_0006332 3300046809 Bacteria 7196
372 Ga0495600_0099347 3300046809 Bacteria 1897
373 Ga0495600_0549801 3300046809 Bacteria 705
374 Ga0495660_0048366 3300046810 Bacteria 2325
375 Ga0495660_0050486 3300046810 Bacteria 2266
376 Ga0495581_0004318 3300047315 Bacteria 8203
377 Ga0495581_0028125 3300047315 Bacteria 3259
378 Ga0495581_0063633 3300047315 Bacteria 2131
379 Ga0495581_0163597 3300047315 Bacteria 1301
380 Ga0495581_0750475 3300047315 Bacteria 561
381 Ga0495604_0006494 3300047317 Bacteria 9269
382 Ga0495604_0058030 3300047317 Bacteria 2973
383 Ga0495604_0100593 3300047317 Bacteria 2125
384 Ga0495604_0601304 3300047317 Bacteria 705
385 Ga0495636_0006423 3300047318 Bacteria 4619
386 Ga0495636_0025732 3300047318 Bacteria 2390
387 Ga0495636_0036470 3300047318 Bacteria 2028
388 Ga0495636_0259354 3300047318 Bacteria 805
389 Ga0495636_0266988 3300047318 Bacteria 794
390 Ga0495636_0503794 3300047318 Bacteria 585
391 Ga0495636_0506286 3300047318 Bacteria 584
392 Ga0495674_0122442 3300047319 Bacteria 2196
393 Ga0495674_0640258 3300047319 Bacteria 839
394 Ga0495672_0096584 3300047320 Bacteria 1611
395 Ga0495676_0002667 3300047321 Bacteria 15977
396 Ga0495676_0008638 3300047321 Bacteria 9326
397 Ga0495676_0009294 3300047321 Bacteria 8958
398 Ga0495676_0011467 3300047321 Bacteria 8001
399 Ga0495676_0016059 3300047321 Bacteria 6651
400 Ga0495676_0138022 3300047321 Bacteria 1750
401 Ga0495676_0140335 3300047321 Bacteria 1732
402 Ga0495676_0277945 3300047321 Bacteria 1134
403 Ga0495676_0696327 3300047321 Bacteria 657
404 Ga0495680_0001987 3300047322 Bacteria 21488
405 Ga0495680_0347016 3300047322 Bacteria 1034
406 Ga0495683_0110162 3300047323 Bacteria 1315
407 Ga0495683_0148392 3300047323 Bacteria 1093
408 Ga0495683_0251168 3300047323 Bacteria 776
409 Ga0495683_0448051 3300047323 Bacteria 530
410 Ga0495687_001345 3300047443 Bacteria 22903
411 Ga0495687_008623 3300047443 Bacteria 5812
412 Ga0495687_011944 3300047443 Bacteria 4632
413 Ga0495687_015224 3300047443 Bacteria 3922
414 Ga0495687_113292 3300047443 Bacteria 992
415 Ga0495687_130700 3300047443 Bacteria 889
416 Ga0495675_0002357 3300047444 Bacteria 11273
417 Ga0495675_0083454 3300047444 Bacteria 2011
418 Ga0495675_0086655 3300047444 Bacteria 1968
419 Ga0495677_0021381 3300047445 Bacteria 2345
420 Ga0495685_001961 3300047447 Bacteria 6385
421 Ga0495685_013872 3300047447 Bacteria 2734
422 Ga0495685_014059 3300047447 Bacteria 2716
423 Ga0495685_057575 3300047447 Bacteria 1312
424 Ga0495685_086187 3300047447 Bacteria 1043
425 Ga0495681_0001930 3300047470 Bacteria 15188
426 Ga0495681_0033825 3300047470 Bacteria 2554
427 Ga0495681_0134121 3300047470 Bacteria 1051
428 Ga0495684_0120483 3300047471 Bacteria 1976
429 Ga0495684_0246598 3300047471 Bacteria 1301
430 Ga0495686_0010378 3300047472 Bacteria 6630
431 Ga0495686_0081037 3300047472 Bacteria 1983
432 Ga0495686_0317022 3300047472 Bacteria 856
433 Ga0495593_0001804 3300047673 Bacteria 12722
434 Ga0495593_0172072 3300047673 Bacteria 1091
435 Ga0495593_0285079 3300047673 Bacteria 826
436 Ga0495593_0646397 3300047673 Bacteria 531
437 Ga0495602_0062348 3300048088 Bacteria 3235
438 Ga0495602_0169775 3300048088 Bacteria 1694
439 Ga0495614_0004349 3300048089 Bacteria 6384
440 Ga0495614_0005858 3300048089 Bacteria 5536
441 Ga0495614_0011311 3300048089 Bacteria 3927
442 Ga0495626_0044420 3300048091 Bacteria 2079
443 Ga0496104_1012177 3300048907 Bacteria 735
444 Ga0496106_0109332 3300048909 Bacteria 2151
445 Ga0496108_0331456 3300048911 Bacteria 1327
446 Ga0496109_0099066 3300048912 Bacteria 2703
447 Ga0496110_0450462 3300048913 Bacteria 1173
448 Ga0495678_075067 3300049459 Bacteria 1228
449 Ga0495682_0012475 3300049460 Bacteria 3258
450 Ga0501031_0007853 3300049568 Bacteria 6944
451 Ga0501031_0095748 3300049568 Bacteria 1937
452 Ga0501031_0150708 3300049568 Bacteria 1519
453 Ga0501031_0169824 3300049568 Bacteria 1425
454 Ga0501032_0012081 3300049569 Bacteria 6183
455 Ga0501032_0021673 3300049569 Bacteria 4465
456 Ga0501032_0088534 3300049569 Bacteria 2055
457 Ga0501032_0089925 3300049569 Bacteria 2038
458 Ga0501032_0109615 3300049569 Bacteria 1827
459 Ga0501032_0140874 3300049569 Bacteria 1588
460 Ga0501033_0001721 3300049570 Bacteria 19146
461 Ga0501033_0005963 3300049570 Bacteria 9565
462 Ga0501033_0011432 3300049570 Bacteria 6794
463 Ga0501033_0033426 3300049570 Bacteria 3860
464 Ga0501033_0101712 3300049570 Bacteria 2096
465 Ga0501033_0174662 3300049570 Bacteria 1542
466 Ga0501033_0362309 3300049570 Bacteria 1014
467 Ga0501034_0006924 3300049571 Bacteria 12115
468 Ga0501034_0013110 3300049571 Bacteria 8541
469 Ga0501034_0015840 3300049571 Bacteria 7742
470 Ga0501034_0021973 3300049571 Bacteria 6501
471 Ga0501034_0031442 3300049571 Bacteria 5390
472 Ga0501034_0049592 3300049571 Bacteria 4236
473 Ga0501034_0226451 3300049571 Bacteria 1820
474 Ga0501036_0006789 3300049572 Bacteria 9298
475 Ga0501036_0011358 3300049572 Bacteria 7371
476 Ga0501036_0033288 3300049572 Bacteria 4358
477 Ga0501036_0044024 3300049572 Bacteria 3780
478 Ga0501036_0046619 3300049572 Bacteria 3670
479 Ga0501036_0074787 3300049572 Bacteria 2865
480 Ga0501036_1162365 3300049572 Bacteria 629
481 Ga0501037_0000724 3300049573 Bacteria 24999
482 Ga0501037_0020484 3300049573 Bacteria 4883
483 Ga0501037_0227667 3300049573 Bacteria 1310
484 Ga0501037_0514403 3300049573 Bacteria 811
485 Ga0501037_0597556 3300049573 Bacteria 741
486 Ga0501038_0006792 3300049574 Bacteria 10567
487 Ga0501038_0015400 3300049574 Bacteria 6951
488 Ga0501038_0030710 3300049574 Bacteria 4750
489 Ga0501038_0046312 3300049574 Bacteria 3771
490 Ga0501038_0225815 3300049574 Bacteria 1492
491 Ga0501038_0286131 3300049574 Bacteria 1296
492 Ga0501039_0021239 3300049575 Bacteria 4981
493 Ga0501039_0146048 3300049575 Bacteria 1858
494 Ga0501039_0177907 3300049575 Bacteria 1673
495 Ga0501039_0225093 3300049575 Bacteria 1474
496 Ga0501039_0695219 3300049575 Bacteria 795
497 Ga0501039_1043660 3300049575 Bacteria 634
498 Ga0501040_0032902 3300049576 Bacteria 3509
499 Ga0501040_0853587 3300049576 Bacteria 659
500 Ga0501041_0003165 3300049577 Bacteria 9469
501 Ga0501042_0051139 3300049578 Bacteria 2947
502 Ga0501042_0305410 3300049578 Bacteria 1149
503 Ga0501042_0792986 3300049578 Bacteria 689
504 Ga0501043_0003026 3300049579 Bacteria 13974
505 Ga0501043_0006148 3300049579 Bacteria 9644
506 Ga0501043_0013131 3300049579 Bacteria 6477
507 Ga0501043_0020604 3300049579 Bacteria 5173
508 Ga0501043_0058756 3300049579 Bacteria 3018
509 Ga0501046_0009533 3300049580 Bacteria 8386
510 Ga0501046_0512276 3300049580 Bacteria 858
511 Ga0501046_0643090 3300049580 Bacteria 750
512 Ga0501046_0644479 3300049580 Bacteria 749
513 Ga0501046_0668710 3300049580 Bacteria 733
514 Ga0501046_1129656 3300049580 Bacteria 540
515 Ga0501047_0000029 3300049581 Bacteria 218396
516 Ga0501047_0007463 3300049581 Bacteria 10292
517 Ga0501047_0009513 3300049581 Bacteria 9184
518 Ga0501047_0018385 3300049581 Bacteria 6700
519 Ga0501047_0050309 3300049581 Bacteria 4024
520 Ga0501047_0156412 3300049581 Bacteria 2153
521 Ga0501047_0585273 3300049581 Bacteria 938
522 Ga0501047_0694023 3300049581 Bacteria 835
523 Ga0501048_0010502 3300049582 Bacteria 6910
524 Ga0501048_0656522 3300049582 Bacteria 753
525 Ga0501067_0000704 3300049583 Bacteria 18014
526 Ga0501068_0002685 3300049584 Bacteria 9423
527 Ga0501068_0262251 3300049584 Bacteria 1102
528 Ga0501068_0342525 3300049584 Bacteria 960
529 Ga0501068_0643194 3300049584 Bacteria 692
530 Ga0501069_0008565 3300049585 Bacteria 5378
531 Ga0501069_0040285 3300049585 Bacteria 2582
532 Ga0501070_0003332 3300049586 Bacteria 13957
533 Ga0501070_0012618 3300049586 Bacteria 7127
534 Ga0501070_0116679 3300049586 Bacteria 2205
535 Ga0501070_0362508 3300049586 Bacteria 1175
536 Ga0501070_0407960 3300049586 Bacteria 1098
537 Ga0501070_0457685 3300049586 Bacteria 1028
538 Ga0501071_0000263 3300049587 Bacteria 24706
539 Ga0501073_0456586 3300049589 Bacteria 883
540 Ga0501074_0000685 3300049590 Bacteria 21150
541 Ga0501074_0004802 3300049590 Bacteria 9690
542 Ga0501074_0386835 3300049590 Bacteria 992
543 Ga0501077_0042588 3300049593 Bacteria 2886
544 Ga0501221_069027 3300049704 Bacteria 831
545 Ga0501079_0026744 3300049741 Bacteria 4423
546 Ga0501080_0097712 3300049742 Bacteria 2726
547 Ga0501080_0941380 3300049742 Bacteria 751
548 Ga0501083_0000333 3300049744 Bacteria 29934
549 Ga0501282_002466 3300049778 Bacteria 2008
550 Ga0501035_0001374 3300049822 Bacteria 25051
551 Ga0501035_0005791 3300049822 Bacteria 11648
552 Ga0501035_0012244 3300049822 Bacteria 7929
553 Ga0501035_0017071 3300049822 Bacteria 6687
554 Ga0501035_0058803 3300049822 Bacteria 3424
555 Ga0501035_0083761 3300049822 Bacteria 2813
556 Ga0501035_0090571 3300049822 Bacteria 2692
557 Ga0501035_0112308 3300049822 Bacteria 2387
558 Ga0501035_0268222 3300049822 Bacteria 1445
559 Ga0501035_0863649 3300049822 Bacteria 719
560 Ga0501044_0004873 3300049823 Bacteria 14996
561 Ga0501044_0006533 3300049823 Bacteria 12877
562 Ga0501044_0047776 3300049823 Bacteria 4425
563 Ga0501044_0073556 3300049823 Bacteria 3473
564 Ga0501044_0116755 3300049823 Bacteria 2673
565 Ga0501044_0139161 3300049823 Bacteria 2416
566 Ga0501044_0204679 3300049823 Bacteria 1930
567 Ga0501044_0276661 3300049823 Bacteria 1613
568 Ga0501044_0277548 3300049823 Bacteria 1610
569 Ga0501044_0280813 3300049823 Bacteria 1599
570 Ga0501044_0350709 3300049823 Bacteria 1395
571 Ga0501044_0447635 3300049823 Bacteria 1198
572 Ga0501044_0783279 3300049823 Bacteria 834
573 Ga0501045_0006168 3300049824 Bacteria 8303
574 Ga0501045_0138757 3300049824 Bacteria 1808
575 nmdc:mga03n38_23835_c1 3300050490 Bacteria 2495
576 nmdc:mga0yw44_115921_c1 3300050492 Bacteria 1721
577 nmdc:mga06z11_584_c1 3300050494 Bacteria 13334
578 nmdc:mga04h51_93480_c1 3300050495 Bacteria 1086
579 nmdc:mga07m45_178137_c1 3300050496 Bacteria 856
580 Ga0500610_0187929 3300053079 Bacteria 1006
581 Ga0500635_0348485 3300053080 Bacteria 586
582 Ga0495655_0156777 3300053083 Bacteria 720
583 Ga0495655_0224217 3300053083 Bacteria 623
584 Ga0495619_0071215 3300053085 Bacteria 2326
585 Ga0500578_0299219 3300053086 Bacteria 954
586 Ga0500643_125306 3300053087 Bacteria 692
587 Ga0500646_0199286 3300053090 Bacteria 686
588 Ga0500583_0210604 3300053092 Bacteria 965
589 Ga0500651_0535329 3300053093 Bacteria 642
590 Ga0500566_0061259 3300053094 Bacteria 2130
591 Ga0500640_070233 3300053095 Bacteria 1503
592 Ga0500641_0333958 3300053096 Bacteria 613
593 Ga0500654_173957 3300053099 Bacteria 701
594 Ga0500553_164193 3300053101 Bacteria 829
595 Ga0500558_092409 3300053106 Bacteria 1215
596 Ga0500560_000786 3300053107 Bacteria 4845
597 Ga0500560_004275 3300053107 Bacteria 3017
598 Ga0500569_061382 3300053109 Bacteria 1161
599 Ga0500580_083645 3300053113 Bacteria 1289
600 Ga0500608_104312 3300053122 Bacteria 1309
601 Ga0500614_006154 3300053123 Bacteria 2522
602 Ga0500614_050662 3300053123 Bacteria 1089
603 Ga0500621_053948 3300053126 Bacteria 1626
604 Ga0500628_209553 3300053129 Bacteria 564
605 Ga0500652_009097 3300053131 Bacteria 3344
606 Ga0500658_0038122 3300053134 Bacteria 1914
607 Ga0500561_0021155 3300053137 Bacteria 1530
608 Ga0500573_0017578 3300053140 Bacteria 4072
609 Ga0500573_0020764 3300053140 Bacteria 3761
610 Ga0500577_0259988 3300053142 Bacteria 755
611 Ga0500600_0105107 3300053149 Bacteria 1482
612 Ga0500600_0234861 3300053149 Bacteria 834
613 Ga0500600_0250607 3300053149 Bacteria 793
614 Ga0500616_0043885 3300053153 Bacteria 2387
615 Ga0500624_001455 3300053157 Bacteria 3803
616 Ga0500633_0164464 3300053160 Bacteria 832
617 Ga0500634_0232953 3300053161 Bacteria 780
618 Ga0500587_006253 3300053739 Bacteria 1583
619 Ga0501084_0005179 3300054114 Bacteria 10664
620 Ga0501084_0665255 3300054114 Bacteria 879
621 Ga0501082_0004945 3300060353 Bacteria 11629
622 Ga0466962_0001135 3300061719 Bacteria 12296
623 Ga0466962_0072567 3300061719 Bacteria 1645
624 Ga0466962_0187136 3300061719 Bacteria 1010
625 Ga0530510_0054191 3300061734 Bacteria 2898

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003354 JGI25160J50197_1011075 JGI25160J50197_10110754 91
2 3300003354 JGI25160J50197_1011015 JGI25160J50197_10110152 92
3 3300025302 Ga0207426_1001554 Ga0207426_10015548 92
4 3300025302 Ga0207426_1002336 Ga0207426_100233611 92
5 iso_pu_bacteria 2775506925 2776373557 94
6 3300046460 Ga0495638_0271331 Ga0495638_0271331_10_309 99
7 iso_pu_bacteria 2643221673 2644403802 104
8 iso_pu_bacteria 2946045630 2946047828 104
9 iso_pu_bacteria 8025478263 8025480458 105
10 iso_pu_bacteria 2582581312 2585296641 106
11 iso_pu_bacteria 2616644941 2616903273 106
12 iso_pu_bacteria 2643221548 2643764046 106
13 iso_pu_bacteria 2643221647 2644265778 106
14 iso_pu_bacteria 2643221682 2644461522 106
15 iso_pu_bacteria 2791355406 2793983599 106
16 iso_pu_bacteria 2818991463 2819694599 106
17 iso_pu_bacteria 2866552031 2866556194 106
18 iso_pu_bacteria 2867369537 2867373895 106
19 iso_pu_bacteria 2867475112 2867478873 106
20 iso_pu_bacteria 2873151551 2873154026 106
21 iso_pu_bacteria 2954380949 2954383978 106
22 iso_pu_bacteria 2966598605 2966600835 106
23 iso_pu_bacteria 8047893842 8047896078 106
24 iso_pu_bacteria 8048127548 8048132239 106
25 iso_pu_bacteria 8048356638 8048362857 106
26 iso_pu_bacteria 8048369669 8048373103 106
27 iso_pu_bacteria 8048379754 8048382036 106
28 iso_pu_bacteria 8054160619 8054166421 106
29 3300049823 Ga0501044_0447635 Ga0501044_0447635_10_411 108
30 3300053106 Ga0500558_092409 Ga0500558_092409_80_445 108
31 3300053107 Ga0500560_004275 Ga0500560_004275_214_579 108
32 3300053140 Ga0500573_0020764 Ga0500573_0020764_1838_2203 108
33 iso_pu_bacteria 2547132111 2547408365 108
34 iso_pu_bacteria 2582581313 2585309084 108
35 iso_pu_bacteria 2582581314 2585319271 108
36 iso_pu_bacteria 2616644814 2616697327 108
37 iso_pu_bacteria 2643221678 2644440080 108
38 iso_pu_bacteria 2643221714 2644632599 108
39 iso_pu_bacteria 2784132148 2784590439 108
40 iso_pu_bacteria 2784746763 2785341174 108
41 iso_pu_bacteria 2784746768 2785371531 108
42 iso_pu_bacteria 2786546132 2786672692 108
43 iso_pu_bacteria 2808606359 2808844057 108
44 iso_pu_bacteria 2808606375 2808913651 108
45 iso_pu_bacteria 2808606448 2809234112 108
46 iso_pu_bacteria 2811994879 2812355918 108
47 iso_pu_bacteria 2811994917 2812478726 108
48 iso_pu_bacteria 2818991472 2819740617 108
49 iso_pu_bacteria 2852635781 2852641047 108
50 iso_pu_bacteria 2862178590 2862186437 108
51 iso_pu_bacteria 2862281513 2862284711 108
52 iso_pu_bacteria 2862290372 2862293523 108
53 iso_pu_bacteria 2862382967 2862384807 108
54 iso_pu_bacteria 2862507626 2862512652 108
55 iso_pu_bacteria 2862574272 2862577482 108
56 iso_pu_bacteria 2863067949 2863068645 108
57 iso_pu_bacteria 2863404153 2863408645 108
58 iso_pu_bacteria 2867428634 2867437370 108
59 iso_pu_bacteria 2877676314 2877679074 108
60 iso_pu_bacteria 2912715099 2912717589 108
61 iso_pu_bacteria 2912723979 2912730132 108
62 iso_pu_bacteria 2919468124 2919471762 108
63 iso_pu_bacteria 2946064051 2946069869 108
64 iso_pu_bacteria 2946072368 2946077790 108
65 iso_pu_bacteria 2947224130 2947226919 108
66 iso_pu_bacteria 2954002825 2954005494 108
67 iso_pu_bacteria 2954673503 2954678985 108
68 iso_pu_bacteria 2954682443 2954685167 108
69 iso_pu_bacteria 2954691527 2954694779 108
70 iso_pu_bacteria 2954701450 2954709980 108
71 iso_pu_bacteria 2954711539 2954714287 108
72 iso_pu_bacteria 2954721474 2954724236 108
73 iso_pu_bacteria 2954731030 2954737604 108
74 iso_pu_bacteria 2954740390 2954743133 108
75 iso_pu_bacteria 2954749733 2954756437 108
76 iso_pu_bacteria 2954759201 2954762091 108
77 iso_pu_bacteria 2990059506 2990062972 108
78 iso_pu_bacteria 2997600082 2997606073 108
79 iso_pu_bacteria 3006393351 3006398626 108
80 iso_pu_bacteria 3006493962 3006500147 108
81 iso_pu_bacteria 8008558824 8008562818 108
82 iso_pu_bacteria 8008574985 8008577141 108
83 iso_pu_bacteria 8023623736 8023629631 108
84 iso_pu_bacteria 8033684223 8033690015 108
85 iso_pu_bacteria 8048406513 8048411684 108
86 iso_pu_bacteria 8056207758 8056215604 108
87 iso_pu_bacteria 8056447290 8056453778 108
88 iso_pu_bacteria 8056829672 8056832228 108
89 3300046459 Ga0495629_0789378 Ga0495629_0789378_212_553 109
90 3300031548 Ga0307408_100962615 Ga0307408_1009626152 110
91 3300031616 Ga0307508_10132356 Ga0307508_101323561 110
92 3300031730 Ga0307516_10634288 Ga0307516_106342882 110
93 3300031824 Ga0307413_10197771 Ga0307413_101977712 110
94 3300031852 Ga0307410_10242895 Ga0307410_102428952 110
95 3300032002 Ga0307416_101014213 Ga0307416_1010142132 110
96 3300032002 Ga0307416_102314849 Ga0307416_1023148492 110
97 3300032126 Ga0307415_100937274 Ga0307415_1009372742 110
98 3300033179 Ga0307507_10141433 Ga0307507_101414332 110
99 3300037466 Ga0395898_1485671 Ga0395898_1485671_14_346 110
100 3300044693 Ga0466961_0638181 Ga0466961_0638181_58_390 110
101 3300046455 Ga0495603_0001170 Ga0495603_0001170_2529_2861 110
102 3300046455 Ga0495603_0022648 Ga0495603_0022648_861_1193 110
103 3300046459 Ga0495629_0001224 Ga0495629_0001224_18471_18803 110
104 3300046459 Ga0495629_0011473 Ga0495629_0011473_5765_6097 110
105 3300046473 Ga0495582_0122037 Ga0495582_0122037_65_397 110
106 3300046492 Ga0495585_0111160 Ga0495585_0111160_451_795 110
107 3300046492 Ga0495585_0210924 Ga0495585_0210924_461_793 110
108 3300046499 Ga0495594_0011637 Ga0495594_0011637_2626_2958 110
109 3300046499 Ga0495594_0219797 Ga0495594_0219797_722_1066 110
110 3300046518 Ga0495631_0234821 Ga0495631_0234821_176_508 110
111 3300046522 Ga0495643_0015860 Ga0495643_0015860_2358_2702 110
112 3300046648 Ga0495611_0036080 Ga0495611_0036080_602_934 110
113 3300046674 Ga0495588_0029177 Ga0495588_0029177_1300_1632 110
114 3300046683 Ga0495658_0064135 Ga0495658_0064135_671_1018 110
115 3300046689 Ga0495613_0014939 Ga0495613_0014939_308_640 110
116 3300046691 Ga0495670_0021308 Ga0495670_0021308_134_478 110
117 3300046794 Ga0495589_0059042 Ga0495589_0059042_710_1042 110
118 3300046794 Ga0495589_0078783 Ga0495589_0078783_126_470 110
119 3300046810 Ga0495660_0050486 Ga0495660_0050486_275_619 110
120 3300047318 Ga0495636_0036470 Ga0495636_0036470_1559_1891 110
121 3300047321 Ga0495676_0009294 Ga0495676_0009294_3731_4063 110
122 3300047321 Ga0495676_0016059 Ga0495676_0016059_3339_3671 110
123 3300047323 Ga0495683_0448051 Ga0495683_0448051_166_510 110
124 3300047443 Ga0495687_015224 Ga0495687_015224_849_1193 110
125 3300047443 Ga0495687_130700 Ga0495687_130700_481_825 110
126 3300047447 Ga0495685_086187 Ga0495685_086187_461_805 110
127 3300047470 Ga0495681_0134121 Ga0495681_0134121_36_380 110
128 3300047673 Ga0495593_0646397 Ga0495593_0646397_86_418 110
129 3300048089 Ga0495614_0005858 Ga0495614_0005858_389_721 110
130 3300048909 Ga0496106_0109332 Ga0496106_0109332_1797_2129 110
131 3300049778 Ga0501282_002466 Ga0501282_002466_275_607 110
132 3300053079 Ga0500610_0187929 Ga0500610_0187929_584_928 110
133 3300053086 Ga0500578_0299219 Ga0500578_0299219_277_621 110
134 3300053087 Ga0500643_125306 Ga0500643_125306_303_647 110
135 3300053090 Ga0500646_0199286 Ga0500646_0199286_70_414 110
136 3300053092 Ga0500583_0210604 Ga0500583_0210604_128_472 110
137 3300053093 Ga0500651_0535329 Ga0500651_0535329_190_534 110
138 3300053094 Ga0500566_0061259 Ga0500566_0061259_689_1033 110
139 3300053096 Ga0500641_0333958 Ga0500641_0333958_227_571 110
140 3300053099 Ga0500654_173957 Ga0500654_173957_326_670 110
141 3300053101 Ga0500553_164193 Ga0500553_164193_287_634 110
142 3300053109 Ga0500569_061382 Ga0500569_061382_132_476 110
143 3300053113 Ga0500580_083645 Ga0500580_083645_339_686 110
144 3300053123 Ga0500614_006154 Ga0500614_006154_873_1220 110
145 3300053126 Ga0500621_053948 Ga0500621_053948_457_801 110
146 3300053129 Ga0500628_209553 Ga0500628_209553_124_468 110
147 3300053131 Ga0500652_009097 Ga0500652_009097_270_614 110
148 3300053134 Ga0500658_0038122 Ga0500658_0038122_1136_1480 110
149 3300053137 Ga0500561_0021155 Ga0500561_0021155_83_427 110
150 3300053142 Ga0500577_0259988 Ga0500577_0259988_333_677 110
151 3300053149 Ga0500600_0105107 Ga0500600_0105107_334_678 110
152 3300053153 Ga0500616_0043885 Ga0500616_0043885_1658_2002 110
153 3300053160 Ga0500633_0164464 Ga0500633_0164464_404_748 110
154 3300053739 Ga0500587_006253 Ga0500587_006253_107_451 110
155 iso_pu_bacteria 3006321560 3006322615 110
156 3300001989 JGI24739J22299_10015480 JGI24739J22299_100154803 112
157 3300001990 JGI24737J22298_10047793 JGI24737J22298_100477932 112
158 3300002067 JGI24735J21928_10030103 JGI24735J21928_100301032 112
159 3300002075 JGI24738J21930_10098346 JGI24738J21930_100983461 112
160 3300003316 rootH1_10016340 rootH1_100163409 112
161 3300003320 rootH2_10108408 rootH2_101084087 112
162 3300003322 rootL2_10011295 rootL2_100112953 112
163 3300003323 rootH1_10003211 rootH1_100032112 112
164 3300003323 rootH1_10025281 rootH1_100252812 112
165 3300003323 rootH1_10025282 rootH1_100252822 112
166 3300003578 Ga0006562J51391_1157409 Ga0006562J51391_11574092 112
167 3300003578 Ga0006562J51391_1157410 Ga0006562J51391_11574107 112
168 3300005439 Ga0070711_101434341 Ga0070711_1014343411 112
169 3300005471 Ga0070698_101222930 Ga0070698_1012229302 112
170 3300005539 Ga0068853_100054136 Ga0068853_1000541364 112
171 3300005543 Ga0070672_101240266 Ga0070672_1012402661 112
172 3300005548 Ga0070665_102167319 Ga0070665_1021673192 112
173 3300005614 Ga0068856_100223398 Ga0068856_1002233982 112
174 3300005616 Ga0068852_102419579 Ga0068852_1024195791 112
175 3300005842 Ga0068858_101722765 Ga0068858_1017227651 112
176 3300005937 Ga0081455_10100897 Ga0081455_101008973 112
177 3300006038 Ga0075365_10147713 Ga0075365_101477132 112
178 3300006042 Ga0075368_10050013 Ga0075368_100500132 112
179 3300006048 Ga0075363_100693062 Ga0075363_1006930621 112
180 3300006178 Ga0075367_10001932 Ga0075367_100019328 112
181 3300006353 Ga0075370_10530982 Ga0075370_105309821 112
182 3300009011 Ga0105251_10013900 Ga0105251_100139002 112
183 3300009036 Ga0105244_10078114 Ga0105244_100781143 112
184 3300009092 Ga0105250_10032581 Ga0105250_100325812 112
185 3300009098 Ga0105245_10214889 Ga0105245_102148892 112
186 3300009101 Ga0105247_10156622 Ga0105247_101566222 112
187 3300009148 Ga0105243_10154889 Ga0105243_101548892 112
188 3300009551 Ga0105238_10203850 Ga0105238_102038504 112
189 3300009551 Ga0105238_10477877 Ga0105238_104778772 112
190 3300009551 Ga0105238_11100643 Ga0105238_111006431 112
191 3300009553 Ga0105249_10728011 Ga0105249_107280112 112
192 3300010375 Ga0105239_10510121 Ga0105239_105101212 112
193 3300010375 Ga0105239_10580632 Ga0105239_105806322 112
194 3300010375 Ga0105239_11605999 Ga0105239_116059992 112
195 3300011119 Ga0105246_10088014 Ga0105246_100880142 112
196 3300011119 Ga0105246_11043860 Ga0105246_110438601 112
197 3300013105 Ga0157369_10170298 Ga0157369_101702983 112
198 3300013306 Ga0163162_12525273 Ga0163162_125252731 112
199 3300013307 Ga0157372_10498816 Ga0157372_104988162 112
200 3300013308 Ga0157375_10442088 Ga0157375_104420882 112
201 3300014497 Ga0182008_10001944 Ga0182008_1000194411 112
202 3300014969 Ga0157376_11137994 Ga0157376_111379941 112
203 3300015261 Ga0182006_1037051 Ga0182006_10370512 112
204 3300015262 Ga0182007_10001129 Ga0182007_100011297 112
205 3300015265 Ga0182005_1074634 Ga0182005_10746342 112
206 3300015688 Ga0183367_1002 Ga0183367_100234 112
207 3300021388 Ga0213875_10003336 Ga0213875_100033361 112
208 3300025302 Ga0207426_1027307 Ga0207426_10273071 112
209 3300025302 Ga0207426_1033574 Ga0207426_10335743 112
210 3300025303 Ga0209051_1106818 Ga0209051_11068182 112
211 3300025735 Ga0207713_1064791 Ga0207713_10647912 112
212 3300025904 Ga0207647_10007368 Ga0207647_100073684 112
213 3300025924 Ga0207694_10193779 Ga0207694_101937792 112
214 3300025927 Ga0207687_10366757 Ga0207687_103667572 112
215 3300025934 Ga0207686_11158651 Ga0207686_111586512 112
216 3300025935 Ga0207709_10023263 Ga0207709_100232632 112
217 3300025940 Ga0207691_10235481 Ga0207691_102354812 112
218 3300025940 Ga0207691_10439237 Ga0207691_104392372 112
219 3300025944 Ga0207661_10138649 Ga0207661_101386492 112
220 3300025961 Ga0207712_10947704 Ga0207712_109477042 112
221 3300025981 Ga0207640_10395393 Ga0207640_103953931 112
222 3300026035 Ga0207703_11564188 Ga0207703_115641882 112
223 3300026041 Ga0207639_12114117 Ga0207639_121141172 112
224 3300026078 Ga0207702_10686557 Ga0207702_106865572 112
225 3300026116 Ga0207674_10613722 Ga0207674_106137222 112
226 3300027312 Ga0209371_1021550 Ga0209371_10215501 112
227 3300027312 Ga0209371_1087523 Ga0209371_10875231 112
228 3300027866 Ga0209813_10027210 Ga0209813_100272102 112
229 3300028379 Ga0268266_11715056 Ga0268266_117150562 112
230 3300028794 Ga0307515_10000813 Ga0307515_1000081312 112
231 3300028794 Ga0307515_10109395 Ga0307515_101093954 112
232 3300030500 Ga0268256_1024205 Ga0268256_10242052 112
233 3300030500 Ga0268256_1046663 Ga0268256_10466632 112
234 3300030521 Ga0307511_10051211 Ga0307511_100512114 112
235 3300030521 Ga0307511_10118501 Ga0307511_101185012 112
236 3300030522 Ga0307512_10051020 Ga0307512_100510203 112
237 3300030522 Ga0307512_10070649 Ga0307512_100706492 112
238 3300030522 Ga0307512_10091748 Ga0307512_100917483 112
239 3300031456 Ga0307513_10017828 Ga0307513_100178286 112
240 3300031456 Ga0307513_10028725 Ga0307513_100287252 112
241 3300031507 Ga0307509_10016921 Ga0307509_100169214 112
242 3300031507 Ga0307509_10116000 Ga0307509_101160002 112
243 3300031616 Ga0307508_10005950 Ga0307508_100059507 112
244 3300031616 Ga0307508_10034247 Ga0307508_100342474 112
245 3300031649 Ga0307514_10053823 Ga0307514_100538233 112
246 3300031649 Ga0307514_10060014 Ga0307514_100600143 112
247 3300031649 Ga0307514_10115022 Ga0307514_101150223 112
248 3300031730 Ga0307516_10001694 Ga0307516_1000169425 112
249 3300031730 Ga0307516_10049439 Ga0307516_100494392 112
250 3300031730 Ga0307516_10093686 Ga0307516_100936862 112
251 3300031838 Ga0307518_10100969 Ga0307518_101009692 112
252 3300033179 Ga0307507_10011491 Ga0307507_100114916 112
253 3300033179 Ga0307507_10274813 Ga0307507_102748132 112
254 3300033180 Ga0307510_10027859 Ga0307510_100278592 112
255 3300033180 Ga0307510_10203628 Ga0307510_102036282 112
256 3300033180 Ga0307510_10255793 Ga0307510_102557932 112
257 3300037418 Ga0395900_0251801 Ga0395900_0251801_581_919 112
258 3300037466 Ga0395898_0014941 Ga0395898_0014941_3441_3779 112
259 3300037466 Ga0395898_0552728 Ga0395898_0552728_568_906 112
260 3300037471 Ga0395905_0113761 Ga0395905_0113761_1996_2334 112
261 3300037853 Ga0436364_0894301 Ga0436364_0894301_697_1035 112
262 3300038443 Ga0395901_0004321 Ga0395901_0004321_12207_12545 112
263 3300041404 Ga0439436_0000864 Ga0439436_0000864_5189_5530 112
264 3300041404 Ga0439436_0019699 Ga0439436_0019699_1147_1485 112
265 3300041406 Ga0439439_0001188 Ga0439439_0001188_3695_4036 112
266 3300041406 Ga0439439_0017456 Ga0439439_0017456_758_1096 112
267 3300041406 Ga0439439_0079580 Ga0439439_0079580_151_489 112
268 3300041456 Ga0451795_1596757 Ga0451795_1596757_384_722 112
269 3300041486 Ga0451807_1292668 Ga0451807_1292668_351_689 112
270 3300041491 Ga0451833_1452990 Ga0451833_1452990_80_418 112
271 3300041492 Ga0451835_0932778 Ga0451835_0932778_64_420 112
272 3300041494 Ga0451837_0652012 Ga0451837_0652012_1939_2277 112
273 3300041496 Ga0451839_0729921 Ga0451839_0729921_155_493 112
274 3300041512 Ga0451853_0696848 Ga0451853_0696848_1976_2332 112
275 3300041512 Ga0451853_3795338 Ga0451853_3795338_2311_2649 112
276 3300042005 Ga0439448_0002802 Ga0439448_0002802_805_1143 112
277 3300042005 Ga0439448_0022472 Ga0439448_0022472_641_979 112
278 3300042007 Ga0439449_0009106 Ga0439449_0009106_695_1033 112
279 3300042007 Ga0439449_0027188 Ga0439449_0027188_1008_1349 112
280 3300042007 Ga0439449_0245857 Ga0439449_0245857_161_502 112
281 3300042008 Ga0439450_021872 Ga0439450_021872_421_777 112
282 3300042012 Ga0439455_0007163 Ga0439455_0007163_1438_1776 112
283 3300042012 Ga0439455_0127537 Ga0439455_0127537_137_475 112
284 3300042014 Ga0439457_000919 Ga0439457_000919_3323_3661 112
285 3300042014 Ga0439457_034554 Ga0439457_034554_344_685 112
286 3300042015 Ga0439462_0006442 Ga0439462_0006442_1420_1758 112
287 3300042127 Ga0450890_006905 Ga0450890_006905_634_975 112
288 3300042131 Ga0450894_000089 Ga0450894_000089_8952_9290 112
289 3300042134 Ga0450898_000428 Ga0450898_000428_4215_4553 112
290 3300042134 Ga0450898_036956 Ga0450898_036956_313_654 112
291 3300042135 Ga0450899_000458 Ga0450899_000458_1719_2057 112
292 3300042137 Ga0450902_073162 Ga0450902_073162_177_515 112
293 3300042138 Ga0450903_000025 Ga0450903_000025_4386_4724 112
294 3300042145 Ga0450906_000226 Ga0450906_000226_1438_1776 112
295 3300042157 Ga0439458_0000750 Ga0439458_0000750_5846_6184 112
296 3300044656 Ga0466969_0157280 Ga0466969_0157280_244_582 112
297 3300044658 Ga0466972_0002962 Ga0466972_0002962_6467_6805 112
298 3300044658 Ga0466972_0004174 Ga0466972_0004174_322_660 112
299 3300044658 Ga0466972_0007163 Ga0466972_0007163_3311_3649 112
300 3300044658 Ga0466972_0122071 Ga0466972_0122071_105_443 112
301 3300044683 Ga0466965_0077772 Ga0466965_0077772_932_1270 112
302 3300044683 Ga0466965_0905607 Ga0466965_0905607_89_427 112
303 3300044684 Ga0466966_0006232 Ga0466966_0006232_6745_7083 112
304 3300044684 Ga0466966_0020981 Ga0466966_0020981_1860_2198 112
305 3300044684 Ga0466966_0616634 Ga0466966_0616634_34_372 112
306 3300044693 Ga0466961_0003621 Ga0466961_0003621_7339_7677 112
307 3300044693 Ga0466961_0020002 Ga0466961_0020002_3881_4219 112
308 3300044693 Ga0466961_0045500 Ga0466961_0045500_126_464 112
309 3300044693 Ga0466961_0243983 Ga0466961_0243983_603_941 112
310 3300044694 Ga0466963_0012012 Ga0466963_0012012_3125_3463 112
311 3300044694 Ga0466963_0634558 Ga0466963_0634558_355_693 112
312 3300044706 Ga0466964_0004533 Ga0466964_0004533_2956_3294 112
313 3300044706 Ga0466964_0066014 Ga0466964_0066014_646_984 112
314 3300044719 Ga0466971_0023423 Ga0466971_0023423_2141_2479 112
315 3300044719 Ga0466971_0077987 Ga0466971_0077987_849_1187 112
316 3300044735 Ga0466968_0027810 Ga0466968_0027810_153_491 112
317 3300044735 Ga0466968_0039702 Ga0466968_0039702_1588_1926 112
318 3300044765 Ga0466970_0001226 Ga0466970_0001226_4817_5155 112
319 3300044765 Ga0466970_0004495 Ga0466970_0004495_3349_3687 112
320 3300044765 Ga0466970_0093768 Ga0466970_0093768_1125_1463 112
321 3300044765 Ga0466970_0383813 Ga0466970_0383813_244_582 112
322 3300044842 Ga0466957_0002870 Ga0466957_0002870_2272_2610 112
323 3300044842 Ga0466957_0221321 Ga0466957_0221321_552_893 112
324 3300044901 Ga0466960_0021297 Ga0466960_0021297_1589_1927 112
325 3300045049 Ga0466959_0003319 Ga0466959_0003319_9363_9701 112
326 3300045049 Ga0466959_0892016 Ga0466959_0892016_172_510 112
327 3300045836 Ga0466958_0004341 Ga0466958_0004341_1908_2246 112
328 3300045836 Ga0466958_0257236 Ga0466958_0257236_666_1004 112
329 3300045976 Ga0466967_0001968 Ga0466967_0001968_6152_6490 112
330 3300045976 Ga0466967_0090406 Ga0466967_0090406_1332_1670 112
331 3300045976 Ga0466967_0142885 Ga0466967_0142885_976_1314 112
332 3300045976 Ga0466967_0267553 Ga0466967_0267553_101_442 112
333 3300045976 Ga0466967_0444308 Ga0466967_0444308_813_1154 112
334 3300045976 Ga0466967_0693257 Ga0466967_0693257_537_878 112
335 3300046452 Ga0495617_067526 Ga0495617_067526_709_1047 112
336 3300046452 Ga0495617_153465 Ga0495617_153465_163_501 112
337 3300046453 Ga0495627_044652 Ga0495627_044652_700_1038 112
338 3300046454 Ga0495592_0002770 Ga0495592_0002770_5407_5745 112
339 3300046454 Ga0495592_0033022 Ga0495592_0033022_3344_3682 112
340 3300046454 Ga0495592_0080563 Ga0495592_0080563_1140_1481 112
341 3300046455 Ga0495603_0001759 Ga0495603_0001759_11933_12271 112
342 3300046455 Ga0495603_0012358 Ga0495603_0012358_2067_2408 112
343 3300046455 Ga0495603_0042651 Ga0495603_0042651_856_1194 112
344 3300046455 Ga0495603_0043852 Ga0495603_0043852_2254_2592 112
345 3300046455 Ga0495603_0418772 Ga0495603_0418772_240_578 112
346 3300046457 Ga0495590_0217666 Ga0495590_0217666_24_362 112
347 3300046459 Ga0495629_0008001 Ga0495629_0008001_797_1135 112
348 3300046459 Ga0495629_0012969 Ga0495629_0012969_2921_3262 112
349 3300046459 Ga0495629_0016650 Ga0495629_0016650_2131_2469 112
350 3300046459 Ga0495629_0023384 Ga0495629_0023384_1571_1912 112
351 3300046459 Ga0495629_0044605 Ga0495629_0044605_2750_3088 112
352 3300046459 Ga0495629_0426537 Ga0495629_0426537_20_358 112
353 3300046459 Ga0495629_0543301 Ga0495629_0543301_66_404 112
354 3300046460 Ga0495638_0082604 Ga0495638_0082604_206_544 112
355 3300046460 Ga0495638_0149916 Ga0495638_0149916_853_1191 112
356 3300046460 Ga0495638_0152079 Ga0495638_0152079_518_856 112
357 3300046460 Ga0495638_0196277 Ga0495638_0196277_198_536 112
358 3300046462 Ga0495651_0001653 Ga0495651_0001653_16891_17229 112
359 3300046462 Ga0495651_0005532 Ga0495651_0005532_1229_1570 112
360 3300046462 Ga0495651_0051354 Ga0495651_0051354_209_547 112
361 3300046463 Ga0495653_0146595 Ga0495653_0146595_999_1337 112
362 3300046472 Ga0495580_0139522 Ga0495580_0139522_664_1002 112
363 3300046473 Ga0495582_0017157 Ga0495582_0017157_3427_3765 112
364 3300046473 Ga0495582_0311540 Ga0495582_0311540_67_405 112
365 3300046474 Ga0495605_0031015 Ga0495605_0031015_1036_1374 112
366 3300046475 Ga0495639_0064589 Ga0495639_0064589_695_1033 112
367 3300046475 Ga0495639_0247075 Ga0495639_0247075_263_601 112
368 3300046476 Ga0495662_0003171 Ga0495662_0003171_6153_6491 112
369 3300046476 Ga0495662_0019058 Ga0495662_0019058_2585_2923 112
370 3300046476 Ga0495662_0143790 Ga0495662_0143790_663_1001 112
371 3300046476 Ga0495662_0233158 Ga0495662_0233158_256_594 112
372 3300046476 Ga0495662_0567010 Ga0495662_0567010_61_402 112
373 3300046477 Ga0495664_0000282 Ga0495664_0000282_8194_8532 112
374 3300046477 Ga0495664_0053517 Ga0495664_0053517_430_768 112
375 3300046477 Ga0495664_0075260 Ga0495664_0075260_894_1235 112
376 3300046491 Ga0495584_0181036 Ga0495584_0181036_176_514 112
377 3300046492 Ga0495585_0035662 Ga0495585_0035662_2422_2763 112
378 3300046492 Ga0495585_0054957 Ga0495585_0054957_627_965 112
379 3300046492 Ga0495585_0474836 Ga0495585_0474836_199_540 112
380 3300046492 Ga0495585_0480161 Ga0495585_0480161_39_377 112
381 3300046499 Ga0495594_0032639 Ga0495594_0032639_2022_2360 112
382 3300046499 Ga0495594_0117308 Ga0495594_0117308_400_741 112
383 3300046499 Ga0495594_0371088 Ga0495594_0371088_228_566 112
384 3300046499 Ga0495594_0388072 Ga0495594_0388072_420_758 112
385 3300046500 Ga0495596_0024281 Ga0495596_0024281_773_1111 112
386 3300046501 Ga0495607_0012696 Ga0495607_0012696_1671_2009 112
387 3300046501 Ga0495607_0102530 Ga0495607_0102530_58_396 112
388 3300046507 Ga0495606_0064381 Ga0495606_0064381_1033_1371 112
389 3300046512 Ga0495610_0054597 Ga0495610_0054597_750_1088 112
390 3300046512 Ga0495610_0259406 Ga0495610_0259406_320_658 112
391 3300046513 Ga0495616_0006140 Ga0495616_0006140_1803_2141 112
392 3300046514 Ga0495618_0025172 Ga0495618_0025172_1061_1399 112
393 3300046514 Ga0495618_0031655 Ga0495618_0031655_2185_2526 112
394 3300046514 Ga0495618_0127295 Ga0495618_0127295_833_1171 112
395 3300046515 Ga0495620_0085339 Ga0495620_0085339_32_370 112
396 3300046515 Ga0495620_0161817 Ga0495620_0161817_469_807 112
397 3300046516 Ga0495628_0022296 Ga0495628_0022296_1451_1789 112
398 3300046516 Ga0495628_0023269 Ga0495628_0023269_691_1032 112
399 3300046516 Ga0495628_0167442 Ga0495628_0167442_372_710 112
400 3300046517 Ga0495630_0025860 Ga0495630_0025860_3486_3824 112
401 3300046518 Ga0495631_0018251 Ga0495631_0018251_1803_2141 112
402 3300046518 Ga0495631_0034970 Ga0495631_0034970_453_791 112
403 3300046519 Ga0495632_0195749 Ga0495632_0195749_31_369 112
404 3300046520 Ga0495637_0120558 Ga0495637_0120558_472_810 112
405 3300046522 Ga0495643_0001554 Ga0495643_0001554_19516_19854 112
406 3300046522 Ga0495643_0217214 Ga0495643_0217214_34_372 112
407 3300046523 Ga0495644_0032456 Ga0495644_0032456_961_1299 112
408 3300046523 Ga0495644_0232160 Ga0495644_0232160_333_671 112
409 3300046524 Ga0495648_0078644 Ga0495648_0078644_366_704 112
410 3300046526 Ga0495666_0048633 Ga0495666_0048633_596_934 112
411 3300046526 Ga0495666_0412287 Ga0495666_0412287_191_529 112
412 3300046528 Ga0495642_0129576 Ga0495642_0129576_115_453 112
413 3300046529 Ga0495652_0028026 Ga0495652_0028026_222_563 112
414 3300046529 Ga0495652_0158430 Ga0495652_0158430_982_1320 112
415 3300046530 Ga0495654_0042557 Ga0495654_0042557_812_1150 112
416 3300046533 Ga0495640_0013523 Ga0495640_0013523_2195_2536 112
417 3300046533 Ga0495640_0030666 Ga0495640_0030666_3303_3644 112
418 3300046533 Ga0495640_0030868 Ga0495640_0030868_2315_2653 112
419 3300046533 Ga0495640_0150123 Ga0495640_0150123_578_916 112
420 3300046535 Ga0495586_0027579 Ga0495586_0027579_1507_1845 112
421 3300046536 Ga0495587_0029688 Ga0495587_0029688_2935_3273 112
422 3300046536 Ga0495587_0093009 Ga0495587_0093009_763_1101 112
423 3300046538 Ga0495609_0032050 Ga0495609_0032050_1134_1472 112
424 3300046542 Ga0495597_0202467 Ga0495597_0202467_247_585 112
425 3300046543 Ga0495645_0007346 Ga0495645_0007346_3277_3615 112
426 3300046543 Ga0495645_0412377 Ga0495645_0412377_216_554 112
427 3300046557 Ga0495622_0012385 Ga0495622_0012385_2501_2839 112
428 3300046557 Ga0495622_0130595 Ga0495622_0130595_346_684 112
429 3300046558 Ga0495633_0018654 Ga0495633_0018654_972_1310 112
430 3300046558 Ga0495633_0330178 Ga0495633_0330178_270_608 112
431 3300046559 Ga0495667_0074258 Ga0495667_0074258_905_1246 112
432 3300046615 Ga0495656_0042215 Ga0495656_0042215_1199_1537 112
433 3300046616 Ga0495668_0070198 Ga0495668_0070198_228_566 112
434 3300046642 Ga0495634_0004963 Ga0495634_0004963_2665_3003 112
435 3300046642 Ga0495634_0006932 Ga0495634_0006932_894_1235 112
436 3300046642 Ga0495634_0394030 Ga0495634_0394030_245_583 112
437 3300046648 Ga0495611_0031653 Ga0495611_0031653_1576_1914 112
438 3300046648 Ga0495611_0049366 Ga0495611_0049366_420_758 112
439 3300046648 Ga0495611_0269004 Ga0495611_0269004_353_691 112
440 3300046648 Ga0495611_0279660 Ga0495611_0279660_54_392 112
441 3300046660 Ga0495625_0016470 Ga0495625_0016470_1471_1809 112
442 3300046660 Ga0495625_0020466 Ga0495625_0020466_2712_3050 112
443 3300046660 Ga0495625_0121946 Ga0495625_0121946_785_1123 112
444 3300046660 Ga0495625_0220917 Ga0495625_0220917_463_801 112
445 3300046663 Ga0495635_0000593 Ga0495635_0000593_14127_14465 112
446 3300046663 Ga0495635_0062632 Ga0495635_0062632_1883_2221 112
447 3300046664 Ga0495659_0071711 Ga0495659_0071711_107_445 112
448 3300046665 Ga0495661_0133290 Ga0495661_0133290_354_692 112
449 3300046674 Ga0495588_0006697 Ga0495588_0006697_564_902 112
450 3300046674 Ga0495588_0009714 Ga0495588_0009714_669_1007 112
451 3300046674 Ga0495588_0115849 Ga0495588_0115849_430_768 112
452 3300046674 Ga0495588_0218376 Ga0495588_0218376_115_453 112
453 3300046674 Ga0495588_0710693 Ga0495588_0710693_92_430 112
454 3300046675 Ga0495657_0002382 Ga0495657_0002382_7187_7525 112
455 3300046675 Ga0495657_0004529 Ga0495657_0004529_9171_9512 112
456 3300046675 Ga0495657_0019119 Ga0495657_0019119_2687_3025 112
457 3300046675 Ga0495657_0134556 Ga0495657_0134556_222_560 112
458 3300046678 Ga0495599_0075685 Ga0495599_0075685_25_363 112
459 3300046679 Ga0495623_0049744 Ga0495623_0049744_506_844 112
460 3300046680 Ga0495646_0002399 Ga0495646_0002399_5493_5831 112
461 3300046680 Ga0495646_0053865 Ga0495646_0053865_847_1185 112
462 3300046681 Ga0495647_0157000 Ga0495647_0157000_56_394 112
463 3300046683 Ga0495658_0020193 Ga0495658_0020193_2264_2602 112
464 3300046689 Ga0495613_0007902 Ga0495613_0007902_3777_4115 112
465 3300046689 Ga0495613_0026062 Ga0495613_0026062_3074_3415 112
466 3300046689 Ga0495613_0218330 Ga0495613_0218330_130_471 112
467 3300046689 Ga0495613_0333107 Ga0495613_0333107_179_517 112
468 3300046689 Ga0495613_0457863 Ga0495613_0457863_455_793 112
469 3300046689 Ga0495613_0470347 Ga0495613_0470347_146_484 112
470 3300046690 Ga0495624_0021164 Ga0495624_0021164_208_549 112
471 3300046690 Ga0495624_0063478 Ga0495624_0063478_1194_1532 112
472 3300046690 Ga0495624_0324856 Ga0495624_0324856_293_631 112
473 3300046690 Ga0495624_0391535 Ga0495624_0391535_251_589 112
474 3300046691 Ga0495670_0021532 Ga0495670_0021532_985_1323 112
475 3300046691 Ga0495670_0132012 Ga0495670_0132012_682_1020 112
476 3300046691 Ga0495670_0338762 Ga0495670_0338762_160_498 112
477 3300046692 Ga0495671_0007806 Ga0495671_0007806_1455_1793 112
478 3300046692 Ga0495671_0076828 Ga0495671_0076828_407_745 112
479 3300046694 Ga0495649_0085127 Ga0495649_0085127_16_372 112
480 3300046694 Ga0495649_0138439 Ga0495649_0138439_919_1257 112
481 3300046694 Ga0495649_0282398 Ga0495649_0282398_345_683 112
482 3300046794 Ga0495589_0018231 Ga0495589_0018231_3041_3379 112
483 3300046794 Ga0495589_0024586 Ga0495589_0024586_1002_1340 112
484 3300046794 Ga0495589_0096008 Ga0495589_0096008_443_781 112
485 3300046794 Ga0495589_0098553 Ga0495589_0098553_713_1051 112
486 3300046794 Ga0495589_0103568 Ga0495589_0103568_379_717 112
487 3300046794 Ga0495589_0129480 Ga0495589_0129480_264_602 112
488 3300046794 Ga0495589_0147737 Ga0495589_0147737_53_391 112
489 3300046809 Ga0495600_0004771 Ga0495600_0004771_1541_1882 112
490 3300046809 Ga0495600_0006332 Ga0495600_0006332_877_1215 112
491 3300046809 Ga0495600_0099347 Ga0495600_0099347_744_1082 112
492 3300046809 Ga0495600_0549801 Ga0495600_0549801_324_662 112
493 3300046810 Ga0495660_0048366 Ga0495660_0048366_715_1053 112
494 3300047315 Ga0495581_0004318 Ga0495581_0004318_3687_4025 112
495 3300047315 Ga0495581_0028125 Ga0495581_0028125_168_506 112
496 3300047315 Ga0495581_0063633 Ga0495581_0063633_1719_2057 112
497 3300047315 Ga0495581_0163597 Ga0495581_0163597_861_1202 112
498 3300047315 Ga0495581_0750475 Ga0495581_0750475_186_524 112
499 3300047317 Ga0495604_0006494 Ga0495604_0006494_7818_8156 112
500 3300047317 Ga0495604_0058030 Ga0495604_0058030_1305_1646 112
501 3300047317 Ga0495604_0100593 Ga0495604_0100593_305_646 112
502 3300047317 Ga0495604_0601304 Ga0495604_0601304_278_640 112
503 3300047318 Ga0495636_0006423 Ga0495636_0006423_2323_2661 112
504 3300047318 Ga0495636_0025732 Ga0495636_0025732_1598_1936 112
505 3300047318 Ga0495636_0259354 Ga0495636_0259354_455_793 112
506 3300047318 Ga0495636_0266988 Ga0495636_0266988_197_535 112
507 3300047318 Ga0495636_0503794 Ga0495636_0503794_163_501 112
508 3300047318 Ga0495636_0506286 Ga0495636_0506286_94_432 112
509 3300047319 Ga0495674_0122442 Ga0495674_0122442_1825_2163 112
510 3300047319 Ga0495674_0640258 Ga0495674_0640258_201_539 112
511 3300047320 Ga0495672_0096584 Ga0495672_0096584_1212_1550 112
512 3300047321 Ga0495676_0002667 Ga0495676_0002667_12577_12915 112
513 3300047321 Ga0495676_0008638 Ga0495676_0008638_5064_5402 112
514 3300047321 Ga0495676_0011467 Ga0495676_0011467_309_650 112
515 3300047321 Ga0495676_0138022 Ga0495676_0138022_49_387 112
516 3300047321 Ga0495676_0140335 Ga0495676_0140335_914_1252 112
517 3300047321 Ga0495676_0277945 Ga0495676_0277945_684_1022 112
518 3300047321 Ga0495676_0696327 Ga0495676_0696327_280_618 112
519 3300047322 Ga0495680_0001987 Ga0495680_0001987_6953_7291 112
520 3300047322 Ga0495680_0347016 Ga0495680_0347016_210_551 112
521 3300047323 Ga0495683_0110162 Ga0495683_0110162_263_601 112
522 3300047323 Ga0495683_0148392 Ga0495683_0148392_650_988 112
523 3300047323 Ga0495683_0251168 Ga0495683_0251168_186_524 112
524 3300047443 Ga0495687_001345 Ga0495687_001345_3670_4008 112
525 3300047443 Ga0495687_008623 Ga0495687_008623_5080_5418 112
526 3300047443 Ga0495687_011944 Ga0495687_011944_4095_4433 112
527 3300047443 Ga0495687_113292 Ga0495687_113292_221_559 112
528 3300047444 Ga0495675_0002357 Ga0495675_0002357_1040_1378 112
529 3300047444 Ga0495675_0083454 Ga0495675_0083454_29_367 112
530 3300047444 Ga0495675_0086655 Ga0495675_0086655_1540_1881 112
531 3300047445 Ga0495677_0021381 Ga0495677_0021381_1014_1352 112
532 3300047447 Ga0495685_001961 Ga0495685_001961_4460_4798 112
533 3300047447 Ga0495685_013872 Ga0495685_013872_1936_2274 112
534 3300047447 Ga0495685_014059 Ga0495685_014059_528_866 112
535 3300047447 Ga0495685_057575 Ga0495685_057575_401_739 112
536 3300047470 Ga0495681_0001930 Ga0495681_0001930_12905_13243 112
537 3300047470 Ga0495681_0033825 Ga0495681_0033825_1111_1449 112
538 3300047471 Ga0495684_0120483 Ga0495684_0120483_697_1035 112
539 3300047471 Ga0495684_0246598 Ga0495684_0246598_324_662 112
540 3300047472 Ga0495686_0010378 Ga0495686_0010378_4532_4870 112
541 3300047472 Ga0495686_0081037 Ga0495686_0081037_164_502 112
542 3300047472 Ga0495686_0317022 Ga0495686_0317022_234_572 112
543 3300047673 Ga0495593_0001804 Ga0495593_0001804_9450_9788 112
544 3300047673 Ga0495593_0172072 Ga0495593_0172072_538_876 112
545 3300047673 Ga0495593_0285079 Ga0495593_0285079_430_768 112
546 3300048088 Ga0495602_0062348 Ga0495602_0062348_1007_1345 112
547 3300048088 Ga0495602_0169775 Ga0495602_0169775_495_833 112
548 3300048089 Ga0495614_0004349 Ga0495614_0004349_1930_2268 112
549 3300048089 Ga0495614_0011311 Ga0495614_0011311_2131_2469 112
550 3300048091 Ga0495626_0044420 Ga0495626_0044420_235_573 112
551 3300048907 Ga0496104_1012177 Ga0496104_1012177_178_516 112
552 3300048911 Ga0496108_0331456 Ga0496108_0331456_197_535 112
553 3300048912 Ga0496109_0099066 Ga0496109_0099066_2223_2561 112
554 3300048913 Ga0496110_0450462 Ga0496110_0450462_441_779 112
555 3300049459 Ga0495678_075067 Ga0495678_075067_228_566 112
556 3300049460 Ga0495682_0012475 Ga0495682_0012475_1076_1414 112
557 3300049568 Ga0501031_0007853 Ga0501031_0007853_6326_6667 112
558 3300049568 Ga0501031_0095748 Ga0501031_0095748_798_1139 112
559 3300049568 Ga0501031_0150708 Ga0501031_0150708_95_439 112
560 3300049568 Ga0501031_0169824 Ga0501031_0169824_500_841 112
561 3300049569 Ga0501032_0012081 Ga0501032_0012081_3710_4123 112
562 3300049569 Ga0501032_0021673 Ga0501032_0021673_3870_4211 112
563 3300049569 Ga0501032_0088534 Ga0501032_0088534_1533_1874 112
564 3300049569 Ga0501032_0089925 Ga0501032_0089925_347_685 112
565 3300049569 Ga0501032_0109615 Ga0501032_0109615_1466_1807 112
566 3300049569 Ga0501032_0140874 Ga0501032_0140874_1119_1463 112
567 3300049570 Ga0501033_0001721 Ga0501033_0001721_15535_15873 112
568 3300049570 Ga0501033_0005963 Ga0501033_0005963_4712_5050 112
569 3300049570 Ga0501033_0011432 Ga0501033_0011432_646_987 112
570 3300049570 Ga0501033_0033426 Ga0501033_0033426_2042_2455 112
571 3300049570 Ga0501033_0101712 Ga0501033_0101712_765_1106 112
572 3300049570 Ga0501033_0174662 Ga0501033_0174662_160_498 112
573 3300049570 Ga0501033_0362309 Ga0501033_0362309_407_748 112
574 3300049571 Ga0501034_0006924 Ga0501034_0006924_5597_5935 112
575 3300049571 Ga0501034_0013110 Ga0501034_0013110_7982_8323 112
576 3300049571 Ga0501034_0015840 Ga0501034_0015840_7361_7702 112
577 3300049571 Ga0501034_0021973 Ga0501034_0021973_2287_2700 112
578 3300049571 Ga0501034_0031442 Ga0501034_0031442_3006_3344 112
579 3300049571 Ga0501034_0049592 Ga0501034_0049592_513_851 112
580 3300049571 Ga0501034_0226451 Ga0501034_0226451_1232_1573 112
581 3300049572 Ga0501036_0006789 Ga0501036_0006789_142_483 112
582 3300049572 Ga0501036_0011358 Ga0501036_0011358_788_1201 112
583 3300049572 Ga0501036_0033288 Ga0501036_0033288_3938_4279 112
584 3300049572 Ga0501036_0044024 Ga0501036_0044024_2932_3273 112
585 3300049572 Ga0501036_0046619 Ga0501036_0046619_2157_2495 112
586 3300049572 Ga0501036_0074787 Ga0501036_0074787_1307_1645 112
587 3300049572 Ga0501036_1162365 Ga0501036_1162365_267_611 112
588 3300049573 Ga0501037_0000724 Ga0501037_0000724_17403_17744 112
589 3300049573 Ga0501037_0020484 Ga0501037_0020484_1697_2113 112
590 3300049573 Ga0501037_0227667 Ga0501037_0227667_108_449 112
591 3300049573 Ga0501037_0514403 Ga0501037_0514403_363_701 112
592 3300049573 Ga0501037_0597556 Ga0501037_0597556_93_437 112
593 3300049574 Ga0501038_0006792 Ga0501038_0006792_3235_3573 112
594 3300049574 Ga0501038_0015400 Ga0501038_0015400_21_362 112
595 3300049574 Ga0501038_0030710 Ga0501038_0030710_1801_2214 112
596 3300049574 Ga0501038_0046312 Ga0501038_0046312_1849_2187 112
597 3300049574 Ga0501038_0225815 Ga0501038_0225815_1082_1423 112
598 3300049574 Ga0501038_0286131 Ga0501038_0286131_221_562 112
599 3300049575 Ga0501039_0021239 Ga0501039_0021239_1836_2174 112
600 3300049575 Ga0501039_0146048 Ga0501039_0146048_790_1131 112
601 3300049575 Ga0501039_0177907 Ga0501039_0177907_21_362 112
602 3300049575 Ga0501039_0225093 Ga0501039_0225093_873_1286 112
603 3300049575 Ga0501039_0695219 Ga0501039_0695219_77_418 112
604 3300049575 Ga0501039_1043660 Ga0501039_1043660_247_585 112
605 3300049576 Ga0501040_0032902 Ga0501040_0032902_1605_1946 112
606 3300049576 Ga0501040_0853587 Ga0501040_0853587_286_627 112
607 3300049577 Ga0501041_0003165 Ga0501041_0003165_3935_4276 112
608 3300049578 Ga0501042_0051139 Ga0501042_0051139_1678_2019 112
609 3300049578 Ga0501042_0305410 Ga0501042_0305410_529_891 112
610 3300049578 Ga0501042_0792986 Ga0501042_0792986_219_557 112
611 3300049579 Ga0501043_0003026 Ga0501043_0003026_13554_13895 112
612 3300049579 Ga0501043_0006148 Ga0501043_0006148_4265_4678 112
613 3300049579 Ga0501043_0013131 Ga0501043_0013131_1384_1722 112
614 3300049579 Ga0501043_0020604 Ga0501043_0020604_4138_4479 112
615 3300049579 Ga0501043_0058756 Ga0501043_0058756_1089_1430 112
616 3300049580 Ga0501046_0009533 Ga0501046_0009533_790_1131 112
617 3300049580 Ga0501046_0512276 Ga0501046_0512276_490_831 112
618 3300049580 Ga0501046_0643090 Ga0501046_0643090_367_705 112
619 3300049580 Ga0501046_0644479 Ga0501046_0644479_166_507 112
620 3300049580 Ga0501046_0668710 Ga0501046_0668710_212_625 112
621 3300049580 Ga0501046_1129656 Ga0501046_1129656_65_406 112
622 3300049581 Ga0501047_0000029 Ga0501047_0000029_198578_198940 112
623 3300049581 Ga0501047_0007463 Ga0501047_0007463_9905_10246 112
624 3300049581 Ga0501047_0009513 Ga0501047_0009513_1405_1818 112
625 3300049581 Ga0501047_0018385 Ga0501047_0018385_34_375 112
626 3300049581 Ga0501047_0050309 Ga0501047_0050309_3526_3867 112
627 3300049581 Ga0501047_0156412 Ga0501047_0156412_1618_1956 112
628 3300049581 Ga0501047_0585273 Ga0501047_0585273_187_525 112
629 3300049581 Ga0501047_0694023 Ga0501047_0694023_306_647 112
630 3300049582 Ga0501048_0010502 Ga0501048_0010502_6453_6794 112
631 3300049582 Ga0501048_0656522 Ga0501048_0656522_136_474 112
632 3300049583 Ga0501067_0000704 Ga0501067_0000704_16964_17305 112
633 3300049584 Ga0501068_0002685 Ga0501068_0002685_1577_1918 112
634 3300049584 Ga0501068_0262251 Ga0501068_0262251_47_385 112
635 3300049584 Ga0501068_0342525 Ga0501068_0342525_104_517 112
636 3300049584 Ga0501068_0643194 Ga0501068_0643194_303_641 112
637 3300049585 Ga0501069_0008565 Ga0501069_0008565_1100_1441 112
638 3300049585 Ga0501069_0040285 Ga0501069_0040285_878_1216 112
639 3300049586 Ga0501070_0003332 Ga0501070_0003332_7895_8233 112
640 3300049586 Ga0501070_0012618 Ga0501070_0012618_1633_2046 112
641 3300049586 Ga0501070_0116679 Ga0501070_0116679_626_964 112
642 3300049586 Ga0501070_0362508 Ga0501070_0362508_34_375 112
643 3300049586 Ga0501070_0407960 Ga0501070_0407960_700_1041 112
644 3300049586 Ga0501070_0457685 Ga0501070_0457685_630_971 112
645 3300049587 Ga0501071_0000263 Ga0501071_0000263_16993_17334 112
646 3300049589 Ga0501073_0456586 Ga0501073_0456586_330_668 112
647 3300049590 Ga0501074_0000685 Ga0501074_0000685_1755_2093 112
648 3300049590 Ga0501074_0004802 Ga0501074_0004802_5778_6119 112
649 3300049590 Ga0501074_0386835 Ga0501074_0386835_45_383 112
650 3300049593 Ga0501077_0042588 Ga0501077_0042588_1917_2258 112
651 3300049704 Ga0501221_069027 Ga0501221_069027_124_465 112
652 3300049741 Ga0501079_0026744 Ga0501079_0026744_2756_3097 112
653 3300049742 Ga0501080_0097712 Ga0501080_0097712_801_1142 112
654 3300049742 Ga0501080_0941380 Ga0501080_0941380_141_479 112
655 3300049744 Ga0501083_0000333 Ga0501083_0000333_218_559 112
656 3300049822 Ga0501035_0001374 Ga0501035_0001374_10073_10411 112
657 3300049822 Ga0501035_0005791 Ga0501035_0005791_1970_2311 112
658 3300049822 Ga0501035_0012244 Ga0501035_0012244_2966_3379 112
659 3300049822 Ga0501035_0017071 Ga0501035_0017071_21_362 112
660 3300049822 Ga0501035_0058803 Ga0501035_0058803_1881_2219 112
661 3300049822 Ga0501035_0083761 Ga0501035_0083761_1527_1865 112
662 3300049822 Ga0501035_0090571 Ga0501035_0090571_1307_1651 112
663 3300049822 Ga0501035_0112308 Ga0501035_0112308_991_1332 112
664 3300049822 Ga0501035_0268222 Ga0501035_0268222_524_865 112
665 3300049822 Ga0501035_0863649 Ga0501035_0863649_349_693 112
666 3300049823 Ga0501044_0004873 Ga0501044_0004873_14576_14917 112
667 3300049823 Ga0501044_0006533 Ga0501044_0006533_9113_9451 112
668 3300049823 Ga0501044_0047776 Ga0501044_0047776_3942_4283 112
669 3300049823 Ga0501044_0073556 Ga0501044_0073556_2748_3086 112
670 3300049823 Ga0501044_0116755 Ga0501044_0116755_1352_1693 112
671 3300049823 Ga0501044_0139161 Ga0501044_0139161_117_458 112
672 3300049823 Ga0501044_0204679 Ga0501044_0204679_956_1294 112
673 3300049823 Ga0501044_0276661 Ga0501044_0276661_479_823 112
674 3300049823 Ga0501044_0277548 Ga0501044_0277548_268_630 112
675 3300049823 Ga0501044_0280813 Ga0501044_0280813_820_1161 112
676 3300049823 Ga0501044_0350709 Ga0501044_0350709_42_380 112
677 3300049823 Ga0501044_0783279 Ga0501044_0783279_393_737 112
678 3300049824 Ga0501045_0006168 Ga0501045_0006168_5287_5628 112
679 3300049824 Ga0501045_0138757 Ga0501045_0138757_1344_1685 112
680 3300050490 nmdc:mga03n38_23835_c1 nmdc:mga03n38_23835_c1_1195_1536 112
681 3300050492 nmdc:mga0yw44_115921_c1 nmdc:mga0yw44_115921_c1_1087_1425 112
682 3300050494 nmdc:mga06z11_584_c1 nmdc:mga06z11_584_c1_12337_12738 112
683 3300050495 nmdc:mga04h51_93480_c1 nmdc:mga04h51_93480_c1_28_429 112
684 3300050496 nmdc:mga07m45_178137_c1 nmdc:mga07m45_178137_c1_120_461 112
685 3300053080 Ga0500635_0348485 Ga0500635_0348485_82_420 112
686 3300053083 Ga0495655_0156777 Ga0495655_0156777_241_579 112
687 3300053083 Ga0495655_0224217 Ga0495655_0224217_254_595 112
688 3300053085 Ga0495619_0071215 Ga0495619_0071215_1241_1579 112
689 3300053095 Ga0500640_070233 Ga0500640_070233_994_1332 112
690 3300053107 Ga0500560_000786 Ga0500560_000786_1109_1447 112
691 3300053122 Ga0500608_104312 Ga0500608_104312_913_1251 112
692 3300053123 Ga0500614_050662 Ga0500614_050662_82_420 112
693 3300053140 Ga0500573_0017578 Ga0500573_0017578_3422_3760 112
694 3300053149 Ga0500600_0234861 Ga0500600_0234861_155_493 112
695 3300053149 Ga0500600_0250607 Ga0500600_0250607_200_538 112
696 3300053157 Ga0500624_001455 Ga0500624_001455_1185_1523 112
697 3300053161 Ga0500634_0232953 Ga0500634_0232953_173_511 112
698 3300054114 Ga0501084_0005179 Ga0501084_0005179_6364_6705 112
699 3300054114 Ga0501084_0665255 Ga0501084_0665255_157_498 112
700 3300060353 Ga0501082_0004945 Ga0501082_0004945_6002_6343 112
701 3300061719 Ga0466962_0001135 Ga0466962_0001135_9363_9701 112
702 3300061719 Ga0466962_0072567 Ga0466962_0072567_722_1060 112
703 3300061719 Ga0466962_0187136 Ga0466962_0187136_239_580 112
704 3300061734 Ga0530510_0054191 Ga0530510_0054191_1070_1411 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12823

DUF3817

Domain of unknown function (DUF3817)

6

94

0.95

Feature Viewer

pLDDT pTM Quality
58.26 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map