F476364
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 372 | 625 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10197771|Ga0307413_101977712 |
| Length | 110 |
| Sequence | MKSSVLTRYRVMAYVTAVMLLVLCVCMIFKYGFDKGEGLTLVVSQVHGVLYIIYLIFAFDLGSKAKWPFGKLLWVLVSGTIPTAAFFVERKVVREVEPLITDGSPVTAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 7 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 8 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 9 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 10 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 11 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 12 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 13 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 14 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 15 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 16 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 17 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 18 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 19 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 20 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 21 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 22 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 23 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 24 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 25 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 26 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 27 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 28 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 29 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 30 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 31 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 32 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 33 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 34 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 35 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 36 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 37 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 38 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 39 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 40 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 41 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 42 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 43 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 44 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 45 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 46 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 47 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 48 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 49 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 50 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 51 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 52 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 53 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 54 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 55 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 56 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 57 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 58 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 59 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 60 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 61 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 62 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 63 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 64 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 65 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 66 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 67 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 68 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 69 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 70 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 71 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 72 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 73 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 74 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 131 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 133 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 138 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 139 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 142 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 146 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 153 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 154 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 157 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 158 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 159 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 162 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 163 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 164 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 165 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 166 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 167 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 168 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 169 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 170 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 171 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 172 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 173 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 174 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 323 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 329 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 330 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 332 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 335 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 336 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 337 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 338 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 339 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 341 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 342 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 343 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 347 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 349 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 351 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 352 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 358 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 359 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 360 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 361 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 362 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 363 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 364 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 365 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 366 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 367 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 368 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 369 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 370 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 371 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 372 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.35 |
| Metatranscriptomes | 0.28 |
| Isolates | 11.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.67 |
| Nodule | 0.43 |
| Rhizoplane | 1.14 |
| Rhizosphere | 80.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10015480 | 3300001989 | Bacteria | 2772 |
| 2 | JGI24737J22298_10047793 | 3300001990 | Bacteria | 1304 |
| 3 | JGI24735J21928_10030103 | 3300002067 | Bacteria | 1613 |
| 4 | JGI24738J21930_10098346 | 3300002075 | Bacteria | 623 |
| 5 | rootH1_10016340 | 3300003316 | Bacteria | 8453 |
| 6 | rootH1_10016340 | 3300003323 | Bacteria | 11100 |
| 7 | rootH2_10108408 | 3300003320 | Bacteria | 5563 |
| 8 | rootL2_10011295 | 3300003322 | Bacteria | 4559 |
| 9 | rootH1_10003211 | 3300003323 | Bacteria | 1150 |
| 10 | rootH1_10025281 | 3300003323 | Bacteria | 8817 |
| 11 | rootH1_10025282 | 3300003323 | Bacteria | 4240 |
| 12 | JGI25160J50197_1011015 | 3300003354 | Bacteria | 3234 |
| 13 | JGI25160J50197_1011075 | 3300003354 | Bacteria | 3220 |
| 14 | Ga0006562J51391_1157409 | 3300003578 | Bacteria | 5811 |
| 15 | Ga0006562J51391_1157410 | 3300003578 | Bacteria | 5640 |
| 16 | Ga0070711_101434341 | 3300005439 | Bacteria | 601 |
| 17 | Ga0070698_101222930 | 3300005471 | Bacteria | 701 |
| 18 | Ga0068853_100054136 | 3300005539 | Bacteria | 3458 |
| 19 | Ga0070672_101240266 | 3300005543 | Bacteria | 665 |
| 20 | Ga0070665_102167319 | 3300005548 | Bacteria | 560 |
| 21 | Ga0068856_100223398 | 3300005614 | Bacteria | 1899 |
| 22 | Ga0068852_102419579 | 3300005616 | Bacteria | 546 |
| 23 | Ga0068858_101722765 | 3300005842 | Bacteria | 619 |
| 24 | Ga0081455_10100897 | 3300005937 | Bacteria | 2318 |
| 25 | Ga0075365_10147713 | 3300006038 | Bacteria | 1634 |
| 26 | Ga0075368_10050013 | 3300006042 | Bacteria | 1659 |
| 27 | Ga0075363_100693062 | 3300006048 | Bacteria | 615 |
| 28 | Ga0075367_10001932 | 3300006178 | Bacteria | 9195 |
| 29 | Ga0075370_10530982 | 3300006353 | Bacteria | 711 |
| 30 | Ga0105251_10013900 | 3300009011 | Bacteria | 4477 |
| 31 | Ga0105244_10078114 | 3300009036 | Bacteria | 1641 |
| 32 | Ga0105250_10032581 | 3300009092 | Bacteria | 2093 |
| 33 | Ga0105245_10214889 | 3300009098 | Bacteria | 1852 |
| 34 | Ga0105247_10156622 | 3300009101 | Bacteria | 1505 |
| 35 | Ga0105243_10154889 | 3300009148 | Bacteria | 1970 |
| 36 | Ga0105238_10203850 | 3300009551 | Bacteria | 1954 |
| 37 | Ga0105238_10477877 | 3300009551 | Bacteria | 1245 |
| 38 | Ga0105238_11100643 | 3300009551 | Bacteria | 817 |
| 39 | Ga0105249_10728011 | 3300009553 | Bacteria | 1053 |
| 40 | Ga0105239_10510121 | 3300010375 | Bacteria | 1368 |
| 41 | Ga0105239_10580632 | 3300010375 | Bacteria | 1278 |
| 42 | Ga0105239_11605999 | 3300010375 | Bacteria | 752 |
| 43 | Ga0105246_10088014 | 3300011119 | Bacteria | 2230 |
| 44 | Ga0105246_11043860 | 3300011119 | Bacteria | 743 |
| 45 | Ga0157369_10170298 | 3300013105 | Bacteria | 2295 |
| 46 | Ga0163162_12525273 | 3300013306 | Bacteria | 591 |
| 47 | Ga0157372_10498816 | 3300013307 | Bacteria | 1419 |
| 48 | Ga0157375_10442088 | 3300013308 | Bacteria | 1466 |
| 49 | Ga0182008_10001944 | 3300014497 | Bacteria | 13339 |
| 50 | Ga0157376_11137994 | 3300014969 | Bacteria | 807 |
| 51 | Ga0182006_1037051 | 3300015261 | Bacteria | 1936 |
| 52 | Ga0182007_10001129 | 3300015262 | Bacteria | 14468 |
| 53 | Ga0182005_1074634 | 3300015265 | Bacteria | 933 |
| 54 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 55 | Ga0213875_10003336 | 3300021388 | Bacteria | 9163 |
| 56 | Ga0207426_1001554 | 3300025302 | Bacteria | 18646 |
| 57 | Ga0207426_1002336 | 3300025302 | Bacteria | 12383 |
| 58 | Ga0207426_1027307 | 3300025302 | Bacteria | 1902 |
| 59 | Ga0207426_1033574 | 3300025302 | Bacteria | 1653 |
| 60 | Ga0209051_1106818 | 3300025303 | Bacteria | 739 |
| 61 | Ga0207713_1064791 | 3300025735 | Bacteria | 1374 |
| 62 | Ga0207647_10007368 | 3300025904 | Bacteria | 7953 |
| 63 | Ga0207694_10193779 | 3300025924 | Bacteria | 1652 |
| 64 | Ga0207687_10366757 | 3300025927 | Bacteria | 1177 |
| 65 | Ga0207686_11158651 | 3300025934 | Bacteria | 632 |
| 66 | Ga0207709_10023263 | 3300025935 | Bacteria | 3525 |
| 67 | Ga0207691_10235481 | 3300025940 | Bacteria | 1584 |
| 68 | Ga0207691_10439237 | 3300025940 | Bacteria | 1111 |
| 69 | Ga0207661_10138649 | 3300025944 | Bacteria | 2091 |
| 70 | Ga0207712_10947704 | 3300025961 | Bacteria | 762 |
| 71 | Ga0207640_10395393 | 3300025981 | Bacteria | 1124 |
| 72 | Ga0207703_11564188 | 3300026035 | Bacteria | 634 |
| 73 | Ga0207639_12114117 | 3300026041 | Bacteria | 524 |
| 74 | Ga0207702_10686557 | 3300026078 | Bacteria | 1008 |
| 75 | Ga0207674_10613722 | 3300026116 | Bacteria | 1050 |
| 76 | Ga0209371_1021550 | 3300027312 | Bacteria | 1559 |
| 77 | Ga0209371_1087523 | 3300027312 | Bacteria | 529 |
| 78 | Ga0209813_10027210 | 3300027866 | Bacteria | 1659 |
| 79 | Ga0268266_11715056 | 3300028379 | Bacteria | 603 |
| 80 | Ga0307515_10000813 | 3300028794 | Bacteria | 71821 |
| 81 | Ga0307515_10109395 | 3300028794 | Bacteria | 3246 |
| 82 | Ga0268256_1024205 | 3300030500 | Bacteria | 1562 |
| 83 | Ga0268256_1046663 | 3300030500 | Bacteria | 937 |
| 84 | Ga0307511_10051211 | 3300030521 | Bacteria | 3314 |
| 85 | Ga0307511_10118501 | 3300030521 | Bacteria | 1649 |
| 86 | Ga0307512_10051020 | 3300030522 | Bacteria | 3315 |
| 87 | Ga0307512_10070649 | 3300030522 | Bacteria | 2598 |
| 88 | Ga0307512_10091748 | 3300030522 | Bacteria | 2111 |
| 89 | Ga0307513_10017828 | 3300031456 | Bacteria | 8505 |
| 90 | Ga0307513_10028725 | 3300031456 | Bacteria | 6353 |
| 91 | Ga0307509_10016921 | 3300031507 | Bacteria | 8410 |
| 92 | Ga0307509_10116000 | 3300031507 | Bacteria | 2668 |
| 93 | Ga0307408_100962615 | 3300031548 | Bacteria | 785 |
| 94 | Ga0307508_10005950 | 3300031616 | Bacteria | 11506 |
| 95 | Ga0307508_10034247 | 3300031616 | Bacteria | 4579 |
| 96 | Ga0307508_10132356 | 3300031616 | Bacteria | 2097 |
| 97 | Ga0307514_10053823 | 3300031649 | Bacteria | 3103 |
| 98 | Ga0307514_10060014 | 3300031649 | Bacteria | 2903 |
| 99 | Ga0307514_10115022 | 3300031649 | Bacteria | 1895 |
| 100 | Ga0307516_10001694 | 3300031730 | Bacteria | 30318 |
| 101 | Ga0307516_10049439 | 3300031730 | Bacteria | 4132 |
| 102 | Ga0307516_10093686 | 3300031730 | Bacteria | 2829 |
| 103 | Ga0307516_10634288 | 3300031730 | Bacteria | 723 |
| 104 | Ga0307413_10197771 | 3300031824 | Bacteria | 1449 |
| 105 | Ga0307518_10100969 | 3300031838 | Bacteria | 2065 |
| 106 | Ga0307410_10242895 | 3300031852 | Bacteria | 1396 |
| 107 | Ga0307416_101014213 | 3300032002 | Bacteria | 933 |
| 108 | Ga0307416_102314849 | 3300032002 | Bacteria | 637 |
| 109 | Ga0307415_100937274 | 3300032126 | Bacteria | 801 |
| 110 | Ga0307507_10011491 | 3300033179 | Bacteria | 11153 |
| 111 | Ga0307507_10141433 | 3300033179 | Bacteria | 1844 |
| 112 | Ga0307507_10274813 | 3300033179 | Bacteria | 1060 |
| 113 | Ga0307510_10027859 | 3300033180 | Bacteria | 6463 |
| 114 | Ga0307510_10203628 | 3300033180 | Bacteria | 1510 |
| 115 | Ga0307510_10255793 | 3300033180 | Bacteria | 1235 |
| 116 | Ga0395900_0251801 | 3300037418 | Bacteria | 1767 |
| 117 | Ga0395898_0014941 | 3300037466 | Bacteria | 7972 |
| 118 | Ga0395898_0552728 | 3300037466 | Bacteria | 1093 |
| 119 | Ga0395898_1485671 | 3300037466 | Bacteria | 604 |
| 120 | Ga0395905_0113761 | 3300037471 | Bacteria | 2543 |
| 121 | Ga0436364_0894301 | 3300037853 | Bacteria | 12265 |
| 122 | Ga0395901_0004321 | 3300038443 | Bacteria | 14345 |
| 123 | Ga0439436_0000864 | 3300041404 | Bacteria | 8271 |
| 124 | Ga0439436_0019699 | 3300041404 | Bacteria | 2012 |
| 125 | Ga0439439_0001188 | 3300041406 | Bacteria | 5026 |
| 126 | Ga0439439_0017456 | 3300041406 | Bacteria | 1764 |
| 127 | Ga0439439_0079580 | 3300041406 | Bacteria | 885 |
| 128 | Ga0451795_1596757 | 3300041456 | Bacteria | 1125 |
| 129 | Ga0451807_1292668 | 3300041486 | Bacteria | 750 |
| 130 | Ga0451833_1452990 | 3300041491 | Bacteria | 669 |
| 131 | Ga0451835_0932778 | 3300041492 | Bacteria | 1081 |
| 132 | Ga0451837_0652012 | 3300041494 | Bacteria | 5344 |
| 133 | Ga0451839_0729921 | 3300041496 | Bacteria | 549 |
| 134 | Ga0451853_0696848 | 3300041512 | Bacteria | 3054 |
| 135 | Ga0451853_3795338 | 3300041512 | Bacteria | 3707 |
| 136 | Ga0439448_0002802 | 3300042005 | Bacteria | 4774 |
| 137 | Ga0439448_0022472 | 3300042005 | Bacteria | 1961 |
| 138 | Ga0439449_0009106 | 3300042007 | Bacteria | 3765 |
| 139 | Ga0439449_0027188 | 3300042007 | Bacteria | 2135 |
| 140 | Ga0439449_0245857 | 3300042007 | Bacteria | 672 |
| 141 | Ga0439450_021872 | 3300042008 | Bacteria | 1377 |
| 142 | Ga0439455_0007163 | 3300042012 | Bacteria | 2350 |
| 143 | Ga0439455_0127537 | 3300042012 | Bacteria | 716 |
| 144 | Ga0439457_000919 | 3300042014 | Bacteria | 8873 |
| 145 | Ga0439457_034554 | 3300042014 | Bacteria | 1123 |
| 146 | Ga0439462_0006442 | 3300042015 | Bacteria | 2917 |
| 147 | Ga0450890_006905 | 3300042127 | Bacteria | 1447 |
| 148 | Ga0450894_000089 | 3300042131 | Bacteria | 15201 |
| 149 | Ga0450898_000428 | 3300042134 | Bacteria | 4890 |
| 150 | Ga0450898_036956 | 3300042134 | Bacteria | 914 |
| 151 | Ga0450899_000458 | 3300042135 | Bacteria | 4578 |
| 152 | Ga0450902_073162 | 3300042137 | Bacteria | 599 |
| 153 | Ga0450903_000025 | 3300042138 | Bacteria | 29994 |
| 154 | Ga0450906_000226 | 3300042145 | Bacteria | 10823 |
| 155 | Ga0439458_0000750 | 3300042157 | Bacteria | 8302 |
| 156 | Ga0466969_0157280 | 3300044656 | Bacteria | 1045 |
| 157 | Ga0466972_0002962 | 3300044658 | Bacteria | 8405 |
| 158 | Ga0466972_0004174 | 3300044658 | Bacteria | 7214 |
| 159 | Ga0466972_0007163 | 3300044658 | Bacteria | 5600 |
| 160 | Ga0466972_0122071 | 3300044658 | Bacteria | 1228 |
| 161 | Ga0466965_0077772 | 3300044683 | Bacteria | 1675 |
| 162 | Ga0466965_0905607 | 3300044683 | Bacteria | 515 |
| 163 | Ga0466966_0006232 | 3300044684 | Bacteria | 7887 |
| 164 | Ga0466966_0020981 | 3300044684 | Bacteria | 4293 |
| 165 | Ga0466966_0616634 | 3300044684 | Bacteria | 653 |
| 166 | Ga0466961_0003621 | 3300044693 | Bacteria | 9622 |
| 167 | Ga0466961_0020002 | 3300044693 | Bacteria | 4307 |
| 168 | Ga0466961_0045500 | 3300044693 | Bacteria | 2808 |
| 169 | Ga0466961_0243983 | 3300044693 | Bacteria | 1104 |
| 170 | Ga0466961_0638181 | 3300044693 | Bacteria | 639 |
| 171 | Ga0466963_0012012 | 3300044694 | Bacteria | 5289 |
| 172 | Ga0466963_0634558 | 3300044694 | Bacteria | 754 |
| 173 | Ga0466964_0004533 | 3300044706 | Bacteria | 5130 |
| 174 | Ga0466964_0066014 | 3300044706 | Bacteria | 1518 |
| 175 | Ga0466971_0023423 | 3300044719 | Bacteria | 2752 |
| 176 | Ga0466971_0077987 | 3300044719 | Bacteria | 1509 |
| 177 | Ga0466968_0027810 | 3300044735 | Bacteria | 2328 |
| 178 | Ga0466968_0039702 | 3300044735 | Bacteria | 1982 |
| 179 | Ga0466970_0001226 | 3300044765 | Bacteria | 12417 |
| 180 | Ga0466970_0004495 | 3300044765 | Bacteria | 6875 |
| 181 | Ga0466970_0093768 | 3300044765 | Bacteria | 1631 |
| 182 | Ga0466970_0383813 | 3300044765 | Bacteria | 800 |
| 183 | Ga0466957_0002870 | 3300044842 | Bacteria | 9335 |
| 184 | Ga0466957_0221321 | 3300044842 | Bacteria | 1250 |
| 185 | Ga0466960_0021297 | 3300044901 | Bacteria | 2884 |
| 186 | Ga0466959_0003319 | 3300045049 | Bacteria | 10505 |
| 187 | Ga0466959_0892016 | 3300045049 | Bacteria | 593 |
| 188 | Ga0466958_0004341 | 3300045836 | Bacteria | 7471 |
| 189 | Ga0466958_0257236 | 3300045836 | Bacteria | 1117 |
| 190 | Ga0466967_0001968 | 3300045976 | Bacteria | 12446 |
| 191 | Ga0466967_0090406 | 3300045976 | Bacteria | 2781 |
| 192 | Ga0466967_0142885 | 3300045976 | Bacteria | 2230 |
| 193 | Ga0466967_0267553 | 3300045976 | Bacteria | 1637 |
| 194 | Ga0466967_0444308 | 3300045976 | Bacteria | 1267 |
| 195 | Ga0466967_0693257 | 3300045976 | Bacteria | 1008 |
| 196 | Ga0495617_067526 | 3300046452 | Bacteria | 1177 |
| 197 | Ga0495617_153465 | 3300046452 | Bacteria | 732 |
| 198 | Ga0495627_044652 | 3300046453 | Bacteria | 1352 |
| 199 | Ga0495592_0002770 | 3300046454 | Bacteria | 12421 |
| 200 | Ga0495592_0033022 | 3300046454 | Bacteria | 3905 |
| 201 | Ga0495592_0080563 | 3300046454 | Bacteria | 2355 |
| 202 | Ga0495603_0001170 | 3300046455 | Bacteria | 15283 |
| 203 | Ga0495603_0001759 | 3300046455 | Bacteria | 12757 |
| 204 | Ga0495603_0012358 | 3300046455 | Bacteria | 5170 |
| 205 | Ga0495603_0022648 | 3300046455 | Bacteria | 3801 |
| 206 | Ga0495603_0042651 | 3300046455 | Bacteria | 2711 |
| 207 | Ga0495603_0043852 | 3300046455 | Bacteria | 2669 |
| 208 | Ga0495603_0418772 | 3300046455 | Bacteria | 767 |
| 209 | Ga0495590_0217666 | 3300046457 | Bacteria | 705 |
| 210 | Ga0495629_0001224 | 3300046459 | Bacteria | 20148 |
| 211 | Ga0495629_0008001 | 3300046459 | Bacteria | 7779 |
| 212 | Ga0495629_0011473 | 3300046459 | Bacteria | 6436 |
| 213 | Ga0495629_0012969 | 3300046459 | Bacteria | 6027 |
| 214 | Ga0495629_0016650 | 3300046459 | Bacteria | 5276 |
| 215 | Ga0495629_0023384 | 3300046459 | Bacteria | 4404 |
| 216 | Ga0495629_0044605 | 3300046459 | Bacteria | 3111 |
| 217 | Ga0495629_0426537 | 3300046459 | Bacteria | 899 |
| 218 | Ga0495629_0543301 | 3300046459 | Bacteria | 780 |
| 219 | Ga0495629_0789378 | 3300046459 | Bacteria | 627 |
| 220 | Ga0495638_0082604 | 3300046460 | Bacteria | 1948 |
| 221 | Ga0495638_0149916 | 3300046460 | Bacteria | 1353 |
| 222 | Ga0495638_0152079 | 3300046460 | Bacteria | 1342 |
| 223 | Ga0495638_0196277 | 3300046460 | Bacteria | 1142 |
| 224 | Ga0495638_0271331 | 3300046460 | Bacteria | 926 |
| 225 | Ga0495651_0001653 | 3300046462 | Bacteria | 17272 |
| 226 | Ga0495651_0005532 | 3300046462 | Bacteria | 9635 |
| 227 | Ga0495651_0051354 | 3300046462 | Bacteria | 3179 |
| 228 | Ga0495653_0146595 | 3300046463 | Bacteria | 1653 |
| 229 | Ga0495580_0139522 | 3300046472 | Bacteria | 1680 |
| 230 | Ga0495582_0017157 | 3300046473 | Bacteria | 3962 |
| 231 | Ga0495582_0122037 | 3300046473 | Bacteria | 1469 |
| 232 | Ga0495582_0311540 | 3300046473 | Bacteria | 905 |
| 233 | Ga0495605_0031015 | 3300046474 | Bacteria | 2733 |
| 234 | Ga0495639_0064589 | 3300046475 | Bacteria | 1682 |
| 235 | Ga0495639_0247075 | 3300046475 | Bacteria | 882 |
| 236 | Ga0495662_0003171 | 3300046476 | Bacteria | 8304 |
| 237 | Ga0495662_0019058 | 3300046476 | Bacteria | 3320 |
| 238 | Ga0495662_0143790 | 3300046476 | Bacteria | 1174 |
| 239 | Ga0495662_0233158 | 3300046476 | Bacteria | 907 |
| 240 | Ga0495662_0567010 | 3300046476 | Bacteria | 556 |
| 241 | Ga0495664_0000282 | 3300046477 | Bacteria | 24266 |
| 242 | Ga0495664_0053517 | 3300046477 | Bacteria | 2400 |
| 243 | Ga0495664_0075260 | 3300046477 | Bacteria | 2020 |
| 244 | Ga0495584_0181036 | 3300046491 | Bacteria | 1071 |
| 245 | Ga0495585_0035662 | 3300046492 | Bacteria | 2809 |
| 246 | Ga0495585_0054957 | 3300046492 | Bacteria | 2201 |
| 247 | Ga0495585_0111160 | 3300046492 | Bacteria | 1457 |
| 248 | Ga0495585_0210924 | 3300046492 | Bacteria | 984 |
| 249 | Ga0495585_0474836 | 3300046492 | Bacteria | 596 |
| 250 | Ga0495585_0480161 | 3300046492 | Bacteria | 592 |
| 251 | Ga0495594_0011637 | 3300046499 | Bacteria | 4575 |
| 252 | Ga0495594_0032639 | 3300046499 | Bacteria | 2827 |
| 253 | Ga0495594_0117308 | 3300046499 | Bacteria | 1503 |
| 254 | Ga0495594_0219797 | 3300046499 | Bacteria | 1083 |
| 255 | Ga0495594_0371088 | 3300046499 | Bacteria | 814 |
| 256 | Ga0495594_0388072 | 3300046499 | Bacteria | 794 |
| 257 | Ga0495596_0024281 | 3300046500 | Bacteria | 2456 |
| 258 | Ga0495607_0012696 | 3300046501 | Bacteria | 5547 |
| 259 | Ga0495607_0102530 | 3300046501 | Bacteria | 1530 |
| 260 | Ga0495606_0064381 | 3300046507 | Bacteria | 2333 |
| 261 | Ga0495610_0054597 | 3300046512 | Bacteria | 1929 |
| 262 | Ga0495610_0259406 | 3300046512 | Bacteria | 685 |
| 263 | Ga0495616_0006140 | 3300046513 | Bacteria | 7315 |
| 264 | Ga0495618_0025172 | 3300046514 | Bacteria | 3692 |
| 265 | Ga0495618_0031655 | 3300046514 | Bacteria | 3310 |
| 266 | Ga0495618_0127295 | 3300046514 | Bacteria | 1630 |
| 267 | Ga0495620_0085339 | 3300046515 | Bacteria | 1272 |
| 268 | Ga0495620_0161817 | 3300046515 | Bacteria | 869 |
| 269 | Ga0495628_0022296 | 3300046516 | Bacteria | 5203 |
| 270 | Ga0495628_0023269 | 3300046516 | Bacteria | 5087 |
| 271 | Ga0495628_0167442 | 3300046516 | Bacteria | 1667 |
| 272 | Ga0495630_0025860 | 3300046517 | Bacteria | 4343 |
| 273 | Ga0495631_0018251 | 3300046518 | Bacteria | 3305 |
| 274 | Ga0495631_0034970 | 3300046518 | Bacteria | 2250 |
| 275 | Ga0495631_0234821 | 3300046518 | Bacteria | 782 |
| 276 | Ga0495632_0195749 | 3300046519 | Bacteria | 922 |
| 277 | Ga0495637_0120558 | 3300046520 | Bacteria | 1009 |
| 278 | Ga0495643_0001554 | 3300046522 | Bacteria | 20479 |
| 279 | Ga0495643_0015860 | 3300046522 | Bacteria | 4438 |
| 280 | Ga0495643_0217214 | 3300046522 | Bacteria | 909 |
| 281 | Ga0495644_0032456 | 3300046523 | Bacteria | 1973 |
| 282 | Ga0495644_0232160 | 3300046523 | Bacteria | 714 |
| 283 | Ga0495648_0078644 | 3300046524 | Bacteria | 1885 |
| 284 | Ga0495666_0048633 | 3300046526 | Bacteria | 2042 |
| 285 | Ga0495666_0412287 | 3300046526 | Bacteria | 606 |
| 286 | Ga0495642_0129576 | 3300046528 | Bacteria | 1085 |
| 287 | Ga0495652_0028026 | 3300046529 | Bacteria | 4960 |
| 288 | Ga0495652_0158430 | 3300046529 | Bacteria | 1760 |
| 289 | Ga0495654_0042557 | 3300046530 | Bacteria | 2254 |
| 290 | Ga0495640_0013523 | 3300046533 | Bacteria | 6204 |
| 291 | Ga0495640_0030666 | 3300046533 | Bacteria | 3847 |
| 292 | Ga0495640_0030868 | 3300046533 | Bacteria | 3832 |
| 293 | Ga0495640_0150123 | 3300046533 | Bacteria | 1498 |
| 294 | Ga0495586_0027579 | 3300046535 | Bacteria | 3038 |
| 295 | Ga0495587_0029688 | 3300046536 | Bacteria | 3318 |
| 296 | Ga0495587_0093009 | 3300046536 | Bacteria | 1741 |
| 297 | Ga0495609_0032050 | 3300046538 | Bacteria | 2388 |
| 298 | Ga0495597_0202467 | 3300046542 | Bacteria | 794 |
| 299 | Ga0495645_0007346 | 3300046543 | Bacteria | 7666 |
| 300 | Ga0495645_0412377 | 3300046543 | Bacteria | 859 |
| 301 | Ga0495622_0012385 | 3300046557 | Bacteria | 3948 |
| 302 | Ga0495622_0130595 | 3300046557 | Bacteria | 1144 |
| 303 | Ga0495633_0018654 | 3300046558 | Bacteria | 3520 |
| 304 | Ga0495633_0330178 | 3300046558 | Bacteria | 692 |
| 305 | Ga0495667_0074258 | 3300046559 | Bacteria | 2214 |
| 306 | Ga0495656_0042215 | 3300046615 | Bacteria | 1909 |
| 307 | Ga0495668_0070198 | 3300046616 | Bacteria | 1925 |
| 308 | Ga0495634_0004963 | 3300046642 | Bacteria | 10282 |
| 309 | Ga0495634_0006932 | 3300046642 | Bacteria | 8559 |
| 310 | Ga0495634_0394030 | 3300046642 | Bacteria | 823 |
| 311 | Ga0495611_0031653 | 3300046648 | Bacteria | 2329 |
| 312 | Ga0495611_0036080 | 3300046648 | Bacteria | 2192 |
| 313 | Ga0495611_0049366 | 3300046648 | Bacteria | 1893 |
| 314 | Ga0495611_0269004 | 3300046648 | Bacteria | 788 |
| 315 | Ga0495611_0279660 | 3300046648 | Bacteria | 771 |
| 316 | Ga0495625_0016470 | 3300046660 | Bacteria | 5817 |
| 317 | Ga0495625_0020466 | 3300046660 | Bacteria | 5108 |
| 318 | Ga0495625_0121946 | 3300046660 | Bacteria | 1773 |
| 319 | Ga0495625_0220917 | 3300046660 | Bacteria | 1242 |
| 320 | Ga0495635_0000593 | 3300046663 | Bacteria | 23305 |
| 321 | Ga0495635_0062632 | 3300046663 | Bacteria | 2554 |
| 322 | Ga0495659_0071711 | 3300046664 | Bacteria | 1299 |
| 323 | Ga0495661_0133290 | 3300046665 | Bacteria | 1359 |
| 324 | Ga0495588_0006697 | 3300046674 | Bacteria | 5204 |
| 325 | Ga0495588_0009714 | 3300046674 | Bacteria | 4458 |
| 326 | Ga0495588_0029177 | 3300046674 | Bacteria | 2766 |
| 327 | Ga0495588_0115849 | 3300046674 | Bacteria | 1412 |
| 328 | Ga0495588_0218376 | 3300046674 | Bacteria | 1006 |
| 329 | Ga0495588_0710693 | 3300046674 | Bacteria | 525 |
| 330 | Ga0495657_0002382 | 3300046675 | Bacteria | 15814 |
| 331 | Ga0495657_0004529 | 3300046675 | Bacteria | 11116 |
| 332 | Ga0495657_0019119 | 3300046675 | Bacteria | 4946 |
| 333 | Ga0495657_0134556 | 3300046675 | Bacteria | 1545 |
| 334 | Ga0495599_0075685 | 3300046678 | Bacteria | 2102 |
| 335 | Ga0495623_0049744 | 3300046679 | Bacteria | 2656 |
| 336 | Ga0495646_0002399 | 3300046680 | Bacteria | 11495 |
| 337 | Ga0495646_0053865 | 3300046680 | Bacteria | 2423 |
| 338 | Ga0495647_0157000 | 3300046681 | Bacteria | 978 |
| 339 | Ga0495658_0020193 | 3300046683 | Bacteria | 3492 |
| 340 | Ga0495658_0064135 | 3300046683 | Bacteria | 2116 |
| 341 | Ga0495613_0007902 | 3300046689 | Bacteria | 7912 |
| 342 | Ga0495613_0014939 | 3300046689 | Bacteria | 5762 |
| 343 | Ga0495613_0026062 | 3300046689 | Bacteria | 4356 |
| 344 | Ga0495613_0218330 | 3300046689 | Bacteria | 1339 |
| 345 | Ga0495613_0333107 | 3300046689 | Bacteria | 1046 |
| 346 | Ga0495613_0457863 | 3300046689 | Bacteria | 863 |
| 347 | Ga0495613_0470347 | 3300046689 | Bacteria | 849 |
| 348 | Ga0495624_0021164 | 3300046690 | Bacteria | 4317 |
| 349 | Ga0495624_0063478 | 3300046690 | Bacteria | 2309 |
| 350 | Ga0495624_0324856 | 3300046690 | Bacteria | 926 |
| 351 | Ga0495624_0391535 | 3300046690 | Bacteria | 834 |
| 352 | Ga0495670_0021308 | 3300046691 | Bacteria | 3196 |
| 353 | Ga0495670_0021532 | 3300046691 | Bacteria | 3180 |
| 354 | Ga0495670_0132012 | 3300046691 | Bacteria | 1302 |
| 355 | Ga0495670_0338762 | 3300046691 | Bacteria | 809 |
| 356 | Ga0495671_0007806 | 3300046692 | Bacteria | 6057 |
| 357 | Ga0495671_0076828 | 3300046692 | Bacteria | 1637 |
| 358 | Ga0495649_0085127 | 3300046694 | Bacteria | 1688 |
| 359 | Ga0495649_0138439 | 3300046694 | Bacteria | 1282 |
| 360 | Ga0495649_0282398 | 3300046694 | Bacteria | 848 |
| 361 | Ga0495589_0018231 | 3300046794 | Bacteria | 3601 |
| 362 | Ga0495589_0024586 | 3300046794 | Bacteria | 3061 |
| 363 | Ga0495589_0059042 | 3300046794 | Bacteria | 1886 |
| 364 | Ga0495589_0078783 | 3300046794 | Bacteria | 1604 |
| 365 | Ga0495589_0096008 | 3300046794 | Bacteria | 1437 |
| 366 | Ga0495589_0098553 | 3300046794 | Bacteria | 1415 |
| 367 | Ga0495589_0103568 | 3300046794 | Bacteria | 1376 |
| 368 | Ga0495589_0129480 | 3300046794 | Bacteria | 1212 |
| 369 | Ga0495589_0147737 | 3300046794 | Bacteria | 1123 |
| 370 | Ga0495600_0004771 | 3300046809 | Bacteria | 8135 |
| 371 | Ga0495600_0006332 | 3300046809 | Bacteria | 7196 |
| 372 | Ga0495600_0099347 | 3300046809 | Bacteria | 1897 |
| 373 | Ga0495600_0549801 | 3300046809 | Bacteria | 705 |
| 374 | Ga0495660_0048366 | 3300046810 | Bacteria | 2325 |
| 375 | Ga0495660_0050486 | 3300046810 | Bacteria | 2266 |
| 376 | Ga0495581_0004318 | 3300047315 | Bacteria | 8203 |
| 377 | Ga0495581_0028125 | 3300047315 | Bacteria | 3259 |
| 378 | Ga0495581_0063633 | 3300047315 | Bacteria | 2131 |
| 379 | Ga0495581_0163597 | 3300047315 | Bacteria | 1301 |
| 380 | Ga0495581_0750475 | 3300047315 | Bacteria | 561 |
| 381 | Ga0495604_0006494 | 3300047317 | Bacteria | 9269 |
| 382 | Ga0495604_0058030 | 3300047317 | Bacteria | 2973 |
| 383 | Ga0495604_0100593 | 3300047317 | Bacteria | 2125 |
| 384 | Ga0495604_0601304 | 3300047317 | Bacteria | 705 |
| 385 | Ga0495636_0006423 | 3300047318 | Bacteria | 4619 |
| 386 | Ga0495636_0025732 | 3300047318 | Bacteria | 2390 |
| 387 | Ga0495636_0036470 | 3300047318 | Bacteria | 2028 |
| 388 | Ga0495636_0259354 | 3300047318 | Bacteria | 805 |
| 389 | Ga0495636_0266988 | 3300047318 | Bacteria | 794 |
| 390 | Ga0495636_0503794 | 3300047318 | Bacteria | 585 |
| 391 | Ga0495636_0506286 | 3300047318 | Bacteria | 584 |
| 392 | Ga0495674_0122442 | 3300047319 | Bacteria | 2196 |
| 393 | Ga0495674_0640258 | 3300047319 | Bacteria | 839 |
| 394 | Ga0495672_0096584 | 3300047320 | Bacteria | 1611 |
| 395 | Ga0495676_0002667 | 3300047321 | Bacteria | 15977 |
| 396 | Ga0495676_0008638 | 3300047321 | Bacteria | 9326 |
| 397 | Ga0495676_0009294 | 3300047321 | Bacteria | 8958 |
| 398 | Ga0495676_0011467 | 3300047321 | Bacteria | 8001 |
| 399 | Ga0495676_0016059 | 3300047321 | Bacteria | 6651 |
| 400 | Ga0495676_0138022 | 3300047321 | Bacteria | 1750 |
| 401 | Ga0495676_0140335 | 3300047321 | Bacteria | 1732 |
| 402 | Ga0495676_0277945 | 3300047321 | Bacteria | 1134 |
| 403 | Ga0495676_0696327 | 3300047321 | Bacteria | 657 |
| 404 | Ga0495680_0001987 | 3300047322 | Bacteria | 21488 |
| 405 | Ga0495680_0347016 | 3300047322 | Bacteria | 1034 |
| 406 | Ga0495683_0110162 | 3300047323 | Bacteria | 1315 |
| 407 | Ga0495683_0148392 | 3300047323 | Bacteria | 1093 |
| 408 | Ga0495683_0251168 | 3300047323 | Bacteria | 776 |
| 409 | Ga0495683_0448051 | 3300047323 | Bacteria | 530 |
| 410 | Ga0495687_001345 | 3300047443 | Bacteria | 22903 |
| 411 | Ga0495687_008623 | 3300047443 | Bacteria | 5812 |
| 412 | Ga0495687_011944 | 3300047443 | Bacteria | 4632 |
| 413 | Ga0495687_015224 | 3300047443 | Bacteria | 3922 |
| 414 | Ga0495687_113292 | 3300047443 | Bacteria | 992 |
| 415 | Ga0495687_130700 | 3300047443 | Bacteria | 889 |
| 416 | Ga0495675_0002357 | 3300047444 | Bacteria | 11273 |
| 417 | Ga0495675_0083454 | 3300047444 | Bacteria | 2011 |
| 418 | Ga0495675_0086655 | 3300047444 | Bacteria | 1968 |
| 419 | Ga0495677_0021381 | 3300047445 | Bacteria | 2345 |
| 420 | Ga0495685_001961 | 3300047447 | Bacteria | 6385 |
| 421 | Ga0495685_013872 | 3300047447 | Bacteria | 2734 |
| 422 | Ga0495685_014059 | 3300047447 | Bacteria | 2716 |
| 423 | Ga0495685_057575 | 3300047447 | Bacteria | 1312 |
| 424 | Ga0495685_086187 | 3300047447 | Bacteria | 1043 |
| 425 | Ga0495681_0001930 | 3300047470 | Bacteria | 15188 |
| 426 | Ga0495681_0033825 | 3300047470 | Bacteria | 2554 |
| 427 | Ga0495681_0134121 | 3300047470 | Bacteria | 1051 |
| 428 | Ga0495684_0120483 | 3300047471 | Bacteria | 1976 |
| 429 | Ga0495684_0246598 | 3300047471 | Bacteria | 1301 |
| 430 | Ga0495686_0010378 | 3300047472 | Bacteria | 6630 |
| 431 | Ga0495686_0081037 | 3300047472 | Bacteria | 1983 |
| 432 | Ga0495686_0317022 | 3300047472 | Bacteria | 856 |
| 433 | Ga0495593_0001804 | 3300047673 | Bacteria | 12722 |
| 434 | Ga0495593_0172072 | 3300047673 | Bacteria | 1091 |
| 435 | Ga0495593_0285079 | 3300047673 | Bacteria | 826 |
| 436 | Ga0495593_0646397 | 3300047673 | Bacteria | 531 |
| 437 | Ga0495602_0062348 | 3300048088 | Bacteria | 3235 |
| 438 | Ga0495602_0169775 | 3300048088 | Bacteria | 1694 |
| 439 | Ga0495614_0004349 | 3300048089 | Bacteria | 6384 |
| 440 | Ga0495614_0005858 | 3300048089 | Bacteria | 5536 |
| 441 | Ga0495614_0011311 | 3300048089 | Bacteria | 3927 |
| 442 | Ga0495626_0044420 | 3300048091 | Bacteria | 2079 |
| 443 | Ga0496104_1012177 | 3300048907 | Bacteria | 735 |
| 444 | Ga0496106_0109332 | 3300048909 | Bacteria | 2151 |
| 445 | Ga0496108_0331456 | 3300048911 | Bacteria | 1327 |
| 446 | Ga0496109_0099066 | 3300048912 | Bacteria | 2703 |
| 447 | Ga0496110_0450462 | 3300048913 | Bacteria | 1173 |
| 448 | Ga0495678_075067 | 3300049459 | Bacteria | 1228 |
| 449 | Ga0495682_0012475 | 3300049460 | Bacteria | 3258 |
| 450 | Ga0501031_0007853 | 3300049568 | Bacteria | 6944 |
| 451 | Ga0501031_0095748 | 3300049568 | Bacteria | 1937 |
| 452 | Ga0501031_0150708 | 3300049568 | Bacteria | 1519 |
| 453 | Ga0501031_0169824 | 3300049568 | Bacteria | 1425 |
| 454 | Ga0501032_0012081 | 3300049569 | Bacteria | 6183 |
| 455 | Ga0501032_0021673 | 3300049569 | Bacteria | 4465 |
| 456 | Ga0501032_0088534 | 3300049569 | Bacteria | 2055 |
| 457 | Ga0501032_0089925 | 3300049569 | Bacteria | 2038 |
| 458 | Ga0501032_0109615 | 3300049569 | Bacteria | 1827 |
| 459 | Ga0501032_0140874 | 3300049569 | Bacteria | 1588 |
| 460 | Ga0501033_0001721 | 3300049570 | Bacteria | 19146 |
| 461 | Ga0501033_0005963 | 3300049570 | Bacteria | 9565 |
| 462 | Ga0501033_0011432 | 3300049570 | Bacteria | 6794 |
| 463 | Ga0501033_0033426 | 3300049570 | Bacteria | 3860 |
| 464 | Ga0501033_0101712 | 3300049570 | Bacteria | 2096 |
| 465 | Ga0501033_0174662 | 3300049570 | Bacteria | 1542 |
| 466 | Ga0501033_0362309 | 3300049570 | Bacteria | 1014 |
| 467 | Ga0501034_0006924 | 3300049571 | Bacteria | 12115 |
| 468 | Ga0501034_0013110 | 3300049571 | Bacteria | 8541 |
| 469 | Ga0501034_0015840 | 3300049571 | Bacteria | 7742 |
| 470 | Ga0501034_0021973 | 3300049571 | Bacteria | 6501 |
| 471 | Ga0501034_0031442 | 3300049571 | Bacteria | 5390 |
| 472 | Ga0501034_0049592 | 3300049571 | Bacteria | 4236 |
| 473 | Ga0501034_0226451 | 3300049571 | Bacteria | 1820 |
| 474 | Ga0501036_0006789 | 3300049572 | Bacteria | 9298 |
| 475 | Ga0501036_0011358 | 3300049572 | Bacteria | 7371 |
| 476 | Ga0501036_0033288 | 3300049572 | Bacteria | 4358 |
| 477 | Ga0501036_0044024 | 3300049572 | Bacteria | 3780 |
| 478 | Ga0501036_0046619 | 3300049572 | Bacteria | 3670 |
| 479 | Ga0501036_0074787 | 3300049572 | Bacteria | 2865 |
| 480 | Ga0501036_1162365 | 3300049572 | Bacteria | 629 |
| 481 | Ga0501037_0000724 | 3300049573 | Bacteria | 24999 |
| 482 | Ga0501037_0020484 | 3300049573 | Bacteria | 4883 |
| 483 | Ga0501037_0227667 | 3300049573 | Bacteria | 1310 |
| 484 | Ga0501037_0514403 | 3300049573 | Bacteria | 811 |
| 485 | Ga0501037_0597556 | 3300049573 | Bacteria | 741 |
| 486 | Ga0501038_0006792 | 3300049574 | Bacteria | 10567 |
| 487 | Ga0501038_0015400 | 3300049574 | Bacteria | 6951 |
| 488 | Ga0501038_0030710 | 3300049574 | Bacteria | 4750 |
| 489 | Ga0501038_0046312 | 3300049574 | Bacteria | 3771 |
| 490 | Ga0501038_0225815 | 3300049574 | Bacteria | 1492 |
| 491 | Ga0501038_0286131 | 3300049574 | Bacteria | 1296 |
| 492 | Ga0501039_0021239 | 3300049575 | Bacteria | 4981 |
| 493 | Ga0501039_0146048 | 3300049575 | Bacteria | 1858 |
| 494 | Ga0501039_0177907 | 3300049575 | Bacteria | 1673 |
| 495 | Ga0501039_0225093 | 3300049575 | Bacteria | 1474 |
| 496 | Ga0501039_0695219 | 3300049575 | Bacteria | 795 |
| 497 | Ga0501039_1043660 | 3300049575 | Bacteria | 634 |
| 498 | Ga0501040_0032902 | 3300049576 | Bacteria | 3509 |
| 499 | Ga0501040_0853587 | 3300049576 | Bacteria | 659 |
| 500 | Ga0501041_0003165 | 3300049577 | Bacteria | 9469 |
| 501 | Ga0501042_0051139 | 3300049578 | Bacteria | 2947 |
| 502 | Ga0501042_0305410 | 3300049578 | Bacteria | 1149 |
| 503 | Ga0501042_0792986 | 3300049578 | Bacteria | 689 |
| 504 | Ga0501043_0003026 | 3300049579 | Bacteria | 13974 |
| 505 | Ga0501043_0006148 | 3300049579 | Bacteria | 9644 |
| 506 | Ga0501043_0013131 | 3300049579 | Bacteria | 6477 |
| 507 | Ga0501043_0020604 | 3300049579 | Bacteria | 5173 |
| 508 | Ga0501043_0058756 | 3300049579 | Bacteria | 3018 |
| 509 | Ga0501046_0009533 | 3300049580 | Bacteria | 8386 |
| 510 | Ga0501046_0512276 | 3300049580 | Bacteria | 858 |
| 511 | Ga0501046_0643090 | 3300049580 | Bacteria | 750 |
| 512 | Ga0501046_0644479 | 3300049580 | Bacteria | 749 |
| 513 | Ga0501046_0668710 | 3300049580 | Bacteria | 733 |
| 514 | Ga0501046_1129656 | 3300049580 | Bacteria | 540 |
| 515 | Ga0501047_0000029 | 3300049581 | Bacteria | 218396 |
| 516 | Ga0501047_0007463 | 3300049581 | Bacteria | 10292 |
| 517 | Ga0501047_0009513 | 3300049581 | Bacteria | 9184 |
| 518 | Ga0501047_0018385 | 3300049581 | Bacteria | 6700 |
| 519 | Ga0501047_0050309 | 3300049581 | Bacteria | 4024 |
| 520 | Ga0501047_0156412 | 3300049581 | Bacteria | 2153 |
| 521 | Ga0501047_0585273 | 3300049581 | Bacteria | 938 |
| 522 | Ga0501047_0694023 | 3300049581 | Bacteria | 835 |
| 523 | Ga0501048_0010502 | 3300049582 | Bacteria | 6910 |
| 524 | Ga0501048_0656522 | 3300049582 | Bacteria | 753 |
| 525 | Ga0501067_0000704 | 3300049583 | Bacteria | 18014 |
| 526 | Ga0501068_0002685 | 3300049584 | Bacteria | 9423 |
| 527 | Ga0501068_0262251 | 3300049584 | Bacteria | 1102 |
| 528 | Ga0501068_0342525 | 3300049584 | Bacteria | 960 |
| 529 | Ga0501068_0643194 | 3300049584 | Bacteria | 692 |
| 530 | Ga0501069_0008565 | 3300049585 | Bacteria | 5378 |
| 531 | Ga0501069_0040285 | 3300049585 | Bacteria | 2582 |
| 532 | Ga0501070_0003332 | 3300049586 | Bacteria | 13957 |
| 533 | Ga0501070_0012618 | 3300049586 | Bacteria | 7127 |
| 534 | Ga0501070_0116679 | 3300049586 | Bacteria | 2205 |
| 535 | Ga0501070_0362508 | 3300049586 | Bacteria | 1175 |
| 536 | Ga0501070_0407960 | 3300049586 | Bacteria | 1098 |
| 537 | Ga0501070_0457685 | 3300049586 | Bacteria | 1028 |
| 538 | Ga0501071_0000263 | 3300049587 | Bacteria | 24706 |
| 539 | Ga0501073_0456586 | 3300049589 | Bacteria | 883 |
| 540 | Ga0501074_0000685 | 3300049590 | Bacteria | 21150 |
| 541 | Ga0501074_0004802 | 3300049590 | Bacteria | 9690 |
| 542 | Ga0501074_0386835 | 3300049590 | Bacteria | 992 |
| 543 | Ga0501077_0042588 | 3300049593 | Bacteria | 2886 |
| 544 | Ga0501221_069027 | 3300049704 | Bacteria | 831 |
| 545 | Ga0501079_0026744 | 3300049741 | Bacteria | 4423 |
| 546 | Ga0501080_0097712 | 3300049742 | Bacteria | 2726 |
| 547 | Ga0501080_0941380 | 3300049742 | Bacteria | 751 |
| 548 | Ga0501083_0000333 | 3300049744 | Bacteria | 29934 |
| 549 | Ga0501282_002466 | 3300049778 | Bacteria | 2008 |
| 550 | Ga0501035_0001374 | 3300049822 | Bacteria | 25051 |
| 551 | Ga0501035_0005791 | 3300049822 | Bacteria | 11648 |
| 552 | Ga0501035_0012244 | 3300049822 | Bacteria | 7929 |
| 553 | Ga0501035_0017071 | 3300049822 | Bacteria | 6687 |
| 554 | Ga0501035_0058803 | 3300049822 | Bacteria | 3424 |
| 555 | Ga0501035_0083761 | 3300049822 | Bacteria | 2813 |
| 556 | Ga0501035_0090571 | 3300049822 | Bacteria | 2692 |
| 557 | Ga0501035_0112308 | 3300049822 | Bacteria | 2387 |
| 558 | Ga0501035_0268222 | 3300049822 | Bacteria | 1445 |
| 559 | Ga0501035_0863649 | 3300049822 | Bacteria | 719 |
| 560 | Ga0501044_0004873 | 3300049823 | Bacteria | 14996 |
| 561 | Ga0501044_0006533 | 3300049823 | Bacteria | 12877 |
| 562 | Ga0501044_0047776 | 3300049823 | Bacteria | 4425 |
| 563 | Ga0501044_0073556 | 3300049823 | Bacteria | 3473 |
| 564 | Ga0501044_0116755 | 3300049823 | Bacteria | 2673 |
| 565 | Ga0501044_0139161 | 3300049823 | Bacteria | 2416 |
| 566 | Ga0501044_0204679 | 3300049823 | Bacteria | 1930 |
| 567 | Ga0501044_0276661 | 3300049823 | Bacteria | 1613 |
| 568 | Ga0501044_0277548 | 3300049823 | Bacteria | 1610 |
| 569 | Ga0501044_0280813 | 3300049823 | Bacteria | 1599 |
| 570 | Ga0501044_0350709 | 3300049823 | Bacteria | 1395 |
| 571 | Ga0501044_0447635 | 3300049823 | Bacteria | 1198 |
| 572 | Ga0501044_0783279 | 3300049823 | Bacteria | 834 |
| 573 | Ga0501045_0006168 | 3300049824 | Bacteria | 8303 |
| 574 | Ga0501045_0138757 | 3300049824 | Bacteria | 1808 |
| 575 | nmdc:mga03n38_23835_c1 | 3300050490 | Bacteria | 2495 |
| 576 | nmdc:mga0yw44_115921_c1 | 3300050492 | Bacteria | 1721 |
| 577 | nmdc:mga06z11_584_c1 | 3300050494 | Bacteria | 13334 |
| 578 | nmdc:mga04h51_93480_c1 | 3300050495 | Bacteria | 1086 |
| 579 | nmdc:mga07m45_178137_c1 | 3300050496 | Bacteria | 856 |
| 580 | Ga0500610_0187929 | 3300053079 | Bacteria | 1006 |
| 581 | Ga0500635_0348485 | 3300053080 | Bacteria | 586 |
| 582 | Ga0495655_0156777 | 3300053083 | Bacteria | 720 |
| 583 | Ga0495655_0224217 | 3300053083 | Bacteria | 623 |
| 584 | Ga0495619_0071215 | 3300053085 | Bacteria | 2326 |
| 585 | Ga0500578_0299219 | 3300053086 | Bacteria | 954 |
| 586 | Ga0500643_125306 | 3300053087 | Bacteria | 692 |
| 587 | Ga0500646_0199286 | 3300053090 | Bacteria | 686 |
| 588 | Ga0500583_0210604 | 3300053092 | Bacteria | 965 |
| 589 | Ga0500651_0535329 | 3300053093 | Bacteria | 642 |
| 590 | Ga0500566_0061259 | 3300053094 | Bacteria | 2130 |
| 591 | Ga0500640_070233 | 3300053095 | Bacteria | 1503 |
| 592 | Ga0500641_0333958 | 3300053096 | Bacteria | 613 |
| 593 | Ga0500654_173957 | 3300053099 | Bacteria | 701 |
| 594 | Ga0500553_164193 | 3300053101 | Bacteria | 829 |
| 595 | Ga0500558_092409 | 3300053106 | Bacteria | 1215 |
| 596 | Ga0500560_000786 | 3300053107 | Bacteria | 4845 |
| 597 | Ga0500560_004275 | 3300053107 | Bacteria | 3017 |
| 598 | Ga0500569_061382 | 3300053109 | Bacteria | 1161 |
| 599 | Ga0500580_083645 | 3300053113 | Bacteria | 1289 |
| 600 | Ga0500608_104312 | 3300053122 | Bacteria | 1309 |
| 601 | Ga0500614_006154 | 3300053123 | Bacteria | 2522 |
| 602 | Ga0500614_050662 | 3300053123 | Bacteria | 1089 |
| 603 | Ga0500621_053948 | 3300053126 | Bacteria | 1626 |
| 604 | Ga0500628_209553 | 3300053129 | Bacteria | 564 |
| 605 | Ga0500652_009097 | 3300053131 | Bacteria | 3344 |
| 606 | Ga0500658_0038122 | 3300053134 | Bacteria | 1914 |
| 607 | Ga0500561_0021155 | 3300053137 | Bacteria | 1530 |
| 608 | Ga0500573_0017578 | 3300053140 | Bacteria | 4072 |
| 609 | Ga0500573_0020764 | 3300053140 | Bacteria | 3761 |
| 610 | Ga0500577_0259988 | 3300053142 | Bacteria | 755 |
| 611 | Ga0500600_0105107 | 3300053149 | Bacteria | 1482 |
| 612 | Ga0500600_0234861 | 3300053149 | Bacteria | 834 |
| 613 | Ga0500600_0250607 | 3300053149 | Bacteria | 793 |
| 614 | Ga0500616_0043885 | 3300053153 | Bacteria | 2387 |
| 615 | Ga0500624_001455 | 3300053157 | Bacteria | 3803 |
| 616 | Ga0500633_0164464 | 3300053160 | Bacteria | 832 |
| 617 | Ga0500634_0232953 | 3300053161 | Bacteria | 780 |
| 618 | Ga0500587_006253 | 3300053739 | Bacteria | 1583 |
| 619 | Ga0501084_0005179 | 3300054114 | Bacteria | 10664 |
| 620 | Ga0501084_0665255 | 3300054114 | Bacteria | 879 |
| 621 | Ga0501082_0004945 | 3300060353 | Bacteria | 11629 |
| 622 | Ga0466962_0001135 | 3300061719 | Bacteria | 12296 |
| 623 | Ga0466962_0072567 | 3300061719 | Bacteria | 1645 |
| 624 | Ga0466962_0187136 | 3300061719 | Bacteria | 1010 |
| 625 | Ga0530510_0054191 | 3300061734 | Bacteria | 2898 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003354 | JGI25160J50197_1011075 | JGI25160J50197_10110754 | 91 |
| 2 | 3300003354 | JGI25160J50197_1011015 | JGI25160J50197_10110152 | 92 |
| 3 | 3300025302 | Ga0207426_1001554 | Ga0207426_10015548 | 92 |
| 4 | 3300025302 | Ga0207426_1002336 | Ga0207426_100233611 | 92 |
| 5 | iso_pu_bacteria | 2775506925 | 2776373557 | 94 |
| 6 | 3300046460 | Ga0495638_0271331 | Ga0495638_0271331_10_309 | 99 |
| 7 | iso_pu_bacteria | 2643221673 | 2644403802 | 104 |
| 8 | iso_pu_bacteria | 2946045630 | 2946047828 | 104 |
| 9 | iso_pu_bacteria | 8025478263 | 8025480458 | 105 |
| 10 | iso_pu_bacteria | 2582581312 | 2585296641 | 106 |
| 11 | iso_pu_bacteria | 2616644941 | 2616903273 | 106 |
| 12 | iso_pu_bacteria | 2643221548 | 2643764046 | 106 |
| 13 | iso_pu_bacteria | 2643221647 | 2644265778 | 106 |
| 14 | iso_pu_bacteria | 2643221682 | 2644461522 | 106 |
| 15 | iso_pu_bacteria | 2791355406 | 2793983599 | 106 |
| 16 | iso_pu_bacteria | 2818991463 | 2819694599 | 106 |
| 17 | iso_pu_bacteria | 2866552031 | 2866556194 | 106 |
| 18 | iso_pu_bacteria | 2867369537 | 2867373895 | 106 |
| 19 | iso_pu_bacteria | 2867475112 | 2867478873 | 106 |
| 20 | iso_pu_bacteria | 2873151551 | 2873154026 | 106 |
| 21 | iso_pu_bacteria | 2954380949 | 2954383978 | 106 |
| 22 | iso_pu_bacteria | 2966598605 | 2966600835 | 106 |
| 23 | iso_pu_bacteria | 8047893842 | 8047896078 | 106 |
| 24 | iso_pu_bacteria | 8048127548 | 8048132239 | 106 |
| 25 | iso_pu_bacteria | 8048356638 | 8048362857 | 106 |
| 26 | iso_pu_bacteria | 8048369669 | 8048373103 | 106 |
| 27 | iso_pu_bacteria | 8048379754 | 8048382036 | 106 |
| 28 | iso_pu_bacteria | 8054160619 | 8054166421 | 106 |
| 29 | 3300049823 | Ga0501044_0447635 | Ga0501044_0447635_10_411 | 108 |
| 30 | 3300053106 | Ga0500558_092409 | Ga0500558_092409_80_445 | 108 |
| 31 | 3300053107 | Ga0500560_004275 | Ga0500560_004275_214_579 | 108 |
| 32 | 3300053140 | Ga0500573_0020764 | Ga0500573_0020764_1838_2203 | 108 |
| 33 | iso_pu_bacteria | 2547132111 | 2547408365 | 108 |
| 34 | iso_pu_bacteria | 2582581313 | 2585309084 | 108 |
| 35 | iso_pu_bacteria | 2582581314 | 2585319271 | 108 |
| 36 | iso_pu_bacteria | 2616644814 | 2616697327 | 108 |
| 37 | iso_pu_bacteria | 2643221678 | 2644440080 | 108 |
| 38 | iso_pu_bacteria | 2643221714 | 2644632599 | 108 |
| 39 | iso_pu_bacteria | 2784132148 | 2784590439 | 108 |
| 40 | iso_pu_bacteria | 2784746763 | 2785341174 | 108 |
| 41 | iso_pu_bacteria | 2784746768 | 2785371531 | 108 |
| 42 | iso_pu_bacteria | 2786546132 | 2786672692 | 108 |
| 43 | iso_pu_bacteria | 2808606359 | 2808844057 | 108 |
| 44 | iso_pu_bacteria | 2808606375 | 2808913651 | 108 |
| 45 | iso_pu_bacteria | 2808606448 | 2809234112 | 108 |
| 46 | iso_pu_bacteria | 2811994879 | 2812355918 | 108 |
| 47 | iso_pu_bacteria | 2811994917 | 2812478726 | 108 |
| 48 | iso_pu_bacteria | 2818991472 | 2819740617 | 108 |
| 49 | iso_pu_bacteria | 2852635781 | 2852641047 | 108 |
| 50 | iso_pu_bacteria | 2862178590 | 2862186437 | 108 |
| 51 | iso_pu_bacteria | 2862281513 | 2862284711 | 108 |
| 52 | iso_pu_bacteria | 2862290372 | 2862293523 | 108 |
| 53 | iso_pu_bacteria | 2862382967 | 2862384807 | 108 |
| 54 | iso_pu_bacteria | 2862507626 | 2862512652 | 108 |
| 55 | iso_pu_bacteria | 2862574272 | 2862577482 | 108 |
| 56 | iso_pu_bacteria | 2863067949 | 2863068645 | 108 |
| 57 | iso_pu_bacteria | 2863404153 | 2863408645 | 108 |
| 58 | iso_pu_bacteria | 2867428634 | 2867437370 | 108 |
| 59 | iso_pu_bacteria | 2877676314 | 2877679074 | 108 |
| 60 | iso_pu_bacteria | 2912715099 | 2912717589 | 108 |
| 61 | iso_pu_bacteria | 2912723979 | 2912730132 | 108 |
| 62 | iso_pu_bacteria | 2919468124 | 2919471762 | 108 |
| 63 | iso_pu_bacteria | 2946064051 | 2946069869 | 108 |
| 64 | iso_pu_bacteria | 2946072368 | 2946077790 | 108 |
| 65 | iso_pu_bacteria | 2947224130 | 2947226919 | 108 |
| 66 | iso_pu_bacteria | 2954002825 | 2954005494 | 108 |
| 67 | iso_pu_bacteria | 2954673503 | 2954678985 | 108 |
| 68 | iso_pu_bacteria | 2954682443 | 2954685167 | 108 |
| 69 | iso_pu_bacteria | 2954691527 | 2954694779 | 108 |
| 70 | iso_pu_bacteria | 2954701450 | 2954709980 | 108 |
| 71 | iso_pu_bacteria | 2954711539 | 2954714287 | 108 |
| 72 | iso_pu_bacteria | 2954721474 | 2954724236 | 108 |
| 73 | iso_pu_bacteria | 2954731030 | 2954737604 | 108 |
| 74 | iso_pu_bacteria | 2954740390 | 2954743133 | 108 |
| 75 | iso_pu_bacteria | 2954749733 | 2954756437 | 108 |
| 76 | iso_pu_bacteria | 2954759201 | 2954762091 | 108 |
| 77 | iso_pu_bacteria | 2990059506 | 2990062972 | 108 |
| 78 | iso_pu_bacteria | 2997600082 | 2997606073 | 108 |
| 79 | iso_pu_bacteria | 3006393351 | 3006398626 | 108 |
| 80 | iso_pu_bacteria | 3006493962 | 3006500147 | 108 |
| 81 | iso_pu_bacteria | 8008558824 | 8008562818 | 108 |
| 82 | iso_pu_bacteria | 8008574985 | 8008577141 | 108 |
| 83 | iso_pu_bacteria | 8023623736 | 8023629631 | 108 |
| 84 | iso_pu_bacteria | 8033684223 | 8033690015 | 108 |
| 85 | iso_pu_bacteria | 8048406513 | 8048411684 | 108 |
| 86 | iso_pu_bacteria | 8056207758 | 8056215604 | 108 |
| 87 | iso_pu_bacteria | 8056447290 | 8056453778 | 108 |
| 88 | iso_pu_bacteria | 8056829672 | 8056832228 | 108 |
| 89 | 3300046459 | Ga0495629_0789378 | Ga0495629_0789378_212_553 | 109 |
| 90 | 3300031548 | Ga0307408_100962615 | Ga0307408_1009626152 | 110 |
| 91 | 3300031616 | Ga0307508_10132356 | Ga0307508_101323561 | 110 |
| 92 | 3300031730 | Ga0307516_10634288 | Ga0307516_106342882 | 110 |
| 93 | 3300031824 | Ga0307413_10197771 | Ga0307413_101977712 | 110 |
| 94 | 3300031852 | Ga0307410_10242895 | Ga0307410_102428952 | 110 |
| 95 | 3300032002 | Ga0307416_101014213 | Ga0307416_1010142132 | 110 |
| 96 | 3300032002 | Ga0307416_102314849 | Ga0307416_1023148492 | 110 |
| 97 | 3300032126 | Ga0307415_100937274 | Ga0307415_1009372742 | 110 |
| 98 | 3300033179 | Ga0307507_10141433 | Ga0307507_101414332 | 110 |
| 99 | 3300037466 | Ga0395898_1485671 | Ga0395898_1485671_14_346 | 110 |
| 100 | 3300044693 | Ga0466961_0638181 | Ga0466961_0638181_58_390 | 110 |
| 101 | 3300046455 | Ga0495603_0001170 | Ga0495603_0001170_2529_2861 | 110 |
| 102 | 3300046455 | Ga0495603_0022648 | Ga0495603_0022648_861_1193 | 110 |
| 103 | 3300046459 | Ga0495629_0001224 | Ga0495629_0001224_18471_18803 | 110 |
| 104 | 3300046459 | Ga0495629_0011473 | Ga0495629_0011473_5765_6097 | 110 |
| 105 | 3300046473 | Ga0495582_0122037 | Ga0495582_0122037_65_397 | 110 |
| 106 | 3300046492 | Ga0495585_0111160 | Ga0495585_0111160_451_795 | 110 |
| 107 | 3300046492 | Ga0495585_0210924 | Ga0495585_0210924_461_793 | 110 |
| 108 | 3300046499 | Ga0495594_0011637 | Ga0495594_0011637_2626_2958 | 110 |
| 109 | 3300046499 | Ga0495594_0219797 | Ga0495594_0219797_722_1066 | 110 |
| 110 | 3300046518 | Ga0495631_0234821 | Ga0495631_0234821_176_508 | 110 |
| 111 | 3300046522 | Ga0495643_0015860 | Ga0495643_0015860_2358_2702 | 110 |
| 112 | 3300046648 | Ga0495611_0036080 | Ga0495611_0036080_602_934 | 110 |
| 113 | 3300046674 | Ga0495588_0029177 | Ga0495588_0029177_1300_1632 | 110 |
| 114 | 3300046683 | Ga0495658_0064135 | Ga0495658_0064135_671_1018 | 110 |
| 115 | 3300046689 | Ga0495613_0014939 | Ga0495613_0014939_308_640 | 110 |
| 116 | 3300046691 | Ga0495670_0021308 | Ga0495670_0021308_134_478 | 110 |
| 117 | 3300046794 | Ga0495589_0059042 | Ga0495589_0059042_710_1042 | 110 |
| 118 | 3300046794 | Ga0495589_0078783 | Ga0495589_0078783_126_470 | 110 |
| 119 | 3300046810 | Ga0495660_0050486 | Ga0495660_0050486_275_619 | 110 |
| 120 | 3300047318 | Ga0495636_0036470 | Ga0495636_0036470_1559_1891 | 110 |
| 121 | 3300047321 | Ga0495676_0009294 | Ga0495676_0009294_3731_4063 | 110 |
| 122 | 3300047321 | Ga0495676_0016059 | Ga0495676_0016059_3339_3671 | 110 |
| 123 | 3300047323 | Ga0495683_0448051 | Ga0495683_0448051_166_510 | 110 |
| 124 | 3300047443 | Ga0495687_015224 | Ga0495687_015224_849_1193 | 110 |
| 125 | 3300047443 | Ga0495687_130700 | Ga0495687_130700_481_825 | 110 |
| 126 | 3300047447 | Ga0495685_086187 | Ga0495685_086187_461_805 | 110 |
| 127 | 3300047470 | Ga0495681_0134121 | Ga0495681_0134121_36_380 | 110 |
| 128 | 3300047673 | Ga0495593_0646397 | Ga0495593_0646397_86_418 | 110 |
| 129 | 3300048089 | Ga0495614_0005858 | Ga0495614_0005858_389_721 | 110 |
| 130 | 3300048909 | Ga0496106_0109332 | Ga0496106_0109332_1797_2129 | 110 |
| 131 | 3300049778 | Ga0501282_002466 | Ga0501282_002466_275_607 | 110 |
| 132 | 3300053079 | Ga0500610_0187929 | Ga0500610_0187929_584_928 | 110 |
| 133 | 3300053086 | Ga0500578_0299219 | Ga0500578_0299219_277_621 | 110 |
| 134 | 3300053087 | Ga0500643_125306 | Ga0500643_125306_303_647 | 110 |
| 135 | 3300053090 | Ga0500646_0199286 | Ga0500646_0199286_70_414 | 110 |
| 136 | 3300053092 | Ga0500583_0210604 | Ga0500583_0210604_128_472 | 110 |
| 137 | 3300053093 | Ga0500651_0535329 | Ga0500651_0535329_190_534 | 110 |
| 138 | 3300053094 | Ga0500566_0061259 | Ga0500566_0061259_689_1033 | 110 |
| 139 | 3300053096 | Ga0500641_0333958 | Ga0500641_0333958_227_571 | 110 |
| 140 | 3300053099 | Ga0500654_173957 | Ga0500654_173957_326_670 | 110 |
| 141 | 3300053101 | Ga0500553_164193 | Ga0500553_164193_287_634 | 110 |
| 142 | 3300053109 | Ga0500569_061382 | Ga0500569_061382_132_476 | 110 |
| 143 | 3300053113 | Ga0500580_083645 | Ga0500580_083645_339_686 | 110 |
| 144 | 3300053123 | Ga0500614_006154 | Ga0500614_006154_873_1220 | 110 |
| 145 | 3300053126 | Ga0500621_053948 | Ga0500621_053948_457_801 | 110 |
| 146 | 3300053129 | Ga0500628_209553 | Ga0500628_209553_124_468 | 110 |
| 147 | 3300053131 | Ga0500652_009097 | Ga0500652_009097_270_614 | 110 |
| 148 | 3300053134 | Ga0500658_0038122 | Ga0500658_0038122_1136_1480 | 110 |
| 149 | 3300053137 | Ga0500561_0021155 | Ga0500561_0021155_83_427 | 110 |
| 150 | 3300053142 | Ga0500577_0259988 | Ga0500577_0259988_333_677 | 110 |
| 151 | 3300053149 | Ga0500600_0105107 | Ga0500600_0105107_334_678 | 110 |
| 152 | 3300053153 | Ga0500616_0043885 | Ga0500616_0043885_1658_2002 | 110 |
| 153 | 3300053160 | Ga0500633_0164464 | Ga0500633_0164464_404_748 | 110 |
| 154 | 3300053739 | Ga0500587_006253 | Ga0500587_006253_107_451 | 110 |
| 155 | iso_pu_bacteria | 3006321560 | 3006322615 | 110 |
| 156 | 3300001989 | JGI24739J22299_10015480 | JGI24739J22299_100154803 | 112 |
| 157 | 3300001990 | JGI24737J22298_10047793 | JGI24737J22298_100477932 | 112 |
| 158 | 3300002067 | JGI24735J21928_10030103 | JGI24735J21928_100301032 | 112 |
| 159 | 3300002075 | JGI24738J21930_10098346 | JGI24738J21930_100983461 | 112 |
| 160 | 3300003316 | rootH1_10016340 | rootH1_100163409 | 112 |
| 161 | 3300003320 | rootH2_10108408 | rootH2_101084087 | 112 |
| 162 | 3300003322 | rootL2_10011295 | rootL2_100112953 | 112 |
| 163 | 3300003323 | rootH1_10003211 | rootH1_100032112 | 112 |
| 164 | 3300003323 | rootH1_10025281 | rootH1_100252812 | 112 |
| 165 | 3300003323 | rootH1_10025282 | rootH1_100252822 | 112 |
| 166 | 3300003578 | Ga0006562J51391_1157409 | Ga0006562J51391_11574092 | 112 |
| 167 | 3300003578 | Ga0006562J51391_1157410 | Ga0006562J51391_11574107 | 112 |
| 168 | 3300005439 | Ga0070711_101434341 | Ga0070711_1014343411 | 112 |
| 169 | 3300005471 | Ga0070698_101222930 | Ga0070698_1012229302 | 112 |
| 170 | 3300005539 | Ga0068853_100054136 | Ga0068853_1000541364 | 112 |
| 171 | 3300005543 | Ga0070672_101240266 | Ga0070672_1012402661 | 112 |
| 172 | 3300005548 | Ga0070665_102167319 | Ga0070665_1021673192 | 112 |
| 173 | 3300005614 | Ga0068856_100223398 | Ga0068856_1002233982 | 112 |
| 174 | 3300005616 | Ga0068852_102419579 | Ga0068852_1024195791 | 112 |
| 175 | 3300005842 | Ga0068858_101722765 | Ga0068858_1017227651 | 112 |
| 176 | 3300005937 | Ga0081455_10100897 | Ga0081455_101008973 | 112 |
| 177 | 3300006038 | Ga0075365_10147713 | Ga0075365_101477132 | 112 |
| 178 | 3300006042 | Ga0075368_10050013 | Ga0075368_100500132 | 112 |
| 179 | 3300006048 | Ga0075363_100693062 | Ga0075363_1006930621 | 112 |
| 180 | 3300006178 | Ga0075367_10001932 | Ga0075367_100019328 | 112 |
| 181 | 3300006353 | Ga0075370_10530982 | Ga0075370_105309821 | 112 |
| 182 | 3300009011 | Ga0105251_10013900 | Ga0105251_100139002 | 112 |
| 183 | 3300009036 | Ga0105244_10078114 | Ga0105244_100781143 | 112 |
| 184 | 3300009092 | Ga0105250_10032581 | Ga0105250_100325812 | 112 |
| 185 | 3300009098 | Ga0105245_10214889 | Ga0105245_102148892 | 112 |
| 186 | 3300009101 | Ga0105247_10156622 | Ga0105247_101566222 | 112 |
| 187 | 3300009148 | Ga0105243_10154889 | Ga0105243_101548892 | 112 |
| 188 | 3300009551 | Ga0105238_10203850 | Ga0105238_102038504 | 112 |
| 189 | 3300009551 | Ga0105238_10477877 | Ga0105238_104778772 | 112 |
| 190 | 3300009551 | Ga0105238_11100643 | Ga0105238_111006431 | 112 |
| 191 | 3300009553 | Ga0105249_10728011 | Ga0105249_107280112 | 112 |
| 192 | 3300010375 | Ga0105239_10510121 | Ga0105239_105101212 | 112 |
| 193 | 3300010375 | Ga0105239_10580632 | Ga0105239_105806322 | 112 |
| 194 | 3300010375 | Ga0105239_11605999 | Ga0105239_116059992 | 112 |
| 195 | 3300011119 | Ga0105246_10088014 | Ga0105246_100880142 | 112 |
| 196 | 3300011119 | Ga0105246_11043860 | Ga0105246_110438601 | 112 |
| 197 | 3300013105 | Ga0157369_10170298 | Ga0157369_101702983 | 112 |
| 198 | 3300013306 | Ga0163162_12525273 | Ga0163162_125252731 | 112 |
| 199 | 3300013307 | Ga0157372_10498816 | Ga0157372_104988162 | 112 |
| 200 | 3300013308 | Ga0157375_10442088 | Ga0157375_104420882 | 112 |
| 201 | 3300014497 | Ga0182008_10001944 | Ga0182008_1000194411 | 112 |
| 202 | 3300014969 | Ga0157376_11137994 | Ga0157376_111379941 | 112 |
| 203 | 3300015261 | Ga0182006_1037051 | Ga0182006_10370512 | 112 |
| 204 | 3300015262 | Ga0182007_10001129 | Ga0182007_100011297 | 112 |
| 205 | 3300015265 | Ga0182005_1074634 | Ga0182005_10746342 | 112 |
| 206 | 3300015688 | Ga0183367_1002 | Ga0183367_100234 | 112 |
| 207 | 3300021388 | Ga0213875_10003336 | Ga0213875_100033361 | 112 |
| 208 | 3300025302 | Ga0207426_1027307 | Ga0207426_10273071 | 112 |
| 209 | 3300025302 | Ga0207426_1033574 | Ga0207426_10335743 | 112 |
| 210 | 3300025303 | Ga0209051_1106818 | Ga0209051_11068182 | 112 |
| 211 | 3300025735 | Ga0207713_1064791 | Ga0207713_10647912 | 112 |
| 212 | 3300025904 | Ga0207647_10007368 | Ga0207647_100073684 | 112 |
| 213 | 3300025924 | Ga0207694_10193779 | Ga0207694_101937792 | 112 |
| 214 | 3300025927 | Ga0207687_10366757 | Ga0207687_103667572 | 112 |
| 215 | 3300025934 | Ga0207686_11158651 | Ga0207686_111586512 | 112 |
| 216 | 3300025935 | Ga0207709_10023263 | Ga0207709_100232632 | 112 |
| 217 | 3300025940 | Ga0207691_10235481 | Ga0207691_102354812 | 112 |
| 218 | 3300025940 | Ga0207691_10439237 | Ga0207691_104392372 | 112 |
| 219 | 3300025944 | Ga0207661_10138649 | Ga0207661_101386492 | 112 |
| 220 | 3300025961 | Ga0207712_10947704 | Ga0207712_109477042 | 112 |
| 221 | 3300025981 | Ga0207640_10395393 | Ga0207640_103953931 | 112 |
| 222 | 3300026035 | Ga0207703_11564188 | Ga0207703_115641882 | 112 |
| 223 | 3300026041 | Ga0207639_12114117 | Ga0207639_121141172 | 112 |
| 224 | 3300026078 | Ga0207702_10686557 | Ga0207702_106865572 | 112 |
| 225 | 3300026116 | Ga0207674_10613722 | Ga0207674_106137222 | 112 |
| 226 | 3300027312 | Ga0209371_1021550 | Ga0209371_10215501 | 112 |
| 227 | 3300027312 | Ga0209371_1087523 | Ga0209371_10875231 | 112 |
| 228 | 3300027866 | Ga0209813_10027210 | Ga0209813_100272102 | 112 |
| 229 | 3300028379 | Ga0268266_11715056 | Ga0268266_117150562 | 112 |
| 230 | 3300028794 | Ga0307515_10000813 | Ga0307515_1000081312 | 112 |
| 231 | 3300028794 | Ga0307515_10109395 | Ga0307515_101093954 | 112 |
| 232 | 3300030500 | Ga0268256_1024205 | Ga0268256_10242052 | 112 |
| 233 | 3300030500 | Ga0268256_1046663 | Ga0268256_10466632 | 112 |
| 234 | 3300030521 | Ga0307511_10051211 | Ga0307511_100512114 | 112 |
| 235 | 3300030521 | Ga0307511_10118501 | Ga0307511_101185012 | 112 |
| 236 | 3300030522 | Ga0307512_10051020 | Ga0307512_100510203 | 112 |
| 237 | 3300030522 | Ga0307512_10070649 | Ga0307512_100706492 | 112 |
| 238 | 3300030522 | Ga0307512_10091748 | Ga0307512_100917483 | 112 |
| 239 | 3300031456 | Ga0307513_10017828 | Ga0307513_100178286 | 112 |
| 240 | 3300031456 | Ga0307513_10028725 | Ga0307513_100287252 | 112 |
| 241 | 3300031507 | Ga0307509_10016921 | Ga0307509_100169214 | 112 |
| 242 | 3300031507 | Ga0307509_10116000 | Ga0307509_101160002 | 112 |
| 243 | 3300031616 | Ga0307508_10005950 | Ga0307508_100059507 | 112 |
| 244 | 3300031616 | Ga0307508_10034247 | Ga0307508_100342474 | 112 |
| 245 | 3300031649 | Ga0307514_10053823 | Ga0307514_100538233 | 112 |
| 246 | 3300031649 | Ga0307514_10060014 | Ga0307514_100600143 | 112 |
| 247 | 3300031649 | Ga0307514_10115022 | Ga0307514_101150223 | 112 |
| 248 | 3300031730 | Ga0307516_10001694 | Ga0307516_1000169425 | 112 |
| 249 | 3300031730 | Ga0307516_10049439 | Ga0307516_100494392 | 112 |
| 250 | 3300031730 | Ga0307516_10093686 | Ga0307516_100936862 | 112 |
| 251 | 3300031838 | Ga0307518_10100969 | Ga0307518_101009692 | 112 |
| 252 | 3300033179 | Ga0307507_10011491 | Ga0307507_100114916 | 112 |
| 253 | 3300033179 | Ga0307507_10274813 | Ga0307507_102748132 | 112 |
| 254 | 3300033180 | Ga0307510_10027859 | Ga0307510_100278592 | 112 |
| 255 | 3300033180 | Ga0307510_10203628 | Ga0307510_102036282 | 112 |
| 256 | 3300033180 | Ga0307510_10255793 | Ga0307510_102557932 | 112 |
| 257 | 3300037418 | Ga0395900_0251801 | Ga0395900_0251801_581_919 | 112 |
| 258 | 3300037466 | Ga0395898_0014941 | Ga0395898_0014941_3441_3779 | 112 |
| 259 | 3300037466 | Ga0395898_0552728 | Ga0395898_0552728_568_906 | 112 |
| 260 | 3300037471 | Ga0395905_0113761 | Ga0395905_0113761_1996_2334 | 112 |
| 261 | 3300037853 | Ga0436364_0894301 | Ga0436364_0894301_697_1035 | 112 |
| 262 | 3300038443 | Ga0395901_0004321 | Ga0395901_0004321_12207_12545 | 112 |
| 263 | 3300041404 | Ga0439436_0000864 | Ga0439436_0000864_5189_5530 | 112 |
| 264 | 3300041404 | Ga0439436_0019699 | Ga0439436_0019699_1147_1485 | 112 |
| 265 | 3300041406 | Ga0439439_0001188 | Ga0439439_0001188_3695_4036 | 112 |
| 266 | 3300041406 | Ga0439439_0017456 | Ga0439439_0017456_758_1096 | 112 |
| 267 | 3300041406 | Ga0439439_0079580 | Ga0439439_0079580_151_489 | 112 |
| 268 | 3300041456 | Ga0451795_1596757 | Ga0451795_1596757_384_722 | 112 |
| 269 | 3300041486 | Ga0451807_1292668 | Ga0451807_1292668_351_689 | 112 |
| 270 | 3300041491 | Ga0451833_1452990 | Ga0451833_1452990_80_418 | 112 |
| 271 | 3300041492 | Ga0451835_0932778 | Ga0451835_0932778_64_420 | 112 |
| 272 | 3300041494 | Ga0451837_0652012 | Ga0451837_0652012_1939_2277 | 112 |
| 273 | 3300041496 | Ga0451839_0729921 | Ga0451839_0729921_155_493 | 112 |
| 274 | 3300041512 | Ga0451853_0696848 | Ga0451853_0696848_1976_2332 | 112 |
| 275 | 3300041512 | Ga0451853_3795338 | Ga0451853_3795338_2311_2649 | 112 |
| 276 | 3300042005 | Ga0439448_0002802 | Ga0439448_0002802_805_1143 | 112 |
| 277 | 3300042005 | Ga0439448_0022472 | Ga0439448_0022472_641_979 | 112 |
| 278 | 3300042007 | Ga0439449_0009106 | Ga0439449_0009106_695_1033 | 112 |
| 279 | 3300042007 | Ga0439449_0027188 | Ga0439449_0027188_1008_1349 | 112 |
| 280 | 3300042007 | Ga0439449_0245857 | Ga0439449_0245857_161_502 | 112 |
| 281 | 3300042008 | Ga0439450_021872 | Ga0439450_021872_421_777 | 112 |
| 282 | 3300042012 | Ga0439455_0007163 | Ga0439455_0007163_1438_1776 | 112 |
| 283 | 3300042012 | Ga0439455_0127537 | Ga0439455_0127537_137_475 | 112 |
| 284 | 3300042014 | Ga0439457_000919 | Ga0439457_000919_3323_3661 | 112 |
| 285 | 3300042014 | Ga0439457_034554 | Ga0439457_034554_344_685 | 112 |
| 286 | 3300042015 | Ga0439462_0006442 | Ga0439462_0006442_1420_1758 | 112 |
| 287 | 3300042127 | Ga0450890_006905 | Ga0450890_006905_634_975 | 112 |
| 288 | 3300042131 | Ga0450894_000089 | Ga0450894_000089_8952_9290 | 112 |
| 289 | 3300042134 | Ga0450898_000428 | Ga0450898_000428_4215_4553 | 112 |
| 290 | 3300042134 | Ga0450898_036956 | Ga0450898_036956_313_654 | 112 |
| 291 | 3300042135 | Ga0450899_000458 | Ga0450899_000458_1719_2057 | 112 |
| 292 | 3300042137 | Ga0450902_073162 | Ga0450902_073162_177_515 | 112 |
| 293 | 3300042138 | Ga0450903_000025 | Ga0450903_000025_4386_4724 | 112 |
| 294 | 3300042145 | Ga0450906_000226 | Ga0450906_000226_1438_1776 | 112 |
| 295 | 3300042157 | Ga0439458_0000750 | Ga0439458_0000750_5846_6184 | 112 |
| 296 | 3300044656 | Ga0466969_0157280 | Ga0466969_0157280_244_582 | 112 |
| 297 | 3300044658 | Ga0466972_0002962 | Ga0466972_0002962_6467_6805 | 112 |
| 298 | 3300044658 | Ga0466972_0004174 | Ga0466972_0004174_322_660 | 112 |
| 299 | 3300044658 | Ga0466972_0007163 | Ga0466972_0007163_3311_3649 | 112 |
| 300 | 3300044658 | Ga0466972_0122071 | Ga0466972_0122071_105_443 | 112 |
| 301 | 3300044683 | Ga0466965_0077772 | Ga0466965_0077772_932_1270 | 112 |
| 302 | 3300044683 | Ga0466965_0905607 | Ga0466965_0905607_89_427 | 112 |
| 303 | 3300044684 | Ga0466966_0006232 | Ga0466966_0006232_6745_7083 | 112 |
| 304 | 3300044684 | Ga0466966_0020981 | Ga0466966_0020981_1860_2198 | 112 |
| 305 | 3300044684 | Ga0466966_0616634 | Ga0466966_0616634_34_372 | 112 |
| 306 | 3300044693 | Ga0466961_0003621 | Ga0466961_0003621_7339_7677 | 112 |
| 307 | 3300044693 | Ga0466961_0020002 | Ga0466961_0020002_3881_4219 | 112 |
| 308 | 3300044693 | Ga0466961_0045500 | Ga0466961_0045500_126_464 | 112 |
| 309 | 3300044693 | Ga0466961_0243983 | Ga0466961_0243983_603_941 | 112 |
| 310 | 3300044694 | Ga0466963_0012012 | Ga0466963_0012012_3125_3463 | 112 |
| 311 | 3300044694 | Ga0466963_0634558 | Ga0466963_0634558_355_693 | 112 |
| 312 | 3300044706 | Ga0466964_0004533 | Ga0466964_0004533_2956_3294 | 112 |
| 313 | 3300044706 | Ga0466964_0066014 | Ga0466964_0066014_646_984 | 112 |
| 314 | 3300044719 | Ga0466971_0023423 | Ga0466971_0023423_2141_2479 | 112 |
| 315 | 3300044719 | Ga0466971_0077987 | Ga0466971_0077987_849_1187 | 112 |
| 316 | 3300044735 | Ga0466968_0027810 | Ga0466968_0027810_153_491 | 112 |
| 317 | 3300044735 | Ga0466968_0039702 | Ga0466968_0039702_1588_1926 | 112 |
| 318 | 3300044765 | Ga0466970_0001226 | Ga0466970_0001226_4817_5155 | 112 |
| 319 | 3300044765 | Ga0466970_0004495 | Ga0466970_0004495_3349_3687 | 112 |
| 320 | 3300044765 | Ga0466970_0093768 | Ga0466970_0093768_1125_1463 | 112 |
| 321 | 3300044765 | Ga0466970_0383813 | Ga0466970_0383813_244_582 | 112 |
| 322 | 3300044842 | Ga0466957_0002870 | Ga0466957_0002870_2272_2610 | 112 |
| 323 | 3300044842 | Ga0466957_0221321 | Ga0466957_0221321_552_893 | 112 |
| 324 | 3300044901 | Ga0466960_0021297 | Ga0466960_0021297_1589_1927 | 112 |
| 325 | 3300045049 | Ga0466959_0003319 | Ga0466959_0003319_9363_9701 | 112 |
| 326 | 3300045049 | Ga0466959_0892016 | Ga0466959_0892016_172_510 | 112 |
| 327 | 3300045836 | Ga0466958_0004341 | Ga0466958_0004341_1908_2246 | 112 |
| 328 | 3300045836 | Ga0466958_0257236 | Ga0466958_0257236_666_1004 | 112 |
| 329 | 3300045976 | Ga0466967_0001968 | Ga0466967_0001968_6152_6490 | 112 |
| 330 | 3300045976 | Ga0466967_0090406 | Ga0466967_0090406_1332_1670 | 112 |
| 331 | 3300045976 | Ga0466967_0142885 | Ga0466967_0142885_976_1314 | 112 |
| 332 | 3300045976 | Ga0466967_0267553 | Ga0466967_0267553_101_442 | 112 |
| 333 | 3300045976 | Ga0466967_0444308 | Ga0466967_0444308_813_1154 | 112 |
| 334 | 3300045976 | Ga0466967_0693257 | Ga0466967_0693257_537_878 | 112 |
| 335 | 3300046452 | Ga0495617_067526 | Ga0495617_067526_709_1047 | 112 |
| 336 | 3300046452 | Ga0495617_153465 | Ga0495617_153465_163_501 | 112 |
| 337 | 3300046453 | Ga0495627_044652 | Ga0495627_044652_700_1038 | 112 |
| 338 | 3300046454 | Ga0495592_0002770 | Ga0495592_0002770_5407_5745 | 112 |
| 339 | 3300046454 | Ga0495592_0033022 | Ga0495592_0033022_3344_3682 | 112 |
| 340 | 3300046454 | Ga0495592_0080563 | Ga0495592_0080563_1140_1481 | 112 |
| 341 | 3300046455 | Ga0495603_0001759 | Ga0495603_0001759_11933_12271 | 112 |
| 342 | 3300046455 | Ga0495603_0012358 | Ga0495603_0012358_2067_2408 | 112 |
| 343 | 3300046455 | Ga0495603_0042651 | Ga0495603_0042651_856_1194 | 112 |
| 344 | 3300046455 | Ga0495603_0043852 | Ga0495603_0043852_2254_2592 | 112 |
| 345 | 3300046455 | Ga0495603_0418772 | Ga0495603_0418772_240_578 | 112 |
| 346 | 3300046457 | Ga0495590_0217666 | Ga0495590_0217666_24_362 | 112 |
| 347 | 3300046459 | Ga0495629_0008001 | Ga0495629_0008001_797_1135 | 112 |
| 348 | 3300046459 | Ga0495629_0012969 | Ga0495629_0012969_2921_3262 | 112 |
| 349 | 3300046459 | Ga0495629_0016650 | Ga0495629_0016650_2131_2469 | 112 |
| 350 | 3300046459 | Ga0495629_0023384 | Ga0495629_0023384_1571_1912 | 112 |
| 351 | 3300046459 | Ga0495629_0044605 | Ga0495629_0044605_2750_3088 | 112 |
| 352 | 3300046459 | Ga0495629_0426537 | Ga0495629_0426537_20_358 | 112 |
| 353 | 3300046459 | Ga0495629_0543301 | Ga0495629_0543301_66_404 | 112 |
| 354 | 3300046460 | Ga0495638_0082604 | Ga0495638_0082604_206_544 | 112 |
| 355 | 3300046460 | Ga0495638_0149916 | Ga0495638_0149916_853_1191 | 112 |
| 356 | 3300046460 | Ga0495638_0152079 | Ga0495638_0152079_518_856 | 112 |
| 357 | 3300046460 | Ga0495638_0196277 | Ga0495638_0196277_198_536 | 112 |
| 358 | 3300046462 | Ga0495651_0001653 | Ga0495651_0001653_16891_17229 | 112 |
| 359 | 3300046462 | Ga0495651_0005532 | Ga0495651_0005532_1229_1570 | 112 |
| 360 | 3300046462 | Ga0495651_0051354 | Ga0495651_0051354_209_547 | 112 |
| 361 | 3300046463 | Ga0495653_0146595 | Ga0495653_0146595_999_1337 | 112 |
| 362 | 3300046472 | Ga0495580_0139522 | Ga0495580_0139522_664_1002 | 112 |
| 363 | 3300046473 | Ga0495582_0017157 | Ga0495582_0017157_3427_3765 | 112 |
| 364 | 3300046473 | Ga0495582_0311540 | Ga0495582_0311540_67_405 | 112 |
| 365 | 3300046474 | Ga0495605_0031015 | Ga0495605_0031015_1036_1374 | 112 |
| 366 | 3300046475 | Ga0495639_0064589 | Ga0495639_0064589_695_1033 | 112 |
| 367 | 3300046475 | Ga0495639_0247075 | Ga0495639_0247075_263_601 | 112 |
| 368 | 3300046476 | Ga0495662_0003171 | Ga0495662_0003171_6153_6491 | 112 |
| 369 | 3300046476 | Ga0495662_0019058 | Ga0495662_0019058_2585_2923 | 112 |
| 370 | 3300046476 | Ga0495662_0143790 | Ga0495662_0143790_663_1001 | 112 |
| 371 | 3300046476 | Ga0495662_0233158 | Ga0495662_0233158_256_594 | 112 |
| 372 | 3300046476 | Ga0495662_0567010 | Ga0495662_0567010_61_402 | 112 |
| 373 | 3300046477 | Ga0495664_0000282 | Ga0495664_0000282_8194_8532 | 112 |
| 374 | 3300046477 | Ga0495664_0053517 | Ga0495664_0053517_430_768 | 112 |
| 375 | 3300046477 | Ga0495664_0075260 | Ga0495664_0075260_894_1235 | 112 |
| 376 | 3300046491 | Ga0495584_0181036 | Ga0495584_0181036_176_514 | 112 |
| 377 | 3300046492 | Ga0495585_0035662 | Ga0495585_0035662_2422_2763 | 112 |
| 378 | 3300046492 | Ga0495585_0054957 | Ga0495585_0054957_627_965 | 112 |
| 379 | 3300046492 | Ga0495585_0474836 | Ga0495585_0474836_199_540 | 112 |
| 380 | 3300046492 | Ga0495585_0480161 | Ga0495585_0480161_39_377 | 112 |
| 381 | 3300046499 | Ga0495594_0032639 | Ga0495594_0032639_2022_2360 | 112 |
| 382 | 3300046499 | Ga0495594_0117308 | Ga0495594_0117308_400_741 | 112 |
| 383 | 3300046499 | Ga0495594_0371088 | Ga0495594_0371088_228_566 | 112 |
| 384 | 3300046499 | Ga0495594_0388072 | Ga0495594_0388072_420_758 | 112 |
| 385 | 3300046500 | Ga0495596_0024281 | Ga0495596_0024281_773_1111 | 112 |
| 386 | 3300046501 | Ga0495607_0012696 | Ga0495607_0012696_1671_2009 | 112 |
| 387 | 3300046501 | Ga0495607_0102530 | Ga0495607_0102530_58_396 | 112 |
| 388 | 3300046507 | Ga0495606_0064381 | Ga0495606_0064381_1033_1371 | 112 |
| 389 | 3300046512 | Ga0495610_0054597 | Ga0495610_0054597_750_1088 | 112 |
| 390 | 3300046512 | Ga0495610_0259406 | Ga0495610_0259406_320_658 | 112 |
| 391 | 3300046513 | Ga0495616_0006140 | Ga0495616_0006140_1803_2141 | 112 |
| 392 | 3300046514 | Ga0495618_0025172 | Ga0495618_0025172_1061_1399 | 112 |
| 393 | 3300046514 | Ga0495618_0031655 | Ga0495618_0031655_2185_2526 | 112 |
| 394 | 3300046514 | Ga0495618_0127295 | Ga0495618_0127295_833_1171 | 112 |
| 395 | 3300046515 | Ga0495620_0085339 | Ga0495620_0085339_32_370 | 112 |
| 396 | 3300046515 | Ga0495620_0161817 | Ga0495620_0161817_469_807 | 112 |
| 397 | 3300046516 | Ga0495628_0022296 | Ga0495628_0022296_1451_1789 | 112 |
| 398 | 3300046516 | Ga0495628_0023269 | Ga0495628_0023269_691_1032 | 112 |
| 399 | 3300046516 | Ga0495628_0167442 | Ga0495628_0167442_372_710 | 112 |
| 400 | 3300046517 | Ga0495630_0025860 | Ga0495630_0025860_3486_3824 | 112 |
| 401 | 3300046518 | Ga0495631_0018251 | Ga0495631_0018251_1803_2141 | 112 |
| 402 | 3300046518 | Ga0495631_0034970 | Ga0495631_0034970_453_791 | 112 |
| 403 | 3300046519 | Ga0495632_0195749 | Ga0495632_0195749_31_369 | 112 |
| 404 | 3300046520 | Ga0495637_0120558 | Ga0495637_0120558_472_810 | 112 |
| 405 | 3300046522 | Ga0495643_0001554 | Ga0495643_0001554_19516_19854 | 112 |
| 406 | 3300046522 | Ga0495643_0217214 | Ga0495643_0217214_34_372 | 112 |
| 407 | 3300046523 | Ga0495644_0032456 | Ga0495644_0032456_961_1299 | 112 |
| 408 | 3300046523 | Ga0495644_0232160 | Ga0495644_0232160_333_671 | 112 |
| 409 | 3300046524 | Ga0495648_0078644 | Ga0495648_0078644_366_704 | 112 |
| 410 | 3300046526 | Ga0495666_0048633 | Ga0495666_0048633_596_934 | 112 |
| 411 | 3300046526 | Ga0495666_0412287 | Ga0495666_0412287_191_529 | 112 |
| 412 | 3300046528 | Ga0495642_0129576 | Ga0495642_0129576_115_453 | 112 |
| 413 | 3300046529 | Ga0495652_0028026 | Ga0495652_0028026_222_563 | 112 |
| 414 | 3300046529 | Ga0495652_0158430 | Ga0495652_0158430_982_1320 | 112 |
| 415 | 3300046530 | Ga0495654_0042557 | Ga0495654_0042557_812_1150 | 112 |
| 416 | 3300046533 | Ga0495640_0013523 | Ga0495640_0013523_2195_2536 | 112 |
| 417 | 3300046533 | Ga0495640_0030666 | Ga0495640_0030666_3303_3644 | 112 |
| 418 | 3300046533 | Ga0495640_0030868 | Ga0495640_0030868_2315_2653 | 112 |
| 419 | 3300046533 | Ga0495640_0150123 | Ga0495640_0150123_578_916 | 112 |
| 420 | 3300046535 | Ga0495586_0027579 | Ga0495586_0027579_1507_1845 | 112 |
| 421 | 3300046536 | Ga0495587_0029688 | Ga0495587_0029688_2935_3273 | 112 |
| 422 | 3300046536 | Ga0495587_0093009 | Ga0495587_0093009_763_1101 | 112 |
| 423 | 3300046538 | Ga0495609_0032050 | Ga0495609_0032050_1134_1472 | 112 |
| 424 | 3300046542 | Ga0495597_0202467 | Ga0495597_0202467_247_585 | 112 |
| 425 | 3300046543 | Ga0495645_0007346 | Ga0495645_0007346_3277_3615 | 112 |
| 426 | 3300046543 | Ga0495645_0412377 | Ga0495645_0412377_216_554 | 112 |
| 427 | 3300046557 | Ga0495622_0012385 | Ga0495622_0012385_2501_2839 | 112 |
| 428 | 3300046557 | Ga0495622_0130595 | Ga0495622_0130595_346_684 | 112 |
| 429 | 3300046558 | Ga0495633_0018654 | Ga0495633_0018654_972_1310 | 112 |
| 430 | 3300046558 | Ga0495633_0330178 | Ga0495633_0330178_270_608 | 112 |
| 431 | 3300046559 | Ga0495667_0074258 | Ga0495667_0074258_905_1246 | 112 |
| 432 | 3300046615 | Ga0495656_0042215 | Ga0495656_0042215_1199_1537 | 112 |
| 433 | 3300046616 | Ga0495668_0070198 | Ga0495668_0070198_228_566 | 112 |
| 434 | 3300046642 | Ga0495634_0004963 | Ga0495634_0004963_2665_3003 | 112 |
| 435 | 3300046642 | Ga0495634_0006932 | Ga0495634_0006932_894_1235 | 112 |
| 436 | 3300046642 | Ga0495634_0394030 | Ga0495634_0394030_245_583 | 112 |
| 437 | 3300046648 | Ga0495611_0031653 | Ga0495611_0031653_1576_1914 | 112 |
| 438 | 3300046648 | Ga0495611_0049366 | Ga0495611_0049366_420_758 | 112 |
| 439 | 3300046648 | Ga0495611_0269004 | Ga0495611_0269004_353_691 | 112 |
| 440 | 3300046648 | Ga0495611_0279660 | Ga0495611_0279660_54_392 | 112 |
| 441 | 3300046660 | Ga0495625_0016470 | Ga0495625_0016470_1471_1809 | 112 |
| 442 | 3300046660 | Ga0495625_0020466 | Ga0495625_0020466_2712_3050 | 112 |
| 443 | 3300046660 | Ga0495625_0121946 | Ga0495625_0121946_785_1123 | 112 |
| 444 | 3300046660 | Ga0495625_0220917 | Ga0495625_0220917_463_801 | 112 |
| 445 | 3300046663 | Ga0495635_0000593 | Ga0495635_0000593_14127_14465 | 112 |
| 446 | 3300046663 | Ga0495635_0062632 | Ga0495635_0062632_1883_2221 | 112 |
| 447 | 3300046664 | Ga0495659_0071711 | Ga0495659_0071711_107_445 | 112 |
| 448 | 3300046665 | Ga0495661_0133290 | Ga0495661_0133290_354_692 | 112 |
| 449 | 3300046674 | Ga0495588_0006697 | Ga0495588_0006697_564_902 | 112 |
| 450 | 3300046674 | Ga0495588_0009714 | Ga0495588_0009714_669_1007 | 112 |
| 451 | 3300046674 | Ga0495588_0115849 | Ga0495588_0115849_430_768 | 112 |
| 452 | 3300046674 | Ga0495588_0218376 | Ga0495588_0218376_115_453 | 112 |
| 453 | 3300046674 | Ga0495588_0710693 | Ga0495588_0710693_92_430 | 112 |
| 454 | 3300046675 | Ga0495657_0002382 | Ga0495657_0002382_7187_7525 | 112 |
| 455 | 3300046675 | Ga0495657_0004529 | Ga0495657_0004529_9171_9512 | 112 |
| 456 | 3300046675 | Ga0495657_0019119 | Ga0495657_0019119_2687_3025 | 112 |
| 457 | 3300046675 | Ga0495657_0134556 | Ga0495657_0134556_222_560 | 112 |
| 458 | 3300046678 | Ga0495599_0075685 | Ga0495599_0075685_25_363 | 112 |
| 459 | 3300046679 | Ga0495623_0049744 | Ga0495623_0049744_506_844 | 112 |
| 460 | 3300046680 | Ga0495646_0002399 | Ga0495646_0002399_5493_5831 | 112 |
| 461 | 3300046680 | Ga0495646_0053865 | Ga0495646_0053865_847_1185 | 112 |
| 462 | 3300046681 | Ga0495647_0157000 | Ga0495647_0157000_56_394 | 112 |
| 463 | 3300046683 | Ga0495658_0020193 | Ga0495658_0020193_2264_2602 | 112 |
| 464 | 3300046689 | Ga0495613_0007902 | Ga0495613_0007902_3777_4115 | 112 |
| 465 | 3300046689 | Ga0495613_0026062 | Ga0495613_0026062_3074_3415 | 112 |
| 466 | 3300046689 | Ga0495613_0218330 | Ga0495613_0218330_130_471 | 112 |
| 467 | 3300046689 | Ga0495613_0333107 | Ga0495613_0333107_179_517 | 112 |
| 468 | 3300046689 | Ga0495613_0457863 | Ga0495613_0457863_455_793 | 112 |
| 469 | 3300046689 | Ga0495613_0470347 | Ga0495613_0470347_146_484 | 112 |
| 470 | 3300046690 | Ga0495624_0021164 | Ga0495624_0021164_208_549 | 112 |
| 471 | 3300046690 | Ga0495624_0063478 | Ga0495624_0063478_1194_1532 | 112 |
| 472 | 3300046690 | Ga0495624_0324856 | Ga0495624_0324856_293_631 | 112 |
| 473 | 3300046690 | Ga0495624_0391535 | Ga0495624_0391535_251_589 | 112 |
| 474 | 3300046691 | Ga0495670_0021532 | Ga0495670_0021532_985_1323 | 112 |
| 475 | 3300046691 | Ga0495670_0132012 | Ga0495670_0132012_682_1020 | 112 |
| 476 | 3300046691 | Ga0495670_0338762 | Ga0495670_0338762_160_498 | 112 |
| 477 | 3300046692 | Ga0495671_0007806 | Ga0495671_0007806_1455_1793 | 112 |
| 478 | 3300046692 | Ga0495671_0076828 | Ga0495671_0076828_407_745 | 112 |
| 479 | 3300046694 | Ga0495649_0085127 | Ga0495649_0085127_16_372 | 112 |
| 480 | 3300046694 | Ga0495649_0138439 | Ga0495649_0138439_919_1257 | 112 |
| 481 | 3300046694 | Ga0495649_0282398 | Ga0495649_0282398_345_683 | 112 |
| 482 | 3300046794 | Ga0495589_0018231 | Ga0495589_0018231_3041_3379 | 112 |
| 483 | 3300046794 | Ga0495589_0024586 | Ga0495589_0024586_1002_1340 | 112 |
| 484 | 3300046794 | Ga0495589_0096008 | Ga0495589_0096008_443_781 | 112 |
| 485 | 3300046794 | Ga0495589_0098553 | Ga0495589_0098553_713_1051 | 112 |
| 486 | 3300046794 | Ga0495589_0103568 | Ga0495589_0103568_379_717 | 112 |
| 487 | 3300046794 | Ga0495589_0129480 | Ga0495589_0129480_264_602 | 112 |
| 488 | 3300046794 | Ga0495589_0147737 | Ga0495589_0147737_53_391 | 112 |
| 489 | 3300046809 | Ga0495600_0004771 | Ga0495600_0004771_1541_1882 | 112 |
| 490 | 3300046809 | Ga0495600_0006332 | Ga0495600_0006332_877_1215 | 112 |
| 491 | 3300046809 | Ga0495600_0099347 | Ga0495600_0099347_744_1082 | 112 |
| 492 | 3300046809 | Ga0495600_0549801 | Ga0495600_0549801_324_662 | 112 |
| 493 | 3300046810 | Ga0495660_0048366 | Ga0495660_0048366_715_1053 | 112 |
| 494 | 3300047315 | Ga0495581_0004318 | Ga0495581_0004318_3687_4025 | 112 |
| 495 | 3300047315 | Ga0495581_0028125 | Ga0495581_0028125_168_506 | 112 |
| 496 | 3300047315 | Ga0495581_0063633 | Ga0495581_0063633_1719_2057 | 112 |
| 497 | 3300047315 | Ga0495581_0163597 | Ga0495581_0163597_861_1202 | 112 |
| 498 | 3300047315 | Ga0495581_0750475 | Ga0495581_0750475_186_524 | 112 |
| 499 | 3300047317 | Ga0495604_0006494 | Ga0495604_0006494_7818_8156 | 112 |
| 500 | 3300047317 | Ga0495604_0058030 | Ga0495604_0058030_1305_1646 | 112 |
| 501 | 3300047317 | Ga0495604_0100593 | Ga0495604_0100593_305_646 | 112 |
| 502 | 3300047317 | Ga0495604_0601304 | Ga0495604_0601304_278_640 | 112 |
| 503 | 3300047318 | Ga0495636_0006423 | Ga0495636_0006423_2323_2661 | 112 |
| 504 | 3300047318 | Ga0495636_0025732 | Ga0495636_0025732_1598_1936 | 112 |
| 505 | 3300047318 | Ga0495636_0259354 | Ga0495636_0259354_455_793 | 112 |
| 506 | 3300047318 | Ga0495636_0266988 | Ga0495636_0266988_197_535 | 112 |
| 507 | 3300047318 | Ga0495636_0503794 | Ga0495636_0503794_163_501 | 112 |
| 508 | 3300047318 | Ga0495636_0506286 | Ga0495636_0506286_94_432 | 112 |
| 509 | 3300047319 | Ga0495674_0122442 | Ga0495674_0122442_1825_2163 | 112 |
| 510 | 3300047319 | Ga0495674_0640258 | Ga0495674_0640258_201_539 | 112 |
| 511 | 3300047320 | Ga0495672_0096584 | Ga0495672_0096584_1212_1550 | 112 |
| 512 | 3300047321 | Ga0495676_0002667 | Ga0495676_0002667_12577_12915 | 112 |
| 513 | 3300047321 | Ga0495676_0008638 | Ga0495676_0008638_5064_5402 | 112 |
| 514 | 3300047321 | Ga0495676_0011467 | Ga0495676_0011467_309_650 | 112 |
| 515 | 3300047321 | Ga0495676_0138022 | Ga0495676_0138022_49_387 | 112 |
| 516 | 3300047321 | Ga0495676_0140335 | Ga0495676_0140335_914_1252 | 112 |
| 517 | 3300047321 | Ga0495676_0277945 | Ga0495676_0277945_684_1022 | 112 |
| 518 | 3300047321 | Ga0495676_0696327 | Ga0495676_0696327_280_618 | 112 |
| 519 | 3300047322 | Ga0495680_0001987 | Ga0495680_0001987_6953_7291 | 112 |
| 520 | 3300047322 | Ga0495680_0347016 | Ga0495680_0347016_210_551 | 112 |
| 521 | 3300047323 | Ga0495683_0110162 | Ga0495683_0110162_263_601 | 112 |
| 522 | 3300047323 | Ga0495683_0148392 | Ga0495683_0148392_650_988 | 112 |
| 523 | 3300047323 | Ga0495683_0251168 | Ga0495683_0251168_186_524 | 112 |
| 524 | 3300047443 | Ga0495687_001345 | Ga0495687_001345_3670_4008 | 112 |
| 525 | 3300047443 | Ga0495687_008623 | Ga0495687_008623_5080_5418 | 112 |
| 526 | 3300047443 | Ga0495687_011944 | Ga0495687_011944_4095_4433 | 112 |
| 527 | 3300047443 | Ga0495687_113292 | Ga0495687_113292_221_559 | 112 |
| 528 | 3300047444 | Ga0495675_0002357 | Ga0495675_0002357_1040_1378 | 112 |
| 529 | 3300047444 | Ga0495675_0083454 | Ga0495675_0083454_29_367 | 112 |
| 530 | 3300047444 | Ga0495675_0086655 | Ga0495675_0086655_1540_1881 | 112 |
| 531 | 3300047445 | Ga0495677_0021381 | Ga0495677_0021381_1014_1352 | 112 |
| 532 | 3300047447 | Ga0495685_001961 | Ga0495685_001961_4460_4798 | 112 |
| 533 | 3300047447 | Ga0495685_013872 | Ga0495685_013872_1936_2274 | 112 |
| 534 | 3300047447 | Ga0495685_014059 | Ga0495685_014059_528_866 | 112 |
| 535 | 3300047447 | Ga0495685_057575 | Ga0495685_057575_401_739 | 112 |
| 536 | 3300047470 | Ga0495681_0001930 | Ga0495681_0001930_12905_13243 | 112 |
| 537 | 3300047470 | Ga0495681_0033825 | Ga0495681_0033825_1111_1449 | 112 |
| 538 | 3300047471 | Ga0495684_0120483 | Ga0495684_0120483_697_1035 | 112 |
| 539 | 3300047471 | Ga0495684_0246598 | Ga0495684_0246598_324_662 | 112 |
| 540 | 3300047472 | Ga0495686_0010378 | Ga0495686_0010378_4532_4870 | 112 |
| 541 | 3300047472 | Ga0495686_0081037 | Ga0495686_0081037_164_502 | 112 |
| 542 | 3300047472 | Ga0495686_0317022 | Ga0495686_0317022_234_572 | 112 |
| 543 | 3300047673 | Ga0495593_0001804 | Ga0495593_0001804_9450_9788 | 112 |
| 544 | 3300047673 | Ga0495593_0172072 | Ga0495593_0172072_538_876 | 112 |
| 545 | 3300047673 | Ga0495593_0285079 | Ga0495593_0285079_430_768 | 112 |
| 546 | 3300048088 | Ga0495602_0062348 | Ga0495602_0062348_1007_1345 | 112 |
| 547 | 3300048088 | Ga0495602_0169775 | Ga0495602_0169775_495_833 | 112 |
| 548 | 3300048089 | Ga0495614_0004349 | Ga0495614_0004349_1930_2268 | 112 |
| 549 | 3300048089 | Ga0495614_0011311 | Ga0495614_0011311_2131_2469 | 112 |
| 550 | 3300048091 | Ga0495626_0044420 | Ga0495626_0044420_235_573 | 112 |
| 551 | 3300048907 | Ga0496104_1012177 | Ga0496104_1012177_178_516 | 112 |
| 552 | 3300048911 | Ga0496108_0331456 | Ga0496108_0331456_197_535 | 112 |
| 553 | 3300048912 | Ga0496109_0099066 | Ga0496109_0099066_2223_2561 | 112 |
| 554 | 3300048913 | Ga0496110_0450462 | Ga0496110_0450462_441_779 | 112 |
| 555 | 3300049459 | Ga0495678_075067 | Ga0495678_075067_228_566 | 112 |
| 556 | 3300049460 | Ga0495682_0012475 | Ga0495682_0012475_1076_1414 | 112 |
| 557 | 3300049568 | Ga0501031_0007853 | Ga0501031_0007853_6326_6667 | 112 |
| 558 | 3300049568 | Ga0501031_0095748 | Ga0501031_0095748_798_1139 | 112 |
| 559 | 3300049568 | Ga0501031_0150708 | Ga0501031_0150708_95_439 | 112 |
| 560 | 3300049568 | Ga0501031_0169824 | Ga0501031_0169824_500_841 | 112 |
| 561 | 3300049569 | Ga0501032_0012081 | Ga0501032_0012081_3710_4123 | 112 |
| 562 | 3300049569 | Ga0501032_0021673 | Ga0501032_0021673_3870_4211 | 112 |
| 563 | 3300049569 | Ga0501032_0088534 | Ga0501032_0088534_1533_1874 | 112 |
| 564 | 3300049569 | Ga0501032_0089925 | Ga0501032_0089925_347_685 | 112 |
| 565 | 3300049569 | Ga0501032_0109615 | Ga0501032_0109615_1466_1807 | 112 |
| 566 | 3300049569 | Ga0501032_0140874 | Ga0501032_0140874_1119_1463 | 112 |
| 567 | 3300049570 | Ga0501033_0001721 | Ga0501033_0001721_15535_15873 | 112 |
| 568 | 3300049570 | Ga0501033_0005963 | Ga0501033_0005963_4712_5050 | 112 |
| 569 | 3300049570 | Ga0501033_0011432 | Ga0501033_0011432_646_987 | 112 |
| 570 | 3300049570 | Ga0501033_0033426 | Ga0501033_0033426_2042_2455 | 112 |
| 571 | 3300049570 | Ga0501033_0101712 | Ga0501033_0101712_765_1106 | 112 |
| 572 | 3300049570 | Ga0501033_0174662 | Ga0501033_0174662_160_498 | 112 |
| 573 | 3300049570 | Ga0501033_0362309 | Ga0501033_0362309_407_748 | 112 |
| 574 | 3300049571 | Ga0501034_0006924 | Ga0501034_0006924_5597_5935 | 112 |
| 575 | 3300049571 | Ga0501034_0013110 | Ga0501034_0013110_7982_8323 | 112 |
| 576 | 3300049571 | Ga0501034_0015840 | Ga0501034_0015840_7361_7702 | 112 |
| 577 | 3300049571 | Ga0501034_0021973 | Ga0501034_0021973_2287_2700 | 112 |
| 578 | 3300049571 | Ga0501034_0031442 | Ga0501034_0031442_3006_3344 | 112 |
| 579 | 3300049571 | Ga0501034_0049592 | Ga0501034_0049592_513_851 | 112 |
| 580 | 3300049571 | Ga0501034_0226451 | Ga0501034_0226451_1232_1573 | 112 |
| 581 | 3300049572 | Ga0501036_0006789 | Ga0501036_0006789_142_483 | 112 |
| 582 | 3300049572 | Ga0501036_0011358 | Ga0501036_0011358_788_1201 | 112 |
| 583 | 3300049572 | Ga0501036_0033288 | Ga0501036_0033288_3938_4279 | 112 |
| 584 | 3300049572 | Ga0501036_0044024 | Ga0501036_0044024_2932_3273 | 112 |
| 585 | 3300049572 | Ga0501036_0046619 | Ga0501036_0046619_2157_2495 | 112 |
| 586 | 3300049572 | Ga0501036_0074787 | Ga0501036_0074787_1307_1645 | 112 |
| 587 | 3300049572 | Ga0501036_1162365 | Ga0501036_1162365_267_611 | 112 |
| 588 | 3300049573 | Ga0501037_0000724 | Ga0501037_0000724_17403_17744 | 112 |
| 589 | 3300049573 | Ga0501037_0020484 | Ga0501037_0020484_1697_2113 | 112 |
| 590 | 3300049573 | Ga0501037_0227667 | Ga0501037_0227667_108_449 | 112 |
| 591 | 3300049573 | Ga0501037_0514403 | Ga0501037_0514403_363_701 | 112 |
| 592 | 3300049573 | Ga0501037_0597556 | Ga0501037_0597556_93_437 | 112 |
| 593 | 3300049574 | Ga0501038_0006792 | Ga0501038_0006792_3235_3573 | 112 |
| 594 | 3300049574 | Ga0501038_0015400 | Ga0501038_0015400_21_362 | 112 |
| 595 | 3300049574 | Ga0501038_0030710 | Ga0501038_0030710_1801_2214 | 112 |
| 596 | 3300049574 | Ga0501038_0046312 | Ga0501038_0046312_1849_2187 | 112 |
| 597 | 3300049574 | Ga0501038_0225815 | Ga0501038_0225815_1082_1423 | 112 |
| 598 | 3300049574 | Ga0501038_0286131 | Ga0501038_0286131_221_562 | 112 |
| 599 | 3300049575 | Ga0501039_0021239 | Ga0501039_0021239_1836_2174 | 112 |
| 600 | 3300049575 | Ga0501039_0146048 | Ga0501039_0146048_790_1131 | 112 |
| 601 | 3300049575 | Ga0501039_0177907 | Ga0501039_0177907_21_362 | 112 |
| 602 | 3300049575 | Ga0501039_0225093 | Ga0501039_0225093_873_1286 | 112 |
| 603 | 3300049575 | Ga0501039_0695219 | Ga0501039_0695219_77_418 | 112 |
| 604 | 3300049575 | Ga0501039_1043660 | Ga0501039_1043660_247_585 | 112 |
| 605 | 3300049576 | Ga0501040_0032902 | Ga0501040_0032902_1605_1946 | 112 |
| 606 | 3300049576 | Ga0501040_0853587 | Ga0501040_0853587_286_627 | 112 |
| 607 | 3300049577 | Ga0501041_0003165 | Ga0501041_0003165_3935_4276 | 112 |
| 608 | 3300049578 | Ga0501042_0051139 | Ga0501042_0051139_1678_2019 | 112 |
| 609 | 3300049578 | Ga0501042_0305410 | Ga0501042_0305410_529_891 | 112 |
| 610 | 3300049578 | Ga0501042_0792986 | Ga0501042_0792986_219_557 | 112 |
| 611 | 3300049579 | Ga0501043_0003026 | Ga0501043_0003026_13554_13895 | 112 |
| 612 | 3300049579 | Ga0501043_0006148 | Ga0501043_0006148_4265_4678 | 112 |
| 613 | 3300049579 | Ga0501043_0013131 | Ga0501043_0013131_1384_1722 | 112 |
| 614 | 3300049579 | Ga0501043_0020604 | Ga0501043_0020604_4138_4479 | 112 |
| 615 | 3300049579 | Ga0501043_0058756 | Ga0501043_0058756_1089_1430 | 112 |
| 616 | 3300049580 | Ga0501046_0009533 | Ga0501046_0009533_790_1131 | 112 |
| 617 | 3300049580 | Ga0501046_0512276 | Ga0501046_0512276_490_831 | 112 |
| 618 | 3300049580 | Ga0501046_0643090 | Ga0501046_0643090_367_705 | 112 |
| 619 | 3300049580 | Ga0501046_0644479 | Ga0501046_0644479_166_507 | 112 |
| 620 | 3300049580 | Ga0501046_0668710 | Ga0501046_0668710_212_625 | 112 |
| 621 | 3300049580 | Ga0501046_1129656 | Ga0501046_1129656_65_406 | 112 |
| 622 | 3300049581 | Ga0501047_0000029 | Ga0501047_0000029_198578_198940 | 112 |
| 623 | 3300049581 | Ga0501047_0007463 | Ga0501047_0007463_9905_10246 | 112 |
| 624 | 3300049581 | Ga0501047_0009513 | Ga0501047_0009513_1405_1818 | 112 |
| 625 | 3300049581 | Ga0501047_0018385 | Ga0501047_0018385_34_375 | 112 |
| 626 | 3300049581 | Ga0501047_0050309 | Ga0501047_0050309_3526_3867 | 112 |
| 627 | 3300049581 | Ga0501047_0156412 | Ga0501047_0156412_1618_1956 | 112 |
| 628 | 3300049581 | Ga0501047_0585273 | Ga0501047_0585273_187_525 | 112 |
| 629 | 3300049581 | Ga0501047_0694023 | Ga0501047_0694023_306_647 | 112 |
| 630 | 3300049582 | Ga0501048_0010502 | Ga0501048_0010502_6453_6794 | 112 |
| 631 | 3300049582 | Ga0501048_0656522 | Ga0501048_0656522_136_474 | 112 |
| 632 | 3300049583 | Ga0501067_0000704 | Ga0501067_0000704_16964_17305 | 112 |
| 633 | 3300049584 | Ga0501068_0002685 | Ga0501068_0002685_1577_1918 | 112 |
| 634 | 3300049584 | Ga0501068_0262251 | Ga0501068_0262251_47_385 | 112 |
| 635 | 3300049584 | Ga0501068_0342525 | Ga0501068_0342525_104_517 | 112 |
| 636 | 3300049584 | Ga0501068_0643194 | Ga0501068_0643194_303_641 | 112 |
| 637 | 3300049585 | Ga0501069_0008565 | Ga0501069_0008565_1100_1441 | 112 |
| 638 | 3300049585 | Ga0501069_0040285 | Ga0501069_0040285_878_1216 | 112 |
| 639 | 3300049586 | Ga0501070_0003332 | Ga0501070_0003332_7895_8233 | 112 |
| 640 | 3300049586 | Ga0501070_0012618 | Ga0501070_0012618_1633_2046 | 112 |
| 641 | 3300049586 | Ga0501070_0116679 | Ga0501070_0116679_626_964 | 112 |
| 642 | 3300049586 | Ga0501070_0362508 | Ga0501070_0362508_34_375 | 112 |
| 643 | 3300049586 | Ga0501070_0407960 | Ga0501070_0407960_700_1041 | 112 |
| 644 | 3300049586 | Ga0501070_0457685 | Ga0501070_0457685_630_971 | 112 |
| 645 | 3300049587 | Ga0501071_0000263 | Ga0501071_0000263_16993_17334 | 112 |
| 646 | 3300049589 | Ga0501073_0456586 | Ga0501073_0456586_330_668 | 112 |
| 647 | 3300049590 | Ga0501074_0000685 | Ga0501074_0000685_1755_2093 | 112 |
| 648 | 3300049590 | Ga0501074_0004802 | Ga0501074_0004802_5778_6119 | 112 |
| 649 | 3300049590 | Ga0501074_0386835 | Ga0501074_0386835_45_383 | 112 |
| 650 | 3300049593 | Ga0501077_0042588 | Ga0501077_0042588_1917_2258 | 112 |
| 651 | 3300049704 | Ga0501221_069027 | Ga0501221_069027_124_465 | 112 |
| 652 | 3300049741 | Ga0501079_0026744 | Ga0501079_0026744_2756_3097 | 112 |
| 653 | 3300049742 | Ga0501080_0097712 | Ga0501080_0097712_801_1142 | 112 |
| 654 | 3300049742 | Ga0501080_0941380 | Ga0501080_0941380_141_479 | 112 |
| 655 | 3300049744 | Ga0501083_0000333 | Ga0501083_0000333_218_559 | 112 |
| 656 | 3300049822 | Ga0501035_0001374 | Ga0501035_0001374_10073_10411 | 112 |
| 657 | 3300049822 | Ga0501035_0005791 | Ga0501035_0005791_1970_2311 | 112 |
| 658 | 3300049822 | Ga0501035_0012244 | Ga0501035_0012244_2966_3379 | 112 |
| 659 | 3300049822 | Ga0501035_0017071 | Ga0501035_0017071_21_362 | 112 |
| 660 | 3300049822 | Ga0501035_0058803 | Ga0501035_0058803_1881_2219 | 112 |
| 661 | 3300049822 | Ga0501035_0083761 | Ga0501035_0083761_1527_1865 | 112 |
| 662 | 3300049822 | Ga0501035_0090571 | Ga0501035_0090571_1307_1651 | 112 |
| 663 | 3300049822 | Ga0501035_0112308 | Ga0501035_0112308_991_1332 | 112 |
| 664 | 3300049822 | Ga0501035_0268222 | Ga0501035_0268222_524_865 | 112 |
| 665 | 3300049822 | Ga0501035_0863649 | Ga0501035_0863649_349_693 | 112 |
| 666 | 3300049823 | Ga0501044_0004873 | Ga0501044_0004873_14576_14917 | 112 |
| 667 | 3300049823 | Ga0501044_0006533 | Ga0501044_0006533_9113_9451 | 112 |
| 668 | 3300049823 | Ga0501044_0047776 | Ga0501044_0047776_3942_4283 | 112 |
| 669 | 3300049823 | Ga0501044_0073556 | Ga0501044_0073556_2748_3086 | 112 |
| 670 | 3300049823 | Ga0501044_0116755 | Ga0501044_0116755_1352_1693 | 112 |
| 671 | 3300049823 | Ga0501044_0139161 | Ga0501044_0139161_117_458 | 112 |
| 672 | 3300049823 | Ga0501044_0204679 | Ga0501044_0204679_956_1294 | 112 |
| 673 | 3300049823 | Ga0501044_0276661 | Ga0501044_0276661_479_823 | 112 |
| 674 | 3300049823 | Ga0501044_0277548 | Ga0501044_0277548_268_630 | 112 |
| 675 | 3300049823 | Ga0501044_0280813 | Ga0501044_0280813_820_1161 | 112 |
| 676 | 3300049823 | Ga0501044_0350709 | Ga0501044_0350709_42_380 | 112 |
| 677 | 3300049823 | Ga0501044_0783279 | Ga0501044_0783279_393_737 | 112 |
| 678 | 3300049824 | Ga0501045_0006168 | Ga0501045_0006168_5287_5628 | 112 |
| 679 | 3300049824 | Ga0501045_0138757 | Ga0501045_0138757_1344_1685 | 112 |
| 680 | 3300050490 | nmdc:mga03n38_23835_c1 | nmdc:mga03n38_23835_c1_1195_1536 | 112 |
| 681 | 3300050492 | nmdc:mga0yw44_115921_c1 | nmdc:mga0yw44_115921_c1_1087_1425 | 112 |
| 682 | 3300050494 | nmdc:mga06z11_584_c1 | nmdc:mga06z11_584_c1_12337_12738 | 112 |
| 683 | 3300050495 | nmdc:mga04h51_93480_c1 | nmdc:mga04h51_93480_c1_28_429 | 112 |
| 684 | 3300050496 | nmdc:mga07m45_178137_c1 | nmdc:mga07m45_178137_c1_120_461 | 112 |
| 685 | 3300053080 | Ga0500635_0348485 | Ga0500635_0348485_82_420 | 112 |
| 686 | 3300053083 | Ga0495655_0156777 | Ga0495655_0156777_241_579 | 112 |
| 687 | 3300053083 | Ga0495655_0224217 | Ga0495655_0224217_254_595 | 112 |
| 688 | 3300053085 | Ga0495619_0071215 | Ga0495619_0071215_1241_1579 | 112 |
| 689 | 3300053095 | Ga0500640_070233 | Ga0500640_070233_994_1332 | 112 |
| 690 | 3300053107 | Ga0500560_000786 | Ga0500560_000786_1109_1447 | 112 |
| 691 | 3300053122 | Ga0500608_104312 | Ga0500608_104312_913_1251 | 112 |
| 692 | 3300053123 | Ga0500614_050662 | Ga0500614_050662_82_420 | 112 |
| 693 | 3300053140 | Ga0500573_0017578 | Ga0500573_0017578_3422_3760 | 112 |
| 694 | 3300053149 | Ga0500600_0234861 | Ga0500600_0234861_155_493 | 112 |
| 695 | 3300053149 | Ga0500600_0250607 | Ga0500600_0250607_200_538 | 112 |
| 696 | 3300053157 | Ga0500624_001455 | Ga0500624_001455_1185_1523 | 112 |
| 697 | 3300053161 | Ga0500634_0232953 | Ga0500634_0232953_173_511 | 112 |
| 698 | 3300054114 | Ga0501084_0005179 | Ga0501084_0005179_6364_6705 | 112 |
| 699 | 3300054114 | Ga0501084_0665255 | Ga0501084_0665255_157_498 | 112 |
| 700 | 3300060353 | Ga0501082_0004945 | Ga0501082_0004945_6002_6343 | 112 |
| 701 | 3300061719 | Ga0466962_0001135 | Ga0466962_0001135_9363_9701 | 112 |
| 702 | 3300061719 | Ga0466962_0072567 | Ga0466962_0072567_722_1060 | 112 |
| 703 | 3300061719 | Ga0466962_0187136 | Ga0466962_0187136_239_580 | 112 |
| 704 | 3300061734 | Ga0530510_0054191 | Ga0530510_0054191_1070_1411 | 112 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar