F476367

General Info

Members Datasets Scaffolds Average Seq Length
704 364 1408 314

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_03596|Ga0400487_03596_2128_3123
Length 331
Sequence MADYLLNEWLVNWPVGWLLAGLQTLLFIAIAPLLAGWIKLKKCRLQNRIAPSIWQPYRDLRKLFRKESVIAANASWIFRTTPYIVFGTTVLAAGVVPLIATDLPSAAIADVIVLVGFFALARFFLALAGMDIGTAFGGMGSSREMTLASLTEPAMLMAVFTLAMTASTTNLSTTIEVILSQGIVLRPSFIFAALGLMMVAIAETGRIPIDNPATHLELTMVHEAMILEYSGRHLAMLEWAQQIKLMVYGVLIVNLFVPWGIATELTEVALLVGSVAIIAKLALLGVILAISETVLAKLRLFRAPNYISFAFLLCLLGLLSHVILEVQQSTL

Samples

Sample ID Description Type Environment
1 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
142 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
143 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
185 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
322 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
323 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
327 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
330 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
334 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
339 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
340 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
341 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
342 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
343 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
344 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
345 2643221618 Ensifer sp. Root231 Isolate Unclassified
346 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
347 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
348 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
349 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
350 2906610324
351 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
352 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
353 2922425934
354 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
355 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
356 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
357 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
358 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
359 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
360 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
361 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
362 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
363 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
364 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0.14
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 2.41
Rhizoplane 9.09
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400487_03596 3300039110 Bacteria 6394
2 JGI24740J21852_10024687 3300001979 Bacteria 2037
3 JGI24737J22298_10048358 3300001990 Bacteria 1295
4 JGI25153J46596_10000946 3300003215 Bacteria 17627
5 JGI25404J52841_10015246 3300003659 Bacteria 1668
6 Ga0065165_1000785 3300005262 Bacteria 42533
7 Ga0065715_10104321 3300005293 Bacteria 2970
8 Ga0065707_10091172 3300005295 Bacteria 3993
9 Ga0070658_10079674 3300005327 Bacteria 2690
10 Ga0070683_100006806 3300005329 Bacteria 9604
11 Ga0070683_100062439 3300005329 Bacteria 3464
12 Ga0070683_100163185 3300005329 Bacteria 2114
13 Ga0070666_10137277 3300005335 Bacteria 1702
14 Ga0070680_100042057 3300005336 Bacteria 3706
15 Ga0068868_100226201 3300005338 Bacteria 1568
16 Ga0070660_100003489 3300005339 Bacteria 10834
17 Ga0070689_100024765 3300005340 Bacteria 4504
18 Ga0070661_100411955 3300005344 Bacteria 1070
19 Ga0070669_100018253 3300005353 Bacteria 5012
20 Ga0070674_100237939 3300005356 Bacteria 1424
21 Ga0070673_100007902 3300005364 Bacteria 7051
22 Ga0070667_100101443 3300005367 Bacteria 2486
23 Ga0070667_100126654 3300005367 Bacteria 2226
24 Ga0070709_10112069 3300005434 Bacteria 1835
25 Ga0070713_100409851 3300005436 Bacteria 1267
26 Ga0070700_100248498 3300005441 Bacteria 1275
27 Ga0070694_100104069 3300005444 Bacteria 2012
28 Ga0070708_100018422 3300005445 Bacteria 5844
29 Ga0070708_100020728 3300005445 Bacteria 5550
30 Ga0070663_100009487 3300005455 Bacteria 6029
31 Ga0070663_100078723 3300005455 Bacteria 2417
32 Ga0070681_10004100 3300005458 Bacteria 13769
33 Ga0070681_10027203 3300005458 Bacteria 5751
34 Ga0070681_10442004 3300005458 Bacteria 1212
35 Ga0070685_10101294 3300005466 Bacteria 1759
36 Ga0070706_100009059 3300005467 Bacteria 9263
37 Ga0070698_100004962 3300005471 Bacteria 14580
38 Ga0070698_100413951 3300005471 Bacteria 1282
39 Ga0070699_100005057 3300005518 Bacteria 11609
40 Ga0070699_100010430 3300005518 Bacteria 8041
41 Ga0070679_100092199 3300005530 Bacteria 3017
42 Ga0070684_100133696 3300005535 Bacteria 2239
43 Ga0070684_100209282 3300005535 Bacteria 1777
44 Ga0070697_100033689 3300005536 Bacteria 4127
45 Ga0070697_100065682 3300005536 Bacteria 2965
46 Ga0068853_100255074 3300005539 Bacteria 1611
47 Ga0070672_100106865 3300005543 Bacteria 2277
48 Ga0070686_100091167 3300005544 Bacteria 2039
49 Ga0070696_100052793 3300005546 Bacteria 2828
50 Ga0070665_100109558 3300005548 Bacteria 2764
51 Ga0070665_100345927 3300005548 Bacteria 1492
52 Ga0070704_100005398 3300005549 Bacteria 7444
53 Ga0068855_100007706 3300005563 Bacteria 13003
54 Ga0068855_100037426 3300005563 Bacteria 5769
55 Ga0068855_100198230 3300005563 Bacteria 2261
56 Ga0068855_100406711 3300005563 Bacteria 1491
57 Ga0068857_100084493 3300005577 Bacteria 2836
58 Ga0068854_100082238 3300005578 Bacteria 2380
59 Ga0070702_100141454 3300005615 Bacteria 1533
60 Ga0068864_100080001 3300005618 Bacteria 2863
61 Ga0068866_10025656 3300005718 Bacteria 2773
62 Ga0068863_100265397 3300005841 Bacteria 1661
63 Ga0081455_10001555 3300005937 Bacteria 28179
64 Ga0081455_10002076 3300005937 Bacteria 23889
65 Ga0081455_10008768 3300005937 Bacteria 10470
66 Ga0081455_10044348 3300005937 Bacteria 3881
67 Ga0081455_10055152 3300005937 Bacteria 3382
68 Ga0081455_10217206 3300005937 Bacteria 1420
69 Ga0081540_1002923 3300005983 Bacteria 13756
70 Ga0081539_10019455 3300005985 Bacteria 4646
71 Ga0070717_10015928 3300006028 Bacteria 5819
72 Ga0070717_10054441 3300006028 Bacteria 3299
73 Ga0070717_10201423 3300006028 Bacteria 1744
74 Ga0075365_10130583 3300006038 Bacteria 1738
75 Ga0070712_100288144 3300006175 Bacteria 1325
76 Ga0075369_10031986 3300006186 Bacteria 2224
77 Ga0097621_100155598 3300006237 Bacteria 1962
78 Ga0097621_100500030 3300006237 Bacteria 1101
79 Ga0075428_100015159 3300006844 Bacteria 8549
80 Ga0075428_100594867 3300006844 Bacteria 1182
81 Ga0075430_100009149 3300006846 Bacteria 8369
82 Ga0075430_100218435 3300006846 Bacteria 1582
83 Ga0075431_100018426 3300006847 Bacteria 7109
84 Ga0075433_10028952 3300006852 Bacteria 4714
85 Ga0075434_100008951 3300006871 Bacteria 9323
86 Ga0075434_100276654 3300006871 Bacteria 1698
87 Ga0075429_100008886 3300006880 Bacteria 8733
88 Ga0075436_100001243 3300006914 Bacteria 17319
89 Ga0075436_100322393 3300006914 Bacteria 1110
90 Ga0075435_100020921 3300007076 Bacteria 5024
91 Ga0099794_10002299 3300007265 Bacteria 7025
92 Ga0099794_10008987 3300007265 Bacteria 4171
93 Ga0099794_10050643 3300007265 Bacteria 1998
94 Ga0099795_10004297 3300007788 Bacteria 3658
95 Ga0099795_10011809 3300007788 Bacteria 2626
96 Ga0099795_10024949 3300007788 Bacteria 1999
97 Ga0105240_10016507 3300009093 Bacteria 9994
98 Ga0105240_10020582 3300009093 Bacteria 8793
99 Ga0111539_10007260 3300009094 Bacteria 14189
100 Ga0111539_10015669 3300009094 Bacteria 9422
101 Ga0105247_10009021 3300009101 Bacteria 6074
102 Ga0105247_10011300 3300009101 Bacteria 5385
103 Ga0114129_10018961 3300009147 Bacteria 9800
104 Ga0114129_10024866 3300009147 Bacteria 8491
105 Ga0114129_10203045 3300009147 Bacteria 2683
106 Ga0114129_10535767 3300009147 Bacteria 1525
107 Ga0105243_10034348 3300009148 Bacteria 3925
108 Ga0105243_10052495 3300009148 Bacteria 3229
109 Ga0105242_10244586 3300009176 Bacteria 1614
110 Ga0105248_10275210 3300009177 Bacteria 1895
111 Ga0105237_10131772 3300009545 Bacteria 2494
112 Ga0105237_10150598 3300009545 Bacteria 2323
113 Ga0105238_10034573 3300009551 Bacteria 5142
114 Ga0105238_10037267 3300009551 Bacteria 4944
115 Ga0105238_10469470 3300009551 Bacteria 1257
116 Ga0105249_10011069 3300009553 Bacteria 7927
117 Ga0105249_10031333 3300009553 Bacteria 4809
118 Ga0099796_10001698 3300010159 Bacteria 4566
119 Ga0099796_10012365 3300010159 Bacteria 2409
120 Ga0099796_10025076 3300010159 Bacteria 1879
121 Ga0105239_10005103 3300010375 Bacteria 15500
122 Ga0105239_10046428 3300010375 Bacteria 4760
123 Ga0105239_10157445 3300010375 Bacteria 2537
124 Ga0105246_10282562 3300011119 Bacteria 1332
125 Ga0157370_10008657 3300013104 Bacteria 10951
126 Ga0157369_10634955 3300013105 Bacteria 1102
127 Ga0157374_10369865 3300013296 Bacteria 1427
128 Ga0157378_10030990 3300013297 Bacteria 4722
129 Ga0157378_10081545 3300013297 Bacteria 2924
130 Ga0157375_10003393 3300013308 Bacteria 13812
131 Ga0157375_10046525 3300013308 Bacteria 4231
132 Ga0163163_10006150 3300014325 Bacteria 10461
133 Ga0163163_10082676 3300014325 Bacteria 3215
134 Ga0163163_10116319 3300014325 Bacteria 2705
135 Ga0163163_10426129 3300014325 Bacteria 1386
136 Ga0157380_10172391 3300014326 Bacteria 1892
137 Ga0157379_10006642 3300014968 Bacteria 9980
138 Ga0157376_10085855 3300014969 Bacteria 2712
139 Ga0213872_10034640 3300021361 Bacteria 2311
140 Ga0213872_10048695 3300021361 Bacteria 1926
141 Ga0213876_10000130 3300021384 Bacteria 81967
142 Ga0213871_10030191 3300021441 Bacteria 1409
143 Ga0213871_10044856 3300021441 Bacteria 1196
144 Ga0228598_1005683 3300024227 Bacteria 2599
145 Ga0209233_1002293 3300025261 Bacteria 7134
146 Ga0209233_1008990 3300025261 Bacteria 3057
147 Ga0209025_1053107 3300025294 Bacteria 1593
148 Ga0209257_1010814 3300025304 Bacteria 4526
149 Ga0207697_10035372 3300025315 Bacteria 2045
150 Ga0207692_10066504 3300025898 Bacteria 1884
151 Ga0207699_10259310 3300025906 Bacteria 1201
152 Ga0207705_10003526 3300025909 Bacteria 11920
153 Ga0207707_10003874 3300025912 Bacteria 13268
154 Ga0207707_10017265 3300025912 Bacteria 6289
155 Ga0207695_10069050 3300025913 Bacteria 3618
156 Ga0207695_10081479 3300025913 Bacteria 3275
157 Ga0207671_10162612 3300025914 Bacteria 1729
158 Ga0207693_10017660 3300025915 Bacteria 5688
159 Ga0207663_10025255 3300025916 Bacteria 3432
160 Ga0207660_10089440 3300025917 Bacteria 2279
161 Ga0207657_10013834 3300025919 Bacteria 7897
162 Ga0207644_10127265 3300025931 Bacteria 1946
163 Ga0207691_10150524 3300025940 Bacteria 2046
164 Ga0207711_10119510 3300025941 Bacteria 2351
165 Ga0207661_10158516 3300025944 Bacteria 1962
166 Ga0207661_10497456 3300025944 Bacteria 1114
167 Ga0207667_10037084 3300025949 Bacteria 5214
168 Ga0207658_10051795 3300025986 Bacteria 3027
169 Ga0207703_10021926 3300026035 Bacteria 5002
170 Ga0207639_10306754 3300026041 Bacteria 1405
171 Ga0207678_10027109 3300026067 Bacteria 4996
172 Ga0207702_10071299 3300026078 Bacteria 2991
173 Ga0207641_10050088 3300026088 Bacteria 3533
174 Ga0207676_10067232 3300026095 Bacteria 2862
175 Ga0207683_10039727 3300026121 Bacteria 4105
176 Ga0209179_1002942 3300027512 Bacteria 2381
177 Ga0209974_10029266 3300027876 Bacteria 1824
178 Ga0207428_10000219 3300027907 Bacteria 79717
179 Ga0268266_10071331 3300028379 Bacteria 3011
180 Ga0268266_10285401 3300028379 Bacteria 1536
181 Ga0265334_10001560 3300028573 Bacteria 11039
182 Ga0265338_10026478 3300028800 Bacteria 5846
183 Ga0265338_10056371 3300028800 Bacteria 3485
184 Ga0265338_10087780 3300028800 Bacteria 2583
185 Ga0265338_10161562 3300028800 Bacteria 1729
186 Ga0265325_10008336 3300031241 Bacteria 6121
187 Ga0265325_10150068 3300031241 Bacteria 1103
188 Ga0265340_10033125 3300031247 Bacteria 2575
189 Ga0265340_10045766 3300031247 Bacteria 2136
190 Ga0265339_10000137 3300031249 Bacteria 60322
191 Ga0265339_10002052 3300031249 Bacteria 14798
192 Ga0265327_10000742 3300031251 Bacteria 50671
193 Ga0265327_10000881 3300031251 Bacteria 44377
194 Ga0265327_10003707 3300031251 Bacteria 14241
195 Ga0265327_10033545 3300031251 Bacteria 2859
196 Ga0265327_10033945 3300031251 Bacteria 2837
197 Ga0265316_10001619 3300031344 Bacteria 24014
198 Ga0265316_10004775 3300031344 Bacteria 13370
199 Ga0265316_10068276 3300031344 Bacteria 2747
200 Ga0265313_10000782 3300031595 Bacteria 32152
201 Ga0307508_10000105 3300031616 Bacteria 99107
202 Ga0316575_10003138 3300031665 Bacteria 5647
203 Ga0316575_10005544 3300031665 Bacteria 4501
204 Ga0316575_10043597 3300031665 Bacteria 1778
205 Ga0316579_10000638 3300031691 Bacteria 11884
206 Ga0316579_10001822 3300031691 Bacteria 7867
207 Ga0316579_10004581 3300031691 Bacteria 5501
208 Ga0316579_10008234 3300031691 Bacteria 4340
209 Ga0316579_10022911 3300031691 Bacteria 2798
210 Ga0316579_10027196 3300031691 Bacteria 2595
211 Ga0265314_10004203 3300031711 Bacteria 13513
212 Ga0265314_10021511 3300031711 Bacteria 4956
213 Ga0265314_10080132 3300031711 Bacteria 2157
214 Ga0316576_10083088 3300031727 Bacteria 2379
215 Ga0316576_10172436 3300031727 Bacteria 1633
216 Ga0316578_10005177 3300031728 Bacteria 6289
217 Ga0316578_10055741 3300031728 Bacteria 2320
218 Ga0307516_10000657 3300031730 Bacteria 46760
219 Ga0307516_10025929 3300031730 Bacteria 5960
220 Ga0316577_10002289 3300031733 Bacteria 9440
221 Ga0316577_10002995 3300031733 Bacteria 8458
222 Ga0307406_10309247 3300031901 Bacteria 1218
223 Ga0307409_100067374 3300031995 Bacteria 2827
224 Ga0316585_10000195 3300032137 Bacteria 12419
225 Ga0316585_10002967 3300032137 Bacteria 4632
226 Ga0316580_10001428 3300032139 Bacteria 6234
227 Ga0316593_10088053 3300032168 Bacteria 1091
228 Ga0315911_1000003 3300033442 Bacteria 502217
229 Ga0373926_0003849 3300035083 Bacteria 4901
230 Ga0373944_0000604 3300035089 Bacteria 8539
231 Ga0373949_0025860 3300035090 Bacteria 1372
232 Ga0373932_0004658 3300035112 Bacteria 3239
233 Ga0373936_0003825 3300035113 Bacteria 5668
234 Ga0373939_0044504 3300035114 Bacteria 1351
235 Ga0373945_0001800 3300035116 Bacteria 6616
236 Ga0373954_0000062 3300035118 Bacteria 38112
237 Ga0373954_0025920 3300035118 Bacteria 2684
238 Ga0373957_0020306 3300035120 Bacteria 2346
239 Ga0373957_0072616 3300035120 Bacteria 1348
240 Ga0373943_0007472 3300035170 Bacteria 4910
241 Ga0373946_0004350 3300035171 Bacteria 5069
242 Ga0373946_0029888 3300035171 Bacteria 2172
243 Ga0373955_0073867 3300035172 Bacteria 1912
244 Ga0373961_0028767 3300035241 Bacteria 1534
245 Ga0316574_0006936 3300035398 Bacteria 6168
246 Ga0316574_0047906 3300035398 Bacteria 2654
247 Ga0316574_0089001 3300035398 Bacteria 1966
248 Ga0316574_0095231 3300035398 Bacteria 1902
249 Ga0373924_0003093 3300035410 Bacteria 5679
250 Ga0373931_0031368 3300035691 Bacteria 2743
251 Ga0373935_0002036 3300035692 Bacteria 11424
252 Ga0373935_0016174 3300035692 Bacteria 4515
253 Ga0373935_0030724 3300035692 Bacteria 3330
254 Ga0373927_0008757 3300035695 Bacteria 6798
255 Ga0373927_0017373 3300035695 Bacteria 4735
256 Ga0373927_0031229 3300035695 Bacteria 3473
257 Ga0373927_0193005 3300035695 Bacteria 1336
258 Ga0373933_0005995 3300035724 Bacteria 6615
259 Ga0373933_0086134 3300035724 Bacteria 1933
260 Ga0373947_0004669 3300035725 Bacteria 8029
261 Ga0373947_0016784 3300035725 Bacteria 4206
262 Ga0373947_0048990 3300035725 Bacteria 2536
263 Ga0373937_0002933 3300036401 Bacteria 14270
264 Ga0373937_0006804 3300036401 Bacteria 9867
265 Ga0373937_0008181 3300036401 Bacteria 9084
266 Ga0373937_0029181 3300036401 Bacteria 4995
267 Ga0316582_0003599 3300036647 Bacteria 7639
268 Ga0316582_0004787 3300036647 Bacteria 6896
269 Ga0316582_0010970 3300036647 Bacteria 4991
270 Ga0316582_0037763 3300036647 Bacteria 2997
271 Ga0316584_0006337 3300036712 Bacteria 8016
272 Ga0316584_0017667 3300036712 Bacteria 5134
273 Ga0316584_0042040 3300036712 Bacteria 3408
274 Ga0316584_0049027 3300036712 Bacteria 3156
275 Ga0316584_0063254 3300036712 Bacteria 2770
276 Ga0316584_0087930 3300036712 Bacteria 2326
277 Ga0316584_0139275 3300036712 Bacteria 1810
278 Ga0373925_0033905 3300037068 Bacteria 3762
279 Ga0373925_0038765 3300037068 Bacteria 3524
280 Ga0373925_0073484 3300037068 Bacteria 2588
281 Ga0395899_0002665 3300037312 Bacteria 14397
282 Ga0395899_0006791 3300037312 Bacteria 8869
283 Ga0395900_0000381 3300037418 Bacteria 63938
284 Ga0395900_0009733 3300037418 Bacteria 9844
285 Ga0395900_0097182 3300037418 Bacteria 3026
286 Ga0395898_0007562 3300037466 Bacteria 11536
287 Ga0395898_0049607 3300037466 Bacteria 4112
288 Ga0395898_0077798 3300037466 Bacteria 3202
289 Ga0395905_0004769 3300037471 Bacteria 14012
290 Ga0395905_0020451 3300037471 Bacteria 6271
291 Ga0316581_0000030 3300037588 Bacteria 15125
292 Ga0316581_0005303 3300037588 Bacteria 3348
293 Ga0316581_0042087 3300037588 Bacteria 1393
294 Ga0395901_0002517 3300038443 Bacteria 18553
295 Ga0395901_0038732 3300038443 Bacteria 4931
296 Ga0395901_0045854 3300038443 Bacteria 4539
297 Ga0395901_0118900 3300038443 Bacteria 2776
298 Ga0436365_0031959 3300039437 Bacteria 106267
299 Ga0436365_1292461 3300039437 Bacteria 3052
300 Ga0436360_0073247 3300039438 Bacteria 3068
301 Ga0436360_0149353 3300039438 Bacteria 3896
302 Ga0436360_0361778 3300039438 Bacteria 2261
303 Ga0436360_0708065 3300039438 Bacteria 1156
304 Ga0436360_1074814 3300039438 Bacteria 5161
305 Ga0436360_1367695 3300039438 Bacteria 2477
306 Ga0436361_0063454 3300039447 Bacteria 2685
307 Ga0436361_0369023 3300039447 Bacteria 6346
308 Ga0436361_0428243 3300039447 Bacteria 2594
309 Ga0436361_0539018 3300039447 Bacteria 2789
310 Ga0436363_0642160 3300039450 Bacteria 1756
311 Ga0436363_1372834 3300039450 Bacteria 2160
312 Ga0436362_0994339 3300039453 Bacteria 2852
313 Ga0436362_1025120 3300039453 Bacteria 1305
314 Ga0439436_0002272 3300041404 Bacteria 5754
315 Ga0439465_0002393 3300041413 Bacteria 6138
316 Ga0439441_007658 3300042001 Bacteria 1747
317 Ga0439462_0034633 3300042015 Bacteria 1341
318 Ga0450920_006237 3300042122 Bacteria 2140
319 Ga0439459_0022052 3300042438 Bacteria 1229
320 Ga0450918_004771 3300042531 Bacteria 2458
321 Ga0451577_0000035 3300042876 Bacteria 373467
322 Ga0451577_0000471 3300042876 Bacteria 69254
323 Ga0451577_0000739 3300042876 Bacteria 50382
324 Ga0451577_0002216 3300042876 Bacteria 23670
325 Ga0451577_0015764 3300042876 Bacteria 7015
326 Ga0451577_0045736 3300042876 Bacteria 3918
327 Ga0451577_0211162 3300042876 Bacteria 1753
328 Ga0451577_0305914 3300042876 Bacteria 1441
329 Ga0451577_0330122 3300042876 Bacteria 1383
330 Ga0453683_0000095 3300044673 Bacteria 132405
331 Ga0453683_0190319 3300044673 Bacteria 1302
332 Ga0466961_0051113 3300044693 Bacteria 2640
333 Ga0466963_0035869 3300044694 Bacteria 3231
334 Ga0453684_0000006 3300044712 Bacteria 1364191
335 Ga0453684_0000031 3300044712 Bacteria 752632
336 Ga0453684_0000089 3300044712 Bacteria 395064
337 Ga0453684_0000097 3300044712 Bacteria 377772
338 Ga0453684_0000176 3300044712 Bacteria 283097
339 Ga0453684_0000177 3300044712 Bacteria 282969
340 Ga0453684_0000732 3300044712 Bacteria 114945
341 Ga0453684_0002182 3300044712 Bacteria 48823
342 Ga0453684_0005947 3300044712 Bacteria 23665
343 Ga0453684_0006440 3300044712 Bacteria 22295
344 Ga0453684_0010364 3300044712 Bacteria 15951
345 Ga0453684_0014620 3300044712 Bacteria 12530
346 Ga0453684_0021800 3300044712 Bacteria 9544
347 Ga0453684_0025660 3300044712 Bacteria 8548
348 Ga0453684_0032406 3300044712 Bacteria 7315
349 Ga0453684_0032690 3300044712 Bacteria 7272
350 Ga0453684_0033541 3300044712 Bacteria 7154
351 Ga0453684_0073235 3300044712 Bacteria 4320
352 Ga0453684_0100025 3300044712 Bacteria 3550
353 Ga0453684_0100546 3300044712 Bacteria 3539
354 Ga0453684_0105141 3300044712 Bacteria 3444
355 Ga0453684_0133742 3300044712 Bacteria 2972
356 Ga0453684_0922051 3300044712 Bacteria 934
357 Ga0466971_0011207 3300044719 Bacteria 3928
358 Ga0451576_0000056 3300045051 Bacteria 303398
359 Ga0451576_0000361 3300045051 Bacteria 109138
360 Ga0451576_0000806 3300045051 Bacteria 61449
361 Ga0451576_0001345 3300045051 Bacteria 42474
362 Ga0451576_0023943 3300045051 Bacteria 6601
363 Ga0451576_0025858 3300045051 Bacteria 6322
364 Ga0451576_0173741 3300045051 Bacteria 2249
365 Ga0451576_0334927 3300045051 Bacteria 1584
366 Ga0451576_0609320 3300045051 Bacteria 1148
367 Ga0466958_0022162 3300045836 Bacteria 3719
368 Ga0495592_0003291 3300046454 Bacteria 11580
369 Ga0495592_0179686 3300046454 Bacteria 1442
370 Ga0495592_0428408 3300046454 Bacteria 833
371 Ga0495603_0002952 3300046455 Bacteria 10061
372 Ga0495603_0027620 3300046455 Bacteria 3424
373 Ga0495591_042423 3300046458 Bacteria 1286
374 Ga0495629_0001640 3300046459 Bacteria 17572
375 Ga0495629_0020353 3300046459 Bacteria 4740
376 Ga0495629_0023236 3300046459 Bacteria 4418
377 Ga0495641_0003962 3300046461 Bacteria 10757
378 Ga0495641_0011719 3300046461 Bacteria 4965
379 Ga0495651_0008882 3300046462 Bacteria 7716
380 Ga0495653_0020998 3300046463 Bacteria 5291
381 Ga0495580_0004604 3300046472 Bacteria 11573
382 Ga0495582_0005832 3300046473 Bacteria 6861
383 Ga0495582_0011370 3300046473 Bacteria 4905
384 Ga0495582_0045136 3300046473 Bacteria 2427
385 Ga0495582_0108975 3300046473 Bacteria 1555
386 Ga0495639_0001566 3300046475 Bacteria 10222
387 Ga0495639_0026056 3300046475 Bacteria 2582
388 Ga0495662_0010471 3300046476 Bacteria 4540
389 Ga0495662_0091346 3300046476 Bacteria 1485
390 Ga0495664_0005011 3300046477 Bacteria 7249
391 Ga0495664_0016146 3300046477 Bacteria 4252
392 Ga0495584_0017160 3300046491 Bacteria 3689
393 Ga0495584_0054883 3300046491 Bacteria 2005
394 Ga0495585_0018483 3300046492 Bacteria 4019
395 Ga0495585_0083604 3300046492 Bacteria 1727
396 Ga0495594_0016763 3300046499 Bacteria 3863
397 Ga0495594_0060909 3300046499 Bacteria 2088
398 Ga0495594_0216700 3300046499 Bacteria 1092
399 Ga0495607_0007920 3300046501 Bacteria 7305
400 Ga0495606_0032077 3300046507 Bacteria 3644
401 Ga0495608_0006686 3300046511 Bacteria 8177
402 Ga0495608_0010335 3300046511 Bacteria 6513
403 Ga0495608_0186712 3300046511 Bacteria 1310
404 Ga0495618_0012578 3300046514 Bacteria 5141
405 Ga0495618_0123901 3300046514 Bacteria 1655
406 Ga0495628_0010228 3300046516 Bacteria 7981
407 Ga0495630_0041990 3300046517 Bacteria 3415
408 Ga0495644_0004819 3300046523 Bacteria 5305
409 Ga0495648_0015002 3300046524 Bacteria 5644
410 Ga0495666_0004818 3300046526 Bacteria 6823
411 Ga0495666_0006104 3300046526 Bacteria 6060
412 Ga0495652_0018574 3300046529 Bacteria 6197
413 Ga0495652_0040865 3300046529 Bacteria 4008
414 Ga0495665_0008763 3300046531 Bacteria 5491
415 Ga0495665_0021877 3300046531 Bacteria 3439
416 Ga0495640_0041943 3300046533 Bacteria 3195
417 Ga0495640_0061733 3300046533 Bacteria 2544
418 Ga0495586_0004394 3300046535 Bacteria 7529
419 Ga0495587_0018466 3300046536 Bacteria 4325
420 Ga0495587_0097553 3300046536 Bacteria 1695
421 Ga0495621_0081752 3300046539 Bacteria 1205
422 Ga0495645_0001251 3300046543 Bacteria 17319
423 Ga0495622_0017687 3300046557 Bacteria 3318
424 Ga0495633_0010960 3300046558 Bacteria 4923
425 Ga0495667_0024282 3300046559 Bacteria 4082
426 Ga0495667_0067972 3300046559 Bacteria 2328
427 Ga0495667_0225723 3300046559 Bacteria 1194
428 Ga0495656_0001215 3300046615 Bacteria 8389
429 Ga0495656_0077176 3300046615 Bacteria 1494
430 Ga0495668_0198921 3300046616 Bacteria 1097
431 Ga0495634_0078762 3300046642 Bacteria 2158
432 Ga0495611_0003868 3300046648 Bacteria 6533
433 Ga0495635_0007616 3300046663 Bacteria 7556
434 Ga0495635_0117106 3300046663 Bacteria 1818
435 Ga0495659_0001029 3300046664 Bacteria 9737
436 Ga0495588_0003197 3300046674 Bacteria 7093
437 Ga0495588_0075845 3300046674 Bacteria 1752
438 Ga0495657_0028272 3300046675 Bacteria 3947
439 Ga0495599_0005701 3300046678 Bacteria 7470
440 Ga0495599_0028550 3300046678 Bacteria 3497
441 Ga0495646_0009398 3300046680 Bacteria 6203
442 Ga0495646_0111340 3300046680 Bacteria 1558
443 Ga0495647_0004286 3300046681 Bacteria 4620
444 Ga0495647_0010294 3300046681 Bacteria 3183
445 Ga0495658_0002463 3300046683 Bacteria 9322
446 Ga0495658_0005737 3300046683 Bacteria 6099
447 Ga0495658_0068503 3300046683 Bacteria 2055
448 Ga0495658_0239895 3300046683 Bacteria 1138
449 Ga0495613_0000615 3300046689 Bacteria 28420
450 Ga0495613_0013607 3300046689 Bacteria 6039
451 Ga0495613_0029172 3300046689 Bacteria 4103
452 Ga0495624_0009958 3300046690 Bacteria 6572
453 Ga0495624_0018144 3300046690 Bacteria 4708
454 Ga0495670_0001068 3300046691 Bacteria 13296
455 Ga0495670_0022339 3300046691 Bacteria 3124
456 Ga0495671_0041925 3300046692 Bacteria 2303
457 Ga0495589_0072186 3300046794 Bacteria 1686
458 Ga0495600_0005021 3300046809 Bacteria 7954
459 Ga0495600_0025066 3300046809 Bacteria 3843
460 Ga0495600_0145126 3300046809 Bacteria 1538
461 Ga0495600_0298987 3300046809 Bacteria 1016
462 Ga0495581_0002747 3300047315 Bacteria 10042
463 Ga0495581_0082642 3300047315 Bacteria 1860
464 Ga0495604_0004824 3300047317 Bacteria 10692
465 Ga0495604_0022472 3300047317 Bacteria 5036
466 Ga0495604_0023196 3300047317 Bacteria 4953
467 Ga0495636_0046928 3300047318 Bacteria 1803
468 Ga0495636_0051239 3300047318 Bacteria 1730
469 Ga0495674_0038965 3300047319 Bacteria 4262
470 Ga0495674_0044084 3300047319 Bacteria 3967
471 Ga0495674_0151742 3300047319 Bacteria 1942
472 Ga0495676_0014348 3300047321 Bacteria 7090
473 Ga0495676_0056171 3300047321 Bacteria 3115
474 Ga0495676_0095015 3300047321 Bacteria 2219
475 Ga0495680_0019669 3300047322 Bacteria 5697
476 Ga0495680_0035652 3300047322 Bacteria 4005
477 Ga0495680_0083563 3300047322 Bacteria 2407
478 Ga0495680_0086644 3300047322 Bacteria 2356
479 Ga0495675_0006704 3300047444 Bacteria 7057
480 Ga0495679_048937 3300047446 Bacteria 1276
481 Ga0495684_0003597 3300047471 Bacteria 12086
482 Ga0495684_0046226 3300047471 Bacteria 3330
483 Ga0495684_0348629 3300047471 Bacteria 1052
484 Ga0495593_0014183 3300047673 Bacteria 4534
485 Ga0495602_0005528 3300048088 Bacteria 13260
486 Ga0495602_0199172 3300048088 Bacteria 1529
487 Ga0496100_0000842 3300048903 Bacteria 14711
488 Ga0496100_0029617 3300048903 Bacteria 3388
489 Ga0496101_0001211 3300048904 Bacteria 15442
490 Ga0496101_0001457 3300048904 Bacteria 14119
491 Ga0496101_0010153 3300048904 Bacteria 6211
492 Ga0496101_0058675 3300048904 Bacteria 2788
493 Ga0496102_0009064 3300048905 Bacteria 8537
494 Ga0496102_0011697 3300048905 Bacteria 7572
495 Ga0496102_0022723 3300048905 Bacteria 5558
496 Ga0496102_0070554 3300048905 Bacteria 3208
497 Ga0496102_0257613 3300048905 Bacteria 1645
498 Ga0496103_0010836 3300048906 Bacteria 5396
499 Ga0496103_0033318 3300048906 Bacteria 3147
500 Ga0496104_0000602 3300048907 Bacteria 30848
501 Ga0496104_0016899 3300048907 Bacteria 6635
502 Ga0496104_0026031 3300048907 Bacteria 5396
503 Ga0496104_0406781 3300048907 Bacteria 1273
504 Ga0496105_0003655 3300048908 Bacteria 11434
505 Ga0496105_0015020 3300048908 Bacteria 6161
506 Ga0496105_0064241 3300048908 Bacteria 3028
507 Ga0496105_0077378 3300048908 Bacteria 2748
508 Ga0496105_0115671 3300048908 Bacteria 2212
509 Ga0496106_0000405 3300048909 Bacteria 30644
510 Ga0496106_0032059 3300048909 Bacteria 3916
511 Ga0496106_0092378 3300048909 Bacteria 2337
512 Ga0496106_0194991 3300048909 Bacteria 1611
513 Ga0496107_0001082 3300048910 Bacteria 16345
514 Ga0496108_0003869 3300048911 Bacteria 12021
515 Ga0496108_0011968 3300048911 Bacteria 7058
516 Ga0496108_0012570 3300048911 Bacteria 6896
517 Ga0496108_0034009 3300048911 Bacteria 4233
518 Ga0496108_0043876 3300048911 Bacteria 3735
519 Ga0496108_0507883 3300048911 Bacteria 1053
520 Ga0496109_0006129 3300048912 Bacteria 10104
521 Ga0496109_0006276 3300048912 Bacteria 10002
522 Ga0496109_0009555 3300048912 Bacteria 8267
523 Ga0496109_0052215 3300048912 Bacteria 3725
524 Ga0496109_0123808 3300048912 Bacteria 2410
525 Ga0496110_0000468 3300048913 Bacteria 27460
526 Ga0496110_0015322 3300048913 Bacteria 6377
527 Ga0496110_0045555 3300048913 Bacteria 3834
528 Ga0496110_0056143 3300048913 Bacteria 3465
529 Ga0496110_0075344 3300048913 Bacteria 2998
530 Ga0496111_0001714 3300048914 Bacteria 12814
531 Ga0496111_0004338 3300048914 Bacteria 8949
532 Ga0496111_0037892 3300048914 Bacteria 3452
533 Ga0496112_0000527 3300048915 Bacteria 26121
534 Ga0496112_0004838 3300048915 Bacteria 11498
535 Ga0496112_0011978 3300048915 Bacteria 7950
536 Ga0496112_0023637 3300048915 Bacteria 5876
537 Ga0496112_0089626 3300048915 Bacteria 3044
538 Ga0496112_0113744 3300048915 Bacteria 2677
539 Ga0496112_0372948 3300048915 Bacteria 1368
540 Ga0496113_0003961 3300048916 Bacteria 8995
541 Ga0496113_0004231 3300048916 Bacteria 8782
542 Ga0496113_0011383 3300048916 Bacteria 5931
543 Ga0496113_0037525 3300048916 Bacteria 3557
544 Ga0496114_0005042 3300048917 Bacteria 10300
545 Ga0496114_0104086 3300048917 Bacteria 2427
546 Ga0496114_0104954 3300048917 Bacteria 2417
547 Ga0496115_0005817 3300048918 Bacteria 8984
548 Ga0496115_0013101 3300048918 Bacteria 6262
549 Ga0496115_0069948 3300048918 Bacteria 2844
550 Ga0496115_0388149 3300048918 Bacteria 1134
551 Ga0496126_0027336 3300048929 Bacteria 5451
552 Ga0501031_0026174 3300049568 Bacteria 3805
553 Ga0501032_0092511 3300049569 Bacteria 2006
554 Ga0501033_0007670 3300049570 Bacteria 8373
555 Ga0501034_0544156 3300049571 Bacteria 1071
556 Ga0501036_0016482 3300049572 Bacteria 6172
557 Ga0501036_0058938 3300049572 Bacteria 3253
558 Ga0501037_0105216 3300049573 Bacteria 2034
559 Ga0501037_0110705 3300049573 Bacteria 1978
560 Ga0501038_0000545 3300049574 Bacteria 33068
561 Ga0501038_0043917 3300049574 Bacteria 3885
562 Ga0501038_0090782 3300049574 Bacteria 2560
563 Ga0501039_0021356 3300049575 Bacteria 4967
564 Ga0501039_0032164 3300049575 Bacteria 4043
565 Ga0501040_0009859 3300049576 Bacteria 6238
566 Ga0501040_0044710 3300049576 Bacteria 3020
567 Ga0501041_0019389 3300049577 Bacteria 4061
568 Ga0501042_0005234 3300049578 Bacteria 8334
569 Ga0501042_0159609 3300049578 Bacteria 1627
570 Ga0501042_0311537 3300049578 Bacteria 1137
571 Ga0501043_0007360 3300049579 Bacteria 8734
572 Ga0501043_0013428 3300049579 Bacteria 6406
573 Ga0501043_0160774 3300049579 Bacteria 1755
574 Ga0501046_0006010 3300049580 Bacteria 10799
575 Ga0501046_0014699 3300049580 Bacteria 6592
576 Ga0501047_0002872 3300049581 Bacteria 16357
577 Ga0501047_0036178 3300049581 Bacteria 4770
578 Ga0501047_0096900 3300049581 Bacteria 2828
579 Ga0501047_0124159 3300049581 Bacteria 2462
580 Ga0501047_0235156 3300049581 Bacteria 1684
581 Ga0501067_0014516 3300049583 Bacteria 4361
582 Ga0501067_0046793 3300049583 Bacteria 2401
583 Ga0501068_0021670 3300049584 Bacteria 3754
584 Ga0501069_0007215 3300049585 Bacteria 5825
585 Ga0501070_0003270 3300049586 Bacteria 14061
586 Ga0501070_0043932 3300049586 Bacteria 3718
587 Ga0501070_0044384 3300049586 Bacteria 3699
588 Ga0501071_0139943 3300049587 Bacteria 1802
589 Ga0501071_0156422 3300049587 Bacteria 1702
590 Ga0501072_0013914 3300049588 Bacteria 6166
591 Ga0501074_0011655 3300049590 Bacteria 6389
592 Ga0501074_0035356 3300049590 Bacteria 3620
593 Ga0501074_0043753 3300049590 Bacteria 3241
594 Ga0501075_0023569 3300049591 Bacteria 4508
595 Ga0501076_0009701 3300049592 Bacteria 7112
596 Ga0501076_0016338 3300049592 Bacteria 5628
597 Ga0501076_0114869 3300049592 Bacteria 2178
598 Ga0501076_0336498 3300049592 Bacteria 1239
599 Ga0501077_0005430 3300049593 Bacteria 7754
600 Ga0501077_0061228 3300049593 Bacteria 2388
601 Ga0501079_0007946 3300049741 Bacteria 8044
602 Ga0501079_0010988 3300049741 Bacteria 6898
603 Ga0501079_0081736 3300049741 Bacteria 2498
604 Ga0501080_0000340 3300049742 Bacteria 35875
605 Ga0501080_0019745 3300049742 Bacteria 6240
606 Ga0501080_0082162 3300049742 Bacteria 2993
607 Ga0501080_0084625 3300049742 Bacteria 2947
608 Ga0501081_0002877 3300049743 Bacteria 10931
609 Ga0501081_0011140 3300049743 Bacteria 5880
610 Ga0501081_0013714 3300049743 Bacteria 5329
611 Ga0501035_0067270 3300049822 Bacteria 3180
612 Ga0501035_0160626 3300049822 Bacteria 1945
613 Ga0501035_0230697 3300049822 Bacteria 1578
614 Ga0501035_0246704 3300049822 Bacteria 1517
615 Ga0501044_0014341 3300049823 Bacteria 8556
616 Ga0501045_0011927 3300049824 Bacteria 6110
617 Ga0501045_0020987 3300049824 Bacteria 4669
618 Ga0501045_0094827 3300049824 Bacteria 2207
619 nmdc:mga03683_17787_c1 3300050489 Bacteria 2695
620 nmdc:mga05p37_33457_c1 3300050507 Bacteria 6295
621 nmdc:mga05p37_44774_c1 3300050507 Bacteria 5444
622 nmdc:mga09592_10439_c1 3300050508 Bacteria 7557
623 nmdc:mga09592_78389_c1 3300050508 Bacteria 2811
624 nmdc:mga0qj67_11760_c1 3300050509 Bacteria 6569
625 nmdc:mga06r32_13597_c1 3300050510 Bacteria 7379
626 nmdc:mga08y16_1925_c1 3300050511 Bacteria 21181
627 nmdc:mga0n895_124457_c1 3300050512 Bacteria 2601
628 nmdc:mga0n895_167910_c1 3300050512 Bacteria 2226
629 nmdc:mga0n895_329747_c1 3300050512 Bacteria 1546
630 nmdc:mga0n895_4364_c1 3300050512 Bacteria 11597
631 nmdc:mga0n895_65942_c1 3300050512 Bacteria 3585
632 nmdc:mga0rr50_342559_c1 3300050513 Bacteria 1256
633 nmdc:mga0rr50_68049_c1 3300050513 Bacteria 2707
634 nmdc:mga0a205_6620_c1 3300050515 Bacteria 10485
635 nmdc:mga0a205_89786_c1 3300050515 Bacteria 2970
636 Ga0495601_0001548 3300053077 Bacteria 12709
637 Ga0495601_0005375 3300053077 Bacteria 7460
638 Ga0495601_0045414 3300053077 Bacteria 2762
639 Ga0495601_0066984 3300053077 Bacteria 2286
640 Ga0495612_0003002 3300053078 Bacteria 7007
641 Ga0495612_0006083 3300053078 Bacteria 4966
642 Ga0495612_0009510 3300053078 Bacteria 3940
643 Ga0495612_0028706 3300053078 Bacteria 2240
644 Ga0495612_0078658 3300053078 Bacteria 1384
645 Ga0495612_0102084 3300053078 Bacteria 1222
646 Ga0495655_0007882 3300053083 Bacteria 2001
647 Ga0495595_0002759 3300053084 Bacteria 6902
648 Ga0495595_0016473 3300053084 Bacteria 3163
649 Ga0495619_0000052 3300053085 Bacteria 98882
650 Ga0495619_0000821 3300053085 Bacteria 20348
651 Ga0495619_0046030 3300053085 Bacteria 2867
652 Ga0500566_0000049 3300053094 Bacteria 57920
653 Ga0500641_0007196 3300053096 Bacteria 3967
654 Ga0500572_000476 3300053111 Bacteria 13916
655 Ga0500591_027619 3300053115 Bacteria 2748
656 Ga0500608_030856 3300053122 Bacteria 2542
657 Ga0500658_0186483 3300053134 Bacteria 946
658 Ga0500559_0000654 3300053136 Bacteria 23267
659 Ga0500559_0016101 3300053136 Bacteria 3158
660 Ga0500590_065126 3300053148 Bacteria 1823
661 Ga0500603_000031 3300053150 Bacteria 34081
662 Ga0500616_0145981 3300053153 Bacteria 1100
663 Ga0500630_000581 3300053159 Bacteria 16620
664 Ga0500639_000020 3300053163 Bacteria 102959
665 Ga0500636_0070433 3300053177 Bacteria 2029
666 Ga0500637_0007143 3300053178 Bacteria 5566
667 Ga0500596_003763 3300053735 Bacteria 2848
668 Ga0500601_006297 3300053737 Bacteria 1308
669 Ga0501084_0008741 3300054114 Bacteria 8374
670 Ga0501084_0014440 3300054114 Bacteria 6545
671 Ga0501084_0274441 3300054114 Bacteria 1423
672 Ga0501084_0287785 3300054114 Bacteria 1388
673 Ga0501082_0005251 3300060353 Bacteria 11259
674 Ga0501082_0115603 3300060353 Bacteria 2323
675 Ga0501082_0171500 3300060353 Bacteria 1886
676 Ga0530510_0013479 3300061734 Bacteria 5747
677 Ga0530510_0079726 3300061734 Bacteria 2381
678 2513657247 2513237096 Bacteria 8722461
679 2513715400 2513237104 Bacteria 10034502
680 2513857715 2513237137 Bacteria 9558895
681 2513919255 2513237145 Bacteria 8979722
682 2517411314 2517287029 Bacteria 6905599
683 2517891048 2517572143 Bacteria 9484767
684 2599106409 2597490356 Bacteria 7030811
685 2644104486 2643221618 Bacteria 7717186
686 2793066402 2791355197 Bacteria 8420563
687 2842333887 2842333319 Bacteria 8899485
688 2846956207 2846952575 Bacteria 6587527
689 2897807417 2897803580 Bacteria 7000062
690 2906616245
691 2906640335 2906635258 Bacteria 8601019
692 2906667255 2906660503 Bacteria 8595048
693 2922431761
694 2932796601 2932794094 Bacteria 7915132
695 2932802617 2932801729 Bacteria 7987968
696 2935768584 2935760218 Bacteria 9817913
697 2935883572 2935883170 Bacteria 7964738
698 2935967063 2935959822 Bacteria 7869783
699 2941506184 2941499720 Bacteria 7599444
700 3005481579 3005474847 Bacteria 9259049
701 8006932277 8006926726 Bacteria 6749210
702 8006943173 8006933436 Bacteria 10410654
703 8006982968 8006973647 Bacteria 10679141
704 8019575115 8019565922 Bacteria 9639779
705 Ga0400487_03596
706 JGI24740J21852_10024687
707 JGI24737J22298_10048358
708 JGI25153J46596_10000946
709 JGI25404J52841_10015246
710 Ga0065165_1000785
711 Ga0065715_10104321
712 Ga0065707_10091172
713 Ga0070658_10079674
714 Ga0070683_100006806
715 Ga0070683_100062439
716 Ga0070683_100163185
717 Ga0070666_10137277
718 Ga0070680_100042057
719 Ga0068868_100226201
720 Ga0070660_100003489
721 Ga0070689_100024765
722 Ga0070661_100411955
723 Ga0070669_100018253
724 Ga0070674_100237939
725 Ga0070673_100007902
726 Ga0070667_100101443
727 Ga0070667_100126654
728 Ga0070709_10112069
729 Ga0070713_100409851
730 Ga0070700_100248498
731 Ga0070694_100104069
732 Ga0070708_100018422
733 Ga0070708_100020728
734 Ga0070663_100009487
735 Ga0070663_100078723
736 Ga0070681_10004100
737 Ga0070681_10027203
738 Ga0070681_10442004
739 Ga0070685_10101294
740 Ga0070706_100009059
741 Ga0070698_100004962
742 Ga0070698_100413951
743 Ga0070699_100005057
744 Ga0070699_100010430
745 Ga0070679_100092199
746 Ga0070684_100133696
747 Ga0070684_100209282
748 Ga0070697_100033689
749 Ga0070697_100065682
750 Ga0068853_100255074
751 Ga0070672_100106865
752 Ga0070686_100091167
753 Ga0070696_100052793
754 Ga0070665_100109558
755 Ga0070665_100345927
756 Ga0070704_100005398
757 Ga0068855_100007706
758 Ga0068855_100037426
759 Ga0068855_100198230
760 Ga0068855_100406711
761 Ga0068857_100084493
762 Ga0068854_100082238
763 Ga0070702_100141454
764 Ga0068864_100080001
765 Ga0068866_10025656
766 Ga0068863_100265397
767 Ga0081455_10001555
768 Ga0081455_10002076
769 Ga0081455_10008768
770 Ga0081455_10044348
771 Ga0081455_10055152
772 Ga0081455_10217206
773 Ga0081540_1002923
774 Ga0081539_10019455
775 Ga0070717_10015928
776 Ga0070717_10054441
777 Ga0070717_10201423
778 Ga0075365_10130583
779 Ga0070712_100288144
780 Ga0075369_10031986
781 Ga0097621_100155598
782 Ga0097621_100500030
783 Ga0075428_100015159
784 Ga0075428_100594867
785 Ga0075430_100009149
786 Ga0075430_100218435
787 Ga0075431_100018426
788 Ga0075433_10028952
789 Ga0075434_100008951
790 Ga0075434_100276654
791 Ga0075429_100008886
792 Ga0075436_100001243
793 Ga0075436_100322393
794 Ga0075435_100020921
795 Ga0099794_10002299
796 Ga0099794_10008987
797 Ga0099794_10050643
798 Ga0099795_10004297
799 Ga0099795_10011809
800 Ga0099795_10024949
801 Ga0105240_10016507
802 Ga0105240_10020582
803 Ga0111539_10007260
804 Ga0111539_10015669
805 Ga0105247_10009021
806 Ga0105247_10011300
807 Ga0114129_10018961
808 Ga0114129_10024866
809 Ga0114129_10203045
810 Ga0114129_10535767
811 Ga0105243_10034348
812 Ga0105243_10052495
813 Ga0105242_10244586
814 Ga0105248_10275210
815 Ga0105237_10131772
816 Ga0105237_10150598
817 Ga0105238_10034573
818 Ga0105238_10037267
819 Ga0105238_10469470
820 Ga0105249_10011069
821 Ga0105249_10031333
822 Ga0099796_10001698
823 Ga0099796_10012365
824 Ga0099796_10025076
825 Ga0105239_10005103
826 Ga0105239_10046428
827 Ga0105239_10157445
828 Ga0105246_10282562
829 Ga0157370_10008657
830 Ga0157369_10634955
831 Ga0157374_10369865
832 Ga0157378_10030990
833 Ga0157378_10081545
834 Ga0157375_10003393
835 Ga0157375_10046525
836 Ga0163163_10006150
837 Ga0163163_10082676
838 Ga0163163_10116319
839 Ga0163163_10426129
840 Ga0157380_10172391
841 Ga0157379_10006642
842 Ga0157376_10085855
843 Ga0213872_10034640
844 Ga0213872_10048695
845 Ga0213876_10000130
846 Ga0213871_10030191
847 Ga0213871_10044856
848 Ga0228598_1005683
849 Ga0209233_1002293
850 Ga0209233_1008990
851 Ga0209025_1053107
852 Ga0209257_1010814
853 Ga0207697_10035372
854 Ga0207692_10066504
855 Ga0207699_10259310
856 Ga0207705_10003526
857 Ga0207707_10003874
858 Ga0207707_10017265
859 Ga0207695_10069050
860 Ga0207695_10081479
861 Ga0207671_10162612
862 Ga0207693_10017660
863 Ga0207663_10025255
864 Ga0207660_10089440
865 Ga0207657_10013834
866 Ga0207644_10127265
867 Ga0207691_10150524
868 Ga0207711_10119510
869 Ga0207661_10158516
870 Ga0207661_10497456
871 Ga0207667_10037084
872 Ga0207658_10051795
873 Ga0207703_10021926
874 Ga0207639_10306754
875 Ga0207678_10027109
876 Ga0207702_10071299
877 Ga0207641_10050088
878 Ga0207676_10067232
879 Ga0207683_10039727
880 Ga0209179_1002942
881 Ga0209974_10029266
882 Ga0207428_10000219
883 Ga0268266_10071331
884 Ga0268266_10285401
885 Ga0265334_10001560
886 Ga0265338_10026478
887 Ga0265338_10056371
888 Ga0265338_10087780
889 Ga0265338_10161562
890 Ga0265325_10008336
891 Ga0265325_10150068
892 Ga0265340_10033125
893 Ga0265340_10045766
894 Ga0265339_10000137
895 Ga0265339_10002052
896 Ga0265327_10000742
897 Ga0265327_10000881
898 Ga0265327_10003707
899 Ga0265327_10033545
900 Ga0265327_10033945
901 Ga0265316_10001619
902 Ga0265316_10004775
903 Ga0265316_10068276
904 Ga0265313_10000782
905 Ga0307508_10000105
906 Ga0316575_10003138
907 Ga0316575_10005544
908 Ga0316575_10043597
909 Ga0316579_10000638
910 Ga0316579_10001822
911 Ga0316579_10004581
912 Ga0316579_10008234
913 Ga0316579_10022911
914 Ga0316579_10027196
915 Ga0265314_10004203
916 Ga0265314_10021511
917 Ga0265314_10080132
918 Ga0316576_10083088
919 Ga0316576_10172436
920 Ga0316578_10005177
921 Ga0316578_10055741
922 Ga0307516_10000657
923 Ga0307516_10025929
924 Ga0316577_10002289
925 Ga0316577_10002995
926 Ga0307406_10309247
927 Ga0307409_100067374
928 Ga0316585_10000195
929 Ga0316585_10002967
930 Ga0316580_10001428
931 Ga0316593_10088053
932 Ga0315911_1000003
933 Ga0373926_0003849
934 Ga0373944_0000604
935 Ga0373949_0025860
936 Ga0373932_0004658
937 Ga0373936_0003825
938 Ga0373939_0044504
939 Ga0373945_0001800
940 Ga0373954_0000062
941 Ga0373954_0025920
942 Ga0373957_0020306
943 Ga0373957_0072616
944 Ga0373943_0007472
945 Ga0373946_0004350
946 Ga0373946_0029888
947 Ga0373955_0073867
948 Ga0373961_0028767
949 Ga0316574_0006936
950 Ga0316574_0047906
951 Ga0316574_0089001
952 Ga0316574_0095231
953 Ga0373924_0003093
954 Ga0373931_0031368
955 Ga0373935_0002036
956 Ga0373935_0016174
957 Ga0373935_0030724
958 Ga0373927_0008757
959 Ga0373927_0017373
960 Ga0373927_0031229
961 Ga0373927_0193005
962 Ga0373933_0005995
963 Ga0373933_0086134
964 Ga0373947_0004669
965 Ga0373947_0016784
966 Ga0373947_0048990
967 Ga0373937_0002933
968 Ga0373937_0006804
969 Ga0373937_0008181
970 Ga0373937_0029181
971 Ga0316582_0003599
972 Ga0316582_0004787
973 Ga0316582_0010970
974 Ga0316582_0037763
975 Ga0316584_0006337
976 Ga0316584_0017667
977 Ga0316584_0042040
978 Ga0316584_0049027
979 Ga0316584_0063254
980 Ga0316584_0087930
981 Ga0316584_0139275
982 Ga0373925_0033905
983 Ga0373925_0038765
984 Ga0373925_0073484
985 Ga0395899_0002665
986 Ga0395899_0006791
987 Ga0395900_0000381
988 Ga0395900_0009733
989 Ga0395900_0097182
990 Ga0395898_0007562
991 Ga0395898_0049607
992 Ga0395898_0077798
993 Ga0395905_0004769
994 Ga0395905_0020451
995 Ga0316581_0000030
996 Ga0316581_0005303
997 Ga0316581_0042087
998 Ga0395901_0002517
999 Ga0395901_0038732
1000 Ga0395901_0045854
1001 Ga0395901_0118900
1002 Ga0436365_0031959
1003 Ga0436365_1292461
1004 Ga0436360_0073247
1005 Ga0436360_0149353
1006 Ga0436360_0361778
1007 Ga0436360_0708065
1008 Ga0436360_1074814
1009 Ga0436360_1367695
1010 Ga0436361_0063454
1011 Ga0436361_0369023
1012 Ga0436361_0428243
1013 Ga0436361_0539018
1014 Ga0436363_0642160
1015 Ga0436363_1372834
1016 Ga0436362_0994339
1017 Ga0436362_1025120
1018 Ga0439436_0002272
1019 Ga0439465_0002393
1020 Ga0439441_007658
1021 Ga0439462_0034633
1022 Ga0450920_006237
1023 Ga0439459_0022052
1024 Ga0450918_004771
1025 Ga0451577_0000035
1026 Ga0451577_0000471
1027 Ga0451577_0000739
1028 Ga0451577_0002216
1029 Ga0451577_0015764
1030 Ga0451577_0045736
1031 Ga0451577_0211162
1032 Ga0451577_0305914
1033 Ga0451577_0330122
1034 Ga0453683_0000095
1035 Ga0453683_0190319
1036 Ga0466961_0051113
1037 Ga0466963_0035869
1038 Ga0453684_0000006
1039 Ga0453684_0000031
1040 Ga0453684_0000089
1041 Ga0453684_0000097
1042 Ga0453684_0000176
1043 Ga0453684_0000177
1044 Ga0453684_0000732
1045 Ga0453684_0002182
1046 Ga0453684_0005947
1047 Ga0453684_0006440
1048 Ga0453684_0010364
1049 Ga0453684_0014620
1050 Ga0453684_0021800
1051 Ga0453684_0025660
1052 Ga0453684_0032406
1053 Ga0453684_0032690
1054 Ga0453684_0033541
1055 Ga0453684_0073235
1056 Ga0453684_0100025
1057 Ga0453684_0100546
1058 Ga0453684_0105141
1059 Ga0453684_0133742
1060 Ga0453684_0922051
1061 Ga0466971_0011207
1062 Ga0451576_0000056
1063 Ga0451576_0000361
1064 Ga0451576_0000806
1065 Ga0451576_0001345
1066 Ga0451576_0023943
1067 Ga0451576_0025858
1068 Ga0451576_0173741
1069 Ga0451576_0334927
1070 Ga0451576_0609320
1071 Ga0466958_0022162
1072 Ga0495592_0003291
1073 Ga0495592_0179686
1074 Ga0495592_0428408
1075 Ga0495603_0002952
1076 Ga0495603_0027620
1077 Ga0495591_042423
1078 Ga0495629_0001640
1079 Ga0495629_0020353
1080 Ga0495629_0023236
1081 Ga0495641_0003962
1082 Ga0495641_0011719
1083 Ga0495651_0008882
1084 Ga0495653_0020998
1085 Ga0495580_0004604
1086 Ga0495582_0005832
1087 Ga0495582_0011370
1088 Ga0495582_0045136
1089 Ga0495582_0108975
1090 Ga0495639_0001566
1091 Ga0495639_0026056
1092 Ga0495662_0010471
1093 Ga0495662_0091346
1094 Ga0495664_0005011
1095 Ga0495664_0016146
1096 Ga0495584_0017160
1097 Ga0495584_0054883
1098 Ga0495585_0018483
1099 Ga0495585_0083604
1100 Ga0495594_0016763
1101 Ga0495594_0060909
1102 Ga0495594_0216700
1103 Ga0495607_0007920
1104 Ga0495606_0032077
1105 Ga0495608_0006686
1106 Ga0495608_0010335
1107 Ga0495608_0186712
1108 Ga0495618_0012578
1109 Ga0495618_0123901
1110 Ga0495628_0010228
1111 Ga0495630_0041990
1112 Ga0495644_0004819
1113 Ga0495648_0015002
1114 Ga0495666_0004818
1115 Ga0495666_0006104
1116 Ga0495652_0018574
1117 Ga0495652_0040865
1118 Ga0495665_0008763
1119 Ga0495665_0021877
1120 Ga0495640_0041943
1121 Ga0495640_0061733
1122 Ga0495586_0004394
1123 Ga0495587_0018466
1124 Ga0495587_0097553
1125 Ga0495621_0081752
1126 Ga0495645_0001251
1127 Ga0495622_0017687
1128 Ga0495633_0010960
1129 Ga0495667_0024282
1130 Ga0495667_0067972
1131 Ga0495667_0225723
1132 Ga0495656_0001215
1133 Ga0495656_0077176
1134 Ga0495668_0198921
1135 Ga0495634_0078762
1136 Ga0495611_0003868
1137 Ga0495635_0007616
1138 Ga0495635_0117106
1139 Ga0495659_0001029
1140 Ga0495588_0003197
1141 Ga0495588_0075845
1142 Ga0495657_0028272
1143 Ga0495599_0005701
1144 Ga0495599_0028550
1145 Ga0495646_0009398
1146 Ga0495646_0111340
1147 Ga0495647_0004286
1148 Ga0495647_0010294
1149 Ga0495658_0002463
1150 Ga0495658_0005737
1151 Ga0495658_0068503
1152 Ga0495658_0239895
1153 Ga0495613_0000615
1154 Ga0495613_0013607
1155 Ga0495613_0029172
1156 Ga0495624_0009958
1157 Ga0495624_0018144
1158 Ga0495670_0001068
1159 Ga0495670_0022339
1160 Ga0495671_0041925
1161 Ga0495589_0072186
1162 Ga0495600_0005021
1163 Ga0495600_0025066
1164 Ga0495600_0145126
1165 Ga0495600_0298987
1166 Ga0495581_0002747
1167 Ga0495581_0082642
1168 Ga0495604_0004824
1169 Ga0495604_0022472
1170 Ga0495604_0023196
1171 Ga0495636_0046928
1172 Ga0495636_0051239
1173 Ga0495674_0038965
1174 Ga0495674_0044084
1175 Ga0495674_0151742
1176 Ga0495676_0014348
1177 Ga0495676_0056171
1178 Ga0495676_0095015
1179 Ga0495680_0019669
1180 Ga0495680_0035652
1181 Ga0495680_0083563
1182 Ga0495680_0086644
1183 Ga0495675_0006704
1184 Ga0495679_048937
1185 Ga0495684_0003597
1186 Ga0495684_0046226
1187 Ga0495684_0348629
1188 Ga0495593_0014183
1189 Ga0495602_0005528
1190 Ga0495602_0199172
1191 Ga0496100_0000842
1192 Ga0496100_0029617
1193 Ga0496101_0001211
1194 Ga0496101_0001457
1195 Ga0496101_0010153
1196 Ga0496101_0058675
1197 Ga0496102_0009064
1198 Ga0496102_0011697
1199 Ga0496102_0022723
1200 Ga0496102_0070554
1201 Ga0496102_0257613
1202 Ga0496103_0010836
1203 Ga0496103_0033318
1204 Ga0496104_0000602
1205 Ga0496104_0016899
1206 Ga0496104_0026031
1207 Ga0496104_0406781
1208 Ga0496105_0003655
1209 Ga0496105_0015020
1210 Ga0496105_0064241
1211 Ga0496105_0077378
1212 Ga0496105_0115671
1213 Ga0496106_0000405
1214 Ga0496106_0032059
1215 Ga0496106_0092378
1216 Ga0496106_0194991
1217 Ga0496107_0001082
1218 Ga0496108_0003869
1219 Ga0496108_0011968
1220 Ga0496108_0012570
1221 Ga0496108_0034009
1222 Ga0496108_0043876
1223 Ga0496108_0507883
1224 Ga0496109_0006129
1225 Ga0496109_0006276
1226 Ga0496109_0009555
1227 Ga0496109_0052215
1228 Ga0496109_0123808
1229 Ga0496110_0000468
1230 Ga0496110_0015322
1231 Ga0496110_0045555
1232 Ga0496110_0056143
1233 Ga0496110_0075344
1234 Ga0496111_0001714
1235 Ga0496111_0004338
1236 Ga0496111_0037892
1237 Ga0496112_0000527
1238 Ga0496112_0004838
1239 Ga0496112_0011978
1240 Ga0496112_0023637
1241 Ga0496112_0089626
1242 Ga0496112_0113744
1243 Ga0496112_0372948
1244 Ga0496113_0003961
1245 Ga0496113_0004231
1246 Ga0496113_0011383
1247 Ga0496113_0037525
1248 Ga0496114_0005042
1249 Ga0496114_0104086
1250 Ga0496114_0104954
1251 Ga0496115_0005817
1252 Ga0496115_0013101
1253 Ga0496115_0069948
1254 Ga0496115_0388149
1255 Ga0496126_0027336
1256 Ga0501031_0026174
1257 Ga0501032_0092511
1258 Ga0501033_0007670
1259 Ga0501034_0544156
1260 Ga0501036_0016482
1261 Ga0501036_0058938
1262 Ga0501037_0105216
1263 Ga0501037_0110705
1264 Ga0501038_0000545
1265 Ga0501038_0043917
1266 Ga0501038_0090782
1267 Ga0501039_0021356
1268 Ga0501039_0032164
1269 Ga0501040_0009859
1270 Ga0501040_0044710
1271 Ga0501041_0019389
1272 Ga0501042_0005234
1273 Ga0501042_0159609
1274 Ga0501042_0311537
1275 Ga0501043_0007360
1276 Ga0501043_0013428
1277 Ga0501043_0160774
1278 Ga0501046_0006010
1279 Ga0501046_0014699
1280 Ga0501047_0002872
1281 Ga0501047_0036178
1282 Ga0501047_0096900
1283 Ga0501047_0124159
1284 Ga0501047_0235156
1285 Ga0501067_0014516
1286 Ga0501067_0046793
1287 Ga0501068_0021670
1288 Ga0501069_0007215
1289 Ga0501070_0003270
1290 Ga0501070_0043932
1291 Ga0501070_0044384
1292 Ga0501071_0139943
1293 Ga0501071_0156422
1294 Ga0501072_0013914
1295 Ga0501074_0011655
1296 Ga0501074_0035356
1297 Ga0501074_0043753
1298 Ga0501075_0023569
1299 Ga0501076_0009701
1300 Ga0501076_0016338
1301 Ga0501076_0114869
1302 Ga0501076_0336498
1303 Ga0501077_0005430
1304 Ga0501077_0061228
1305 Ga0501079_0007946
1306 Ga0501079_0010988
1307 Ga0501079_0081736
1308 Ga0501080_0000340
1309 Ga0501080_0019745
1310 Ga0501080_0082162
1311 Ga0501080_0084625
1312 Ga0501081_0002877
1313 Ga0501081_0011140
1314 Ga0501081_0013714
1315 Ga0501035_0067270
1316 Ga0501035_0160626
1317 Ga0501035_0230697
1318 Ga0501035_0246704
1319 Ga0501044_0014341
1320 Ga0501045_0011927
1321 Ga0501045_0020987
1322 Ga0501045_0094827
1323 nmdc:mga03683_17787_c1
1324 nmdc:mga05p37_33457_c1
1325 nmdc:mga05p37_44774_c1
1326 nmdc:mga09592_10439_c1
1327 nmdc:mga09592_78389_c1
1328 nmdc:mga0qj67_11760_c1
1329 nmdc:mga06r32_13597_c1
1330 nmdc:mga08y16_1925_c1
1331 nmdc:mga0n895_124457_c1
1332 nmdc:mga0n895_167910_c1
1333 nmdc:mga0n895_329747_c1
1334 nmdc:mga0n895_4364_c1
1335 nmdc:mga0n895_65942_c1
1336 nmdc:mga0rr50_342559_c1
1337 nmdc:mga0rr50_68049_c1
1338 nmdc:mga0a205_6620_c1
1339 nmdc:mga0a205_89786_c1
1340 Ga0495601_0001548
1341 Ga0495601_0005375
1342 Ga0495601_0045414
1343 Ga0495601_0066984
1344 Ga0495612_0003002
1345 Ga0495612_0006083
1346 Ga0495612_0009510
1347 Ga0495612_0028706
1348 Ga0495612_0078658
1349 Ga0495612_0102084
1350 Ga0495655_0007882
1351 Ga0495595_0002759
1352 Ga0495595_0016473
1353 Ga0495619_0000052
1354 Ga0495619_0000821
1355 Ga0495619_0046030
1356 Ga0500566_0000049
1357 Ga0500641_0007196
1358 Ga0500572_000476
1359 Ga0500591_027619
1360 Ga0500608_030856
1361 Ga0500658_0186483
1362 Ga0500559_0000654
1363 Ga0500559_0016101
1364 Ga0500590_065126
1365 Ga0500603_000031
1366 Ga0500616_0145981
1367 Ga0500630_000581
1368 Ga0500639_000020
1369 Ga0500636_0070433
1370 Ga0500637_0007143
1371 Ga0500596_003763
1372 Ga0500601_006297
1373 Ga0501084_0008741
1374 Ga0501084_0014440
1375 Ga0501084_0274441
1376 Ga0501084_0287785
1377 Ga0501082_0005251
1378 Ga0501082_0115603
1379 Ga0501082_0171500
1380 Ga0530510_0013479
1381 Ga0530510_0079726
1382 2513657247
1383 2513715400
1384 2513857715
1385 2513919255
1386 2517411314
1387 2517891048
1388 2599106409
1389 2644104486
1390 2793066402
1391 2842333887
1392 2846956207
1393 2897807417
1394 2906616245
1395 2906640335
1396 2906667255
1397 2922431761
1398 2932796601
1399 2932802617
1400 2935768584
1401 2935883572
1402 2935967063
1403 2941506184
1404 3005481579
1405 8006932277
1406 8006943173
1407 8006982968
1408 8019575115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

19

323

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8966 10 314
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8953 10 314
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8801 10 314
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8777 10 314
7f9o-assembly1.cif.gz_G psi-ndh supercomplex of barley 0.8038 15 316
ID Description Score Start End Superfamily
af_Q59R29_400_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3318 101 281 1.20.1250.20
af_Q59R29_400_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3243 101 281 1.20.1250.20
af_Q09934_214_431_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3199 67 247 1.20.1640.10
af_Q6YK44_74_579_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3179 65 311 1.20.1250.20
af_A0A1D8PQZ7_87_288_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3084 93 313 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3D3AY45-F1-model_v4 Formate hydrogenlyase 0.9812 69 195 GO:0005886
GO:0016829
AF-A0A3D3AY45-F1-model_v4 Formate hydrogenlyase 0.9662 69 195 GO:0005886
GO:0016829
AF-A0A257PYX2-F1-model_v4 Formate hydrogenlyase 0.9585 4 195 GO:0005886
AF-A0A534DSG4-F1-model_v4 deleted 0.9576 6 153
AF-A0A3N5MWE9-F1-model_v4 Formate hydrogenlyase 0.9554 1 288 GO:0005886
GO:0016829

Map