F476374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 326 | 1408 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0000028|Ga0495670_0000028_19659_20504 |
| Length | 281 |
| Sequence | MLSASCDAHWSDVCCLTGFPQAGKAPVAFRGAIPYIGAMHLRAEAIILSVRAHGEHGAVVRALTESDGLQPGYVRGGRSRALRPVLQPANLVLGEWRSRTEDQLAGLTVELIHSRAPMFGEPLPAAAFEWATALTAATLPDAQPYPRLYSALDGVLAAIEAAPAARGWAVALVRYELLLLAELGFGLDLEHCAATGRNDDLAFVSPKSGIAVSRLGAEGYEKRLLALPRFLFEGGEADWDDILAGLKLTGHFLERDLLIGKGADTLAARARLVDRLLRAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 201 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 202 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 203 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 207 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 208 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 209 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 210 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 211 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 212 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 215 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 216 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 297 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 299 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 302 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 305 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 306 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 308 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 311 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 312 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 313 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 314 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 315 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 316 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 317 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 318 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 319 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 320 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 321 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 322 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 323 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 324 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 325 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 326 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.59 |
| Metatranscriptomes | 0.14 |
| Isolates | 2.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 8.95 |
| Nodule | 0 |
| Rhizoplane | 4.97 |
| Rhizosphere | 76.28 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495670_0000028 | 3300046691 | Bacteria | 90085 |
| 2 | SwRhRL2b_contig_1489105 | 2162886007 | Bacteria | 7422 |
| 3 | JGI24736J21556_1002251 | 3300001904 | Bacteria | 3412 |
| 4 | JGI24741J21665_1000549 | 3300001915 | Bacteria | 11447 |
| 5 | JGI24752J21851_1001710 | 3300001976 | Bacteria | 2943 |
| 6 | JGI24740J21852_10004963 | 3300001979 | Bacteria | 5657 |
| 7 | JGI24740J21852_10005015 | 3300001979 | Bacteria | 5624 |
| 8 | JGI24739J22299_10011325 | 3300001989 | Bacteria | 3294 |
| 9 | JGI24737J22298_10002940 | 3300001990 | Bacteria | 6039 |
| 10 | JGI24737J22298_10005153 | 3300001990 | Bacteria | 4525 |
| 11 | JGI24735J21928_10001689 | 3300002067 | Bacteria | 7795 |
| 12 | JGI24735J21928_10002252 | 3300002067 | Bacteria | 6743 |
| 13 | JGI24735J21928_10003032 | 3300002067 | Bacteria | 5764 |
| 14 | JGI24735J21928_10010004 | 3300002067 | Bacteria | 3035 |
| 15 | JGI24735J21928_10015767 | 3300002067 | Bacteria | 2352 |
| 16 | JGI24735J21928_10050673 | 3300002067 | Bacteria | 1199 |
| 17 | JGI24750J21931_1000042 | 3300002070 | Bacteria | 16868 |
| 18 | JGI24748J21848_1000063 | 3300002074 | Bacteria | 40664 |
| 19 | JGI24738J21930_10001001 | 3300002075 | Bacteria | 8087 |
| 20 | JGI24738J21930_10001487 | 3300002075 | Bacteria | 6511 |
| 21 | JGI24744J21845_10002202 | 3300002077 | Bacteria | 3961 |
| 22 | JGI24034J26672_10000007 | 3300002239 | Bacteria | 224370 |
| 23 | JGI25150J39212_1002132 | 3300002774 | Bacteria | 5113 |
| 24 | JGI25165J46597_1000145 | 3300003214 | Bacteria | 116948 |
| 25 | JGI25153J46596_10000028 | 3300003215 | Bacteria | 209842 |
| 26 | rootH2_10161563 | 3300003320 | Bacteria | 1182 |
| 27 | rootH2_10235635 | 3300003320 | Bacteria | 2669 |
| 28 | rootL2_10107312 | 3300003322 | Bacteria | 1065 |
| 29 | rootH1_10190613 | 3300003323 | Bacteria | 1084 |
| 30 | Ga0055526_1000478 | 3300003771 | Bacteria | 31736 |
| 31 | Ga0055537_1001154 | 3300003773 | Bacteria | 11291 |
| 32 | Ga0055524_1000457 | 3300003775 | Bacteria | 33415 |
| 33 | Ga0055530_10041505 | 3300003791 | Bacteria | 1122 |
| 34 | Ga0055540_1001446 | 3300003792 | Bacteria | 14141 |
| 35 | Ga0055540_1001525 | 3300003792 | Bacteria | 13634 |
| 36 | Ga0055531_10000384 | 3300003794 | Bacteria | 42713 |
| 37 | Ga0065165_1002862 | 3300005262 | Bacteria | 13339 |
| 38 | Ga0065165_1003940 | 3300005262 | Bacteria | 9774 |
| 39 | Ga0065165_1031534 | 3300005262 | Bacteria | 1674 |
| 40 | Ga0065165_1044517 | 3300005262 | Bacteria | 1298 |
| 41 | Ga0065704_10007250 | 3300005289 | Bacteria | 4185 |
| 42 | Ga0065704_10072419 | 3300005289 | Bacteria | 8555 |
| 43 | Ga0065707_10082875 | 3300005295 | Bacteria | 11637 |
| 44 | Ga0070658_10000033 | 3300005327 | Bacteria | 147380 |
| 45 | Ga0070658_10037857 | 3300005327 | Bacteria | 3889 |
| 46 | Ga0070658_10160501 | 3300005327 | Bacteria | 1886 |
| 47 | Ga0070676_10411414 | 3300005328 | Bacteria | 943 |
| 48 | Ga0070676_10503058 | 3300005328 | Bacteria | 860 |
| 49 | Ga0070690_100000110 | 3300005330 | Bacteria | 42574 |
| 50 | Ga0070690_100019099 | 3300005330 | Bacteria | 4153 |
| 51 | Ga0070670_100000075 | 3300005331 | Bacteria | 97494 |
| 52 | Ga0070670_100050727 | 3300005331 | Bacteria | 3565 |
| 53 | Ga0070670_100085590 | 3300005331 | Bacteria | 2708 |
| 54 | Ga0070670_100111155 | 3300005331 | Bacteria | 2361 |
| 55 | Ga0070670_100169856 | 3300005331 | Bacteria | 1891 |
| 56 | Ga0068869_100191317 | 3300005334 | Bacteria | 1609 |
| 57 | Ga0070666_10000417 | 3300005335 | Bacteria | 26409 |
| 58 | Ga0070666_10003441 | 3300005335 | Bacteria | 9590 |
| 59 | Ga0070660_100002857 | 3300005339 | Bacteria | 11892 |
| 60 | Ga0070660_100011482 | 3300005339 | Bacteria | 6296 |
| 61 | Ga0070660_100054688 | 3300005339 | Bacteria | 3083 |
| 62 | Ga0070660_100063008 | 3300005339 | Bacteria | 2882 |
| 63 | Ga0070660_100073995 | 3300005339 | Bacteria | 2665 |
| 64 | Ga0070660_100090135 | 3300005339 | Bacteria | 2417 |
| 65 | Ga0070660_100092582 | 3300005339 | Bacteria | 2386 |
| 66 | Ga0070660_100135012 | 3300005339 | Bacteria | 1977 |
| 67 | Ga0070660_100173181 | 3300005339 | Bacteria | 1744 |
| 68 | Ga0070661_100130953 | 3300005344 | Bacteria | 1884 |
| 69 | Ga0070661_100199930 | 3300005344 | Bacteria | 1527 |
| 70 | Ga0070661_100254965 | 3300005344 | Bacteria | 1355 |
| 71 | Ga0070661_100274167 | 3300005344 | Bacteria | 1307 |
| 72 | Ga0070692_10018735 | 3300005345 | Bacteria | 3333 |
| 73 | Ga0070668_100089004 | 3300005347 | Bacteria | 2431 |
| 74 | Ga0070669_100000332 | 3300005353 | Bacteria | 36750 |
| 75 | Ga0070669_100037676 | 3300005353 | Bacteria | 3508 |
| 76 | Ga0070675_100001516 | 3300005354 | Bacteria | 17164 |
| 77 | Ga0070675_100146846 | 3300005354 | Bacteria | 2020 |
| 78 | Ga0070671_100022882 | 3300005355 | Bacteria | 5107 |
| 79 | Ga0070671_100055455 | 3300005355 | Bacteria | 3297 |
| 80 | Ga0070671_100061130 | 3300005355 | Bacteria | 3137 |
| 81 | Ga0070671_100073726 | 3300005355 | Bacteria | 2851 |
| 82 | Ga0070671_100099761 | 3300005355 | Bacteria | 2436 |
| 83 | Ga0070674_100021920 | 3300005356 | Bacteria | 4112 |
| 84 | Ga0070674_100092379 | 3300005356 | Bacteria | 2187 |
| 85 | Ga0070673_100002629 | 3300005364 | Bacteria | 10985 |
| 86 | Ga0070659_100002258 | 3300005366 | Bacteria | 13727 |
| 87 | Ga0070659_100022028 | 3300005366 | Bacteria | 4862 |
| 88 | Ga0070659_100057141 | 3300005366 | Bacteria | 3076 |
| 89 | Ga0070659_100062359 | 3300005366 | Bacteria | 2947 |
| 90 | Ga0070659_100115132 | 3300005366 | Bacteria | 2173 |
| 91 | Ga0070659_100181006 | 3300005366 | Bacteria | 1730 |
| 92 | Ga0070659_100204838 | 3300005366 | Bacteria | 1625 |
| 93 | Ga0070659_100271573 | 3300005366 | Bacteria | 1409 |
| 94 | Ga0070659_100433901 | 3300005366 | Bacteria | 1112 |
| 95 | Ga0070659_100676045 | 3300005366 | Bacteria | 891 |
| 96 | Ga0070667_100000039 | 3300005367 | Bacteria | 170228 |
| 97 | Ga0070667_100259304 | 3300005367 | Bacteria | 1556 |
| 98 | Ga0070663_100004890 | 3300005455 | Bacteria | 7910 |
| 99 | Ga0070663_100132933 | 3300005455 | Bacteria | 1891 |
| 100 | Ga0070663_100181416 | 3300005455 | Bacteria | 1633 |
| 101 | Ga0070678_100001866 | 3300005456 | Bacteria | 11366 |
| 102 | Ga0070678_100004810 | 3300005456 | Bacteria | 7707 |
| 103 | Ga0070662_100006444 | 3300005457 | Bacteria | 7564 |
| 104 | Ga0070662_100011803 | 3300005457 | Bacteria | 5773 |
| 105 | Ga0070662_100168906 | 3300005457 | Bacteria | 1716 |
| 106 | Ga0070681_10102501 | 3300005458 | Bacteria | 2807 |
| 107 | Ga0068867_100005781 | 3300005459 | Bacteria | 8775 |
| 108 | Ga0068867_100006557 | 3300005459 | Bacteria | 8220 |
| 109 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 110 | Ga0068853_100008364 | 3300005539 | Bacteria | 8308 |
| 111 | Ga0068853_100048683 | 3300005539 | Bacteria | 3642 |
| 112 | Ga0068853_100552448 | 3300005539 | Bacteria | 1091 |
| 113 | Ga0068853_100614750 | 3300005539 | Bacteria | 1033 |
| 114 | Ga0068853_100842060 | 3300005539 | Unclassified | 879 |
| 115 | Ga0070672_100018490 | 3300005543 | Bacteria | 5039 |
| 116 | Ga0070672_100059421 | 3300005543 | Bacteria | 3008 |
| 117 | Ga0070672_100250539 | 3300005543 | Bacteria | 1491 |
| 118 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 119 | Ga0070693_100096773 | 3300005547 | Bacteria | 1790 |
| 120 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 121 | Ga0070665_100138494 | 3300005548 | Bacteria | 2437 |
| 122 | Ga0070665_100139592 | 3300005548 | Bacteria | 2427 |
| 123 | Ga0068855_100117343 | 3300005563 | Bacteria | 3049 |
| 124 | Ga0068855_100131931 | 3300005563 | Bacteria | 2853 |
| 125 | Ga0068855_100526948 | 3300005563 | Bacteria | 1281 |
| 126 | Ga0070664_100014603 | 3300005564 | Bacteria | 6408 |
| 127 | Ga0070664_100044891 | 3300005564 | Bacteria | 3732 |
| 128 | Ga0068857_100003501 | 3300005577 | Bacteria | 13108 |
| 129 | Ga0068857_100018632 | 3300005577 | Bacteria | 6092 |
| 130 | Ga0068857_100235716 | 3300005577 | Bacteria | 1674 |
| 131 | Ga0068857_100244914 | 3300005577 | Bacteria | 1642 |
| 132 | Ga0068857_100392160 | 3300005577 | Bacteria | 1291 |
| 133 | Ga0068854_100016231 | 3300005578 | Bacteria | 4959 |
| 134 | Ga0068854_100025435 | 3300005578 | Bacteria | 4062 |
| 135 | Ga0068854_100067438 | 3300005578 | Bacteria | 2607 |
| 136 | Ga0068856_100016269 | 3300005614 | Bacteria | 7197 |
| 137 | Ga0068856_100036758 | 3300005614 | Bacteria | 4802 |
| 138 | Ga0068856_100064590 | 3300005614 | Bacteria | 3617 |
| 139 | Ga0068856_100246893 | 3300005614 | Bacteria | 1800 |
| 140 | Ga0068852_100068729 | 3300005616 | Bacteria | 3102 |
| 141 | Ga0068852_100199080 | 3300005616 | Bacteria | 1895 |
| 142 | Ga0068852_100454952 | 3300005616 | Bacteria | 1268 |
| 143 | Ga0068852_101093151 | 3300005616 | Bacteria | 817 |
| 144 | Ga0068859_100005488 | 3300005617 | Bacteria | 12913 |
| 145 | Ga0068859_100022537 | 3300005617 | Bacteria | 6316 |
| 146 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 147 | Ga0068864_100157801 | 3300005618 | Bacteria | 2060 |
| 148 | Ga0068864_100503707 | 3300005618 | Bacteria | 1165 |
| 149 | Ga0068861_100000321 | 3300005719 | Bacteria | 26985 |
| 150 | Ga0068861_100000965 | 3300005719 | Bacteria | 17524 |
| 151 | Ga0068851_10008938 | 3300005834 | Bacteria | 4646 |
| 152 | Ga0068851_10027735 | 3300005834 | Bacteria | 2792 |
| 153 | Ga0068851_10103684 | 3300005834 | Bacteria | 1511 |
| 154 | Ga0068863_100000033 | 3300005841 | Bacteria | 170238 |
| 155 | Ga0068863_100000280 | 3300005841 | Bacteria | 52729 |
| 156 | Ga0068863_100007192 | 3300005841 | Bacteria | 10917 |
| 157 | Ga0068863_100019160 | 3300005841 | Bacteria | 6550 |
| 158 | Ga0068858_100007900 | 3300005842 | Bacteria | 10254 |
| 159 | Ga0068858_100069059 | 3300005842 | Bacteria | 3275 |
| 160 | Ga0068858_100243409 | 3300005842 | Bacteria | 1707 |
| 161 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 162 | Ga0068860_100112898 | 3300005843 | Bacteria | 2598 |
| 163 | Ga0068862_100000040 | 3300005844 | Bacteria | 167832 |
| 164 | Ga0068862_100000308 | 3300005844 | Bacteria | 53687 |
| 165 | Ga0068862_100009087 | 3300005844 | Bacteria | 8225 |
| 166 | Ga0068862_100266217 | 3300005844 | Bacteria | 1566 |
| 167 | Ga0068862_100361141 | 3300005844 | Bacteria | 1350 |
| 168 | Ga0081455_10160295 | 3300005937 | Bacteria | 1725 |
| 169 | Ga0075368_10000033 | 3300006042 | Bacteria | 32184 |
| 170 | Ga0075367_10000481 | 3300006178 | Bacteria | 14919 |
| 171 | Ga0097621_100048516 | 3300006237 | Bacteria | 3445 |
| 172 | Ga0075370_10066614 | 3300006353 | Bacteria | 2055 |
| 173 | Ga0068871_100562537 | 3300006358 | Bacteria | 1034 |
| 174 | Ga0075430_100059109 | 3300006846 | Bacteria | 3222 |
| 175 | Ga0075431_100151201 | 3300006847 | Bacteria | 2390 |
| 176 | Ga0075431_100366551 | 3300006847 | Bacteria | 1446 |
| 177 | Ga0075429_100161451 | 3300006880 | Bacteria | 1963 |
| 178 | Ga0068865_100004177 | 3300006881 | Bacteria | 8697 |
| 179 | Ga0097620_100005488 | 3300006931 | Bacteria | 12913 |
| 180 | Ga0097620_100022537 | 3300006931 | Bacteria | 6316 |
| 181 | Ga0105251_10001444 | 3300009011 | Bacteria | 20434 |
| 182 | Ga0105251_10017044 | 3300009011 | Bacteria | 3903 |
| 183 | Ga0105240_10007666 | 3300009093 | Bacteria | 15628 |
| 184 | Ga0105240_10026155 | 3300009093 | Bacteria | 7658 |
| 185 | Ga0105240_10098942 | 3300009093 | Bacteria | 3551 |
| 186 | Ga0105240_10128458 | 3300009093 | Bacteria | 3043 |
| 187 | Ga0105240_10873625 | 3300009093 | Bacteria | 969 |
| 188 | Ga0105245_10001867 | 3300009098 | Bacteria | 19148 |
| 189 | Ga0105247_10214021 | 3300009101 | Bacteria | 1301 |
| 190 | Ga0114129_10841433 | 3300009147 | Bacteria | 1167 |
| 191 | Ga0105243_10104131 | 3300009148 | Bacteria | 2361 |
| 192 | Ga0105241_10008072 | 3300009174 | Bacteria | 7745 |
| 193 | Ga0105241_10217538 | 3300009174 | Bacteria | 1604 |
| 194 | Ga0105242_10064796 | 3300009176 | Bacteria | 3013 |
| 195 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 196 | Ga0105248_10124883 | 3300009177 | Bacteria | 2903 |
| 197 | Ga0105248_10394403 | 3300009177 | Bacteria | 1558 |
| 198 | Ga0105248_10982508 | 3300009177 | Bacteria | 954 |
| 199 | Ga0105237_10009418 | 3300009545 | Bacteria | 10463 |
| 200 | Ga0105237_10013028 | 3300009545 | Bacteria | 8731 |
| 201 | Ga0105237_10050016 | 3300009545 | Bacteria | 4201 |
| 202 | Ga0105237_10054292 | 3300009545 | Bacteria | 4015 |
| 203 | Ga0105238_10065766 | 3300009551 | Bacteria | 3627 |
| 204 | Ga0105238_10120716 | 3300009551 | Bacteria | 2600 |
| 205 | Ga0105238_10421674 | 3300009551 | Bacteria | 1329 |
| 206 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 207 | Ga0105249_10002603 | 3300009553 | Bacteria | 15632 |
| 208 | Ga0105249_10325529 | 3300009553 | Bacteria | 1549 |
| 209 | Ga0105249_10807819 | 3300009553 | Bacteria | 1002 |
| 210 | Ga0105148_100202 | 3300009978 | Bacteria | 8692 |
| 211 | Ga0105239_10000461 | 3300010375 | Bacteria | 59449 |
| 212 | Ga0105246_10176826 | 3300011119 | Bacteria | 1640 |
| 213 | Ga0157373_10121323 | 3300013100 | Bacteria | 1837 |
| 214 | Ga0157373_10389734 | 3300013100 | Bacteria | 997 |
| 215 | Ga0157373_10492926 | 3300013100 | Bacteria | 884 |
| 216 | Ga0157371_10085604 | 3300013102 | Bacteria | 2233 |
| 217 | Ga0157371_10149242 | 3300013102 | Unclassified | 1667 |
| 218 | Ga0157371_10169826 | 3300013102 | Bacteria | 1558 |
| 219 | Ga0157371_10177025 | 3300013102 | Bacteria | 1525 |
| 220 | Ga0157370_10000008 | 3300013104 | Bacteria | 240668 |
| 221 | Ga0157370_10002308 | 3300013104 | Bacteria | 23086 |
| 222 | Ga0157370_10024209 | 3300013104 | Bacteria | 6016 |
| 223 | Ga0157369_10031631 | 3300013105 | Bacteria | 5825 |
| 224 | Ga0157369_10112395 | 3300013105 | Bacteria | 2893 |
| 225 | Ga0157369_10816810 | 3300013105 | Bacteria | 957 |
| 226 | Ga0157374_10004197 | 3300013296 | Bacteria | 12105 |
| 227 | Ga0157374_10067557 | 3300013296 | Bacteria | 3361 |
| 228 | Ga0157374_10372050 | 3300013296 | Bacteria | 1422 |
| 229 | Ga0163162_10096754 | 3300013306 | Bacteria | 3040 |
| 230 | Ga0163162_10202484 | 3300013306 | Bacteria | 2114 |
| 231 | Ga0163162_10204173 | 3300013306 | Bacteria | 2105 |
| 232 | Ga0157372_10018134 | 3300013307 | Bacteria | 7567 |
| 233 | Ga0157372_10404374 | 3300013307 | Bacteria | 1591 |
| 234 | Ga0163163_10081360 | 3300014325 | Bacteria | 3241 |
| 235 | Ga0163163_10120063 | 3300014325 | Bacteria | 2662 |
| 236 | Ga0163163_10159477 | 3300014325 | Bacteria | 2301 |
| 237 | Ga0157380_10000440 | 3300014326 | Bacteria | 25347 |
| 238 | Ga0157380_10034756 | 3300014326 | Bacteria | 3890 |
| 239 | Ga0157379_10003144 | 3300014968 | Bacteria | 13972 |
| 240 | Ga0157379_10036117 | 3300014968 | Bacteria | 4407 |
| 241 | Ga0157379_10121240 | 3300014968 | Bacteria | 2352 |
| 242 | Ga0157376_10130417 | 3300014969 | Bacteria | 2242 |
| 243 | Ga0163161_10000202 | 3300017792 | Bacteria | 54518 |
| 244 | Ga0163161_10017029 | 3300017792 | Bacteria | 5082 |
| 245 | Ga0163161_10355841 | 3300017792 | Bacteria | 1165 |
| 246 | Ga0163161_10406912 | 3300017792 | Unclassified | 1092 |
| 247 | Ga0206353_11760290 | 3300020082 | Bacteria | 11326 |
| 248 | Ga0213876_10033404 | 3300021384 | Bacteria | 2713 |
| 249 | Ga0213875_10000721 | 3300021388 | Bacteria | 25266 |
| 250 | Ga0207672_1001024 | 3300025223 | Bacteria | 2658 |
| 251 | Ga0207427_100545 | 3300025231 | Bacteria | 19253 |
| 252 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 253 | Ga0207425_1004365 | 3300025245 | Bacteria | 4275 |
| 254 | Ga0209026_1002632 | 3300025250 | Bacteria | 6543 |
| 255 | Ga0209148_1000338 | 3300025254 | Bacteria | 62960 |
| 256 | Ga0209129_1000825 | 3300025258 | Bacteria | 19506 |
| 257 | Ga0209233_1000207 | 3300025261 | Bacteria | 117152 |
| 258 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 259 | Ga0209565_1000056 | 3300025263 | Bacteria | 200189 |
| 260 | Ga0209455_1000480 | 3300025272 | Bacteria | 29756 |
| 261 | Ga0209455_1018960 | 3300025272 | Bacteria | 1401 |
| 262 | Ga0209673_1001497 | 3300025273 | Bacteria | 21703 |
| 263 | Ga0209025_1000296 | 3300025294 | Bacteria | 111440 |
| 264 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 265 | Ga0209758_1002418 | 3300025297 | Bacteria | 19122 |
| 266 | Ga0209758_1066833 | 3300025297 | Bacteria | 1153 |
| 267 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 268 | Ga0209050_1000196 | 3300025298 | Bacteria | 135678 |
| 269 | Ga0209050_1008839 | 3300025298 | Bacteria | 5283 |
| 270 | Ga0209050_1016183 | 3300025298 | Bacteria | 3071 |
| 271 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 272 | Ga0209051_1000153 | 3300025303 | Bacteria | 131166 |
| 273 | Ga0209257_1000228 | 3300025304 | Bacteria | 133390 |
| 274 | Ga0209257_1003469 | 3300025304 | Bacteria | 13472 |
| 275 | Ga0209257_1004247 | 3300025304 | Bacteria | 11310 |
| 276 | Ga0209257_1004769 | 3300025304 | Bacteria | 10121 |
| 277 | Ga0207697_10016147 | 3300025315 | Bacteria | 3079 |
| 278 | Ga0207656_10049933 | 3300025321 | Bacteria | 1805 |
| 279 | Ga0207713_1007763 | 3300025735 | Bacteria | 6265 |
| 280 | Ga0207710_10166100 | 3300025900 | Unclassified | 1077 |
| 281 | Ga0207688_10032718 | 3300025901 | Bacteria | 2875 |
| 282 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 283 | Ga0207647_10001622 | 3300025904 | Bacteria | 17295 |
| 284 | Ga0207647_10104017 | 3300025904 | Bacteria | 1683 |
| 285 | Ga0207647_10135199 | 3300025904 | Bacteria | 1447 |
| 286 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 287 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 288 | Ga0207705_10007714 | 3300025909 | Bacteria | 7913 |
| 289 | Ga0207705_10011424 | 3300025909 | Bacteria | 6428 |
| 290 | Ga0207705_10042116 | 3300025909 | Bacteria | 3278 |
| 291 | Ga0207705_10117758 | 3300025909 | Bacteria | 1968 |
| 292 | Ga0207705_10192064 | 3300025909 | Bacteria | 1545 |
| 293 | Ga0207705_10194448 | 3300025909 | Bacteria | 1535 |
| 294 | Ga0207654_10001661 | 3300025911 | Bacteria | 11622 |
| 295 | Ga0207654_10049270 | 3300025911 | Bacteria | 2415 |
| 296 | Ga0207695_10000641 | 3300025913 | Bacteria | 69705 |
| 297 | Ga0207695_10006576 | 3300025913 | Bacteria | 15034 |
| 298 | Ga0207695_10024580 | 3300025913 | Bacteria | 6771 |
| 299 | Ga0207695_10077765 | 3300025913 | Bacteria | 3369 |
| 300 | Ga0207695_10098637 | 3300025913 | Bacteria | 2921 |
| 301 | Ga0207695_10134453 | 3300025913 | Bacteria | 2427 |
| 302 | Ga0207671_10002738 | 3300025914 | Bacteria | 18433 |
| 303 | Ga0207671_10203960 | 3300025914 | Bacteria | 1545 |
| 304 | Ga0207657_10008853 | 3300025919 | Bacteria | 10181 |
| 305 | Ga0207657_10065116 | 3300025919 | Bacteria | 3108 |
| 306 | Ga0207657_10065750 | 3300025919 | Bacteria | 3090 |
| 307 | Ga0207657_10066709 | 3300025919 | Bacteria | 3062 |
| 308 | Ga0207657_10103427 | 3300025919 | Bacteria | 2361 |
| 309 | Ga0207657_10189101 | 3300025919 | Bacteria | 1662 |
| 310 | Ga0207657_10227301 | 3300025919 | Bacteria | 1493 |
| 311 | Ga0207657_10254383 | 3300025919 | Bacteria | 1399 |
| 312 | Ga0207649_10010061 | 3300025920 | Bacteria | 5189 |
| 313 | Ga0207649_10050916 | 3300025920 | Bacteria | 2563 |
| 314 | Ga0207649_10126732 | 3300025920 | Bacteria | 1729 |
| 315 | Ga0207649_10312385 | 3300025920 | Bacteria | 1152 |
| 316 | Ga0207649_10325948 | 3300025920 | Bacteria | 1130 |
| 317 | Ga0207649_10352238 | 3300025920 | Bacteria | 1090 |
| 318 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 319 | Ga0207694_10001461 | 3300025924 | Bacteria | 20212 |
| 320 | Ga0207694_10028824 | 3300025924 | Bacteria | 4234 |
| 321 | Ga0207694_10039527 | 3300025924 | Bacteria | 3630 |
| 322 | Ga0207650_10000069 | 3300025925 | Bacteria | 138442 |
| 323 | Ga0207650_10026743 | 3300025925 | Bacteria | 4120 |
| 324 | Ga0207650_10033961 | 3300025925 | Bacteria | 3698 |
| 325 | Ga0207650_10061262 | 3300025925 | Bacteria | 2809 |
| 326 | Ga0207650_10157802 | 3300025925 | Bacteria | 1795 |
| 327 | Ga0207659_10059191 | 3300025926 | Bacteria | 2753 |
| 328 | Ga0207687_10003098 | 3300025927 | Bacteria | 11274 |
| 329 | Ga0207644_10003422 | 3300025931 | Bacteria | 10247 |
| 330 | Ga0207644_10067193 | 3300025931 | Bacteria | 2612 |
| 331 | Ga0207644_10072418 | 3300025931 | Bacteria | 2523 |
| 332 | Ga0207644_10073678 | 3300025931 | Bacteria | 2504 |
| 333 | Ga0207644_10081104 | 3300025931 | Bacteria | 2396 |
| 334 | Ga0207644_10225803 | 3300025931 | Bacteria | 1486 |
| 335 | Ga0207690_10003689 | 3300025932 | Bacteria | 9111 |
| 336 | Ga0207690_10007350 | 3300025932 | Bacteria | 6539 |
| 337 | Ga0207690_10040990 | 3300025932 | Bacteria | 3031 |
| 338 | Ga0207690_10043362 | 3300025932 | Bacteria | 2960 |
| 339 | Ga0207690_10093263 | 3300025932 | Bacteria | 2133 |
| 340 | Ga0207690_10099311 | 3300025932 | Bacteria | 2075 |
| 341 | Ga0207690_10129291 | 3300025932 | Bacteria | 1846 |
| 342 | Ga0207690_10161495 | 3300025932 | Bacteria | 1671 |
| 343 | Ga0207690_10205312 | 3300025932 | Bacteria | 1499 |
| 344 | Ga0207690_10314363 | 3300025932 | Bacteria | 1229 |
| 345 | Ga0207706_10001442 | 3300025933 | Bacteria | 23791 |
| 346 | Ga0207706_10018968 | 3300025933 | Bacteria | 6185 |
| 347 | Ga0207706_10043654 | 3300025933 | Bacteria | 3972 |
| 348 | Ga0207706_10160806 | 3300025933 | Bacteria | 1974 |
| 349 | Ga0207706_10246139 | 3300025933 | Bacteria | 1562 |
| 350 | Ga0207706_10511476 | 3300025933 | Bacteria | 1036 |
| 351 | Ga0207706_10643802 | 3300025933 | Bacteria | 908 |
| 352 | Ga0207686_10028588 | 3300025934 | Bacteria | 3279 |
| 353 | Ga0207709_10105314 | 3300025935 | Bacteria | 1874 |
| 354 | Ga0207669_10055566 | 3300025937 | Bacteria | 2398 |
| 355 | Ga0207669_10078646 | 3300025937 | Bacteria | 2102 |
| 356 | Ga0207691_10000631 | 3300025940 | Bacteria | 34819 |
| 357 | Ga0207691_10037826 | 3300025940 | Bacteria | 4466 |
| 358 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 359 | Ga0207711_10010871 | 3300025941 | Bacteria | 7565 |
| 360 | Ga0207711_10016625 | 3300025941 | Bacteria | 6110 |
| 361 | Ga0207689_10087928 | 3300025942 | Bacteria | 2553 |
| 362 | Ga0207689_10100100 | 3300025942 | Bacteria | 2381 |
| 363 | Ga0207679_10005299 | 3300025945 | Bacteria | 8090 |
| 364 | Ga0207679_10016820 | 3300025945 | Bacteria | 4862 |
| 365 | Ga0207679_10196654 | 3300025945 | Bacteria | 1681 |
| 366 | Ga0207667_10004663 | 3300025949 | Bacteria | 16793 |
| 367 | Ga0207667_10044332 | 3300025949 | Bacteria | 4714 |
| 368 | Ga0207667_10219943 | 3300025949 | Bacteria | 1946 |
| 369 | Ga0207667_10277086 | 3300025949 | Bacteria | 1714 |
| 370 | Ga0207651_10008206 | 3300025960 | Bacteria | 5624 |
| 371 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 372 | Ga0207712_10002020 | 3300025961 | Bacteria | 13317 |
| 373 | Ga0207712_10134447 | 3300025961 | Bacteria | 1889 |
| 374 | Ga0207668_10135614 | 3300025972 | Bacteria | 1885 |
| 375 | Ga0207640_10018490 | 3300025981 | Bacteria | 4097 |
| 376 | Ga0207640_10158364 | 3300025981 | Bacteria | 1672 |
| 377 | Ga0207640_10228286 | 3300025981 | Bacteria | 1430 |
| 378 | Ga0207658_10000652 | 3300025986 | Bacteria | 30347 |
| 379 | Ga0207658_10003067 | 3300025986 | Bacteria | 11944 |
| 380 | Ga0207658_10202436 | 3300025986 | Bacteria | 1658 |
| 381 | Ga0207677_10087570 | 3300026023 | Bacteria | 2255 |
| 382 | Ga0207703_10010176 | 3300026035 | Bacteria | 7372 |
| 383 | Ga0207703_10054384 | 3300026035 | Bacteria | 3255 |
| 384 | Ga0207639_10071982 | 3300026041 | Bacteria | 2706 |
| 385 | Ga0207639_10315558 | 3300026041 | Unclassified | 1386 |
| 386 | Ga0207639_10401778 | 3300026041 | Bacteria | 1234 |
| 387 | Ga0207639_10787962 | 3300026041 | Bacteria | 885 |
| 388 | Ga0207678_10001799 | 3300026067 | Bacteria | 19627 |
| 389 | Ga0207678_10004357 | 3300026067 | Bacteria | 12713 |
| 390 | Ga0207678_10045975 | 3300026067 | Bacteria | 3775 |
| 391 | Ga0207678_10241115 | 3300026067 | Bacteria | 1548 |
| 392 | Ga0207702_10002022 | 3300026078 | Bacteria | 19645 |
| 393 | Ga0207702_10008254 | 3300026078 | Bacteria | 8801 |
| 394 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 395 | Ga0207641_10000414 | 3300026088 | Bacteria | 49835 |
| 396 | Ga0207641_10005204 | 3300026088 | Bacteria | 11123 |
| 397 | Ga0207648_10001344 | 3300026089 | Bacteria | 27279 |
| 398 | Ga0207648_10062609 | 3300026089 | Bacteria | 3243 |
| 399 | Ga0207676_10000353 | 3300026095 | Bacteria | 39309 |
| 400 | Ga0207676_10009609 | 3300026095 | Bacteria | 6885 |
| 401 | Ga0207676_10077831 | 3300026095 | Bacteria | 2684 |
| 402 | Ga0207676_10646159 | 3300026095 | Bacteria | 1020 |
| 403 | Ga0207674_10000291 | 3300026116 | Bacteria | 63446 |
| 404 | Ga0207674_10010820 | 3300026116 | Bacteria | 10286 |
| 405 | Ga0207674_10042500 | 3300026116 | Bacteria | 4694 |
| 406 | Ga0207674_10114135 | 3300026116 | Unclassified | 2674 |
| 407 | Ga0207674_10246853 | 3300026116 | Bacteria | 1732 |
| 408 | Ga0207674_10251420 | 3300026116 | Bacteria | 1715 |
| 409 | Ga0207675_100000227 | 3300026118 | Bacteria | 53090 |
| 410 | Ga0207675_100000998 | 3300026118 | Bacteria | 28040 |
| 411 | Ga0207683_10004993 | 3300026121 | Bacteria | 11396 |
| 412 | Ga0207683_10010089 | 3300026121 | Bacteria | 8060 |
| 413 | Ga0207698_10001499 | 3300026142 | Bacteria | 13593 |
| 414 | Ga0207698_10038110 | 3300026142 | Bacteria | 3548 |
| 415 | Ga0207698_10079015 | 3300026142 | Bacteria | 2644 |
| 416 | Ga0207698_10095930 | 3300026142 | Bacteria | 2443 |
| 417 | Ga0207698_10130366 | 3300026142 | Bacteria | 2147 |
| 418 | Ga0207698_10304513 | 3300026142 | Bacteria | 1485 |
| 419 | Ga0209813_10000041 | 3300027866 | Bacteria | 53753 |
| 420 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 421 | Ga0268266_10116025 | 3300028379 | Bacteria | 2378 |
| 422 | Ga0268266_10194973 | 3300028379 | Bacteria | 1851 |
| 423 | Ga0268266_10376461 | 3300028379 | Bacteria | 1338 |
| 424 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 425 | Ga0268265_10002814 | 3300028380 | Bacteria | 12797 |
| 426 | Ga0268265_10239805 | 3300028380 | Bacteria | 1599 |
| 427 | Ga0268265_10315647 | 3300028380 | Bacteria | 1413 |
| 428 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 429 | Ga0268264_10754480 | 3300028381 | Bacteria | 970 |
| 430 | Ga0307408_100036711 | 3300031548 | Bacteria | 3446 |
| 431 | Ga0307408_100453026 | 3300031548 | Bacteria | 1113 |
| 432 | Ga0307405_10038560 | 3300031731 | Bacteria | 2881 |
| 433 | Ga0307413_10004075 | 3300031824 | Bacteria | 6286 |
| 434 | Ga0307413_10028063 | 3300031824 | Bacteria | 3128 |
| 435 | Ga0307413_10119107 | 3300031824 | Bacteria | 1784 |
| 436 | Ga0307410_10000281 | 3300031852 | Bacteria | 19663 |
| 437 | Ga0307410_10019341 | 3300031852 | Bacteria | 4141 |
| 438 | Ga0307410_10035705 | 3300031852 | Bacteria | 3231 |
| 439 | Ga0307406_10020481 | 3300031901 | Bacteria | 3895 |
| 440 | Ga0307406_10149122 | 3300031901 | Bacteria | 1666 |
| 441 | Ga0307406_10229868 | 3300031901 | Bacteria | 1384 |
| 442 | Ga0307407_10001856 | 3300031903 | Bacteria | 7945 |
| 443 | Ga0307407_10004947 | 3300031903 | Bacteria | 5730 |
| 444 | Ga0307407_10209618 | 3300031903 | Bacteria | 1311 |
| 445 | Ga0307412_10000453 | 3300031911 | Bacteria | 24741 |
| 446 | Ga0307412_10005872 | 3300031911 | Bacteria | 6914 |
| 447 | Ga0307412_10132167 | 3300031911 | Bacteria | 1814 |
| 448 | Ga0307409_100013771 | 3300031995 | Bacteria | 5225 |
| 449 | Ga0307409_100065828 | 3300031995 | Bacteria | 2854 |
| 450 | Ga0307409_100277011 | 3300031995 | Bacteria | 1548 |
| 451 | Ga0307416_100009701 | 3300032002 | Bacteria | 6321 |
| 452 | Ga0307416_100033727 | 3300032002 | Bacteria | 3885 |
| 453 | Ga0307416_100069334 | 3300032002 | Bacteria | 2917 |
| 454 | Ga0307416_100225252 | 3300032002 | Bacteria | 1802 |
| 455 | Ga0307414_10000248 | 3300032004 | Bacteria | 33977 |
| 456 | Ga0307414_10004115 | 3300032004 | Bacteria | 7856 |
| 457 | Ga0307414_10008487 | 3300032004 | Bacteria | 5829 |
| 458 | Ga0307414_10018719 | 3300032004 | Bacteria | 4272 |
| 459 | Ga0307414_10373356 | 3300032004 | Bacteria | 1231 |
| 460 | Ga0307411_10004182 | 3300032005 | Bacteria | 6861 |
| 461 | Ga0307411_10012924 | 3300032005 | Bacteria | 4580 |
| 462 | Ga0307411_10021318 | 3300032005 | Bacteria | 3789 |
| 463 | Ga0307411_10076900 | 3300032005 | Bacteria | 2283 |
| 464 | Ga0307411_10079644 | 3300032005 | Bacteria | 2250 |
| 465 | Ga0307411_10106071 | 3300032005 | Bacteria | 1999 |
| 466 | Ga0307415_100272494 | 3300032126 | Bacteria | 1387 |
| 467 | Ga0373932_0041935 | 3300035112 | Bacteria | 1325 |
| 468 | Ga0373932_0045385 | 3300035112 | Bacteria | 1285 |
| 469 | Ga0395899_0000251 | 3300037312 | Bacteria | 71228 |
| 470 | Ga0395899_0001062 | 3300037312 | Bacteria | 24783 |
| 471 | Ga0395899_0001983 | 3300037312 | Bacteria | 16840 |
| 472 | Ga0395900_0000084 | 3300037418 | Bacteria | 172593 |
| 473 | Ga0395900_0022623 | 3300037418 | Bacteria | 6433 |
| 474 | Ga0395900_0025014 | 3300037418 | Bacteria | 6110 |
| 475 | Ga0395900_0479610 | 3300037418 | Bacteria | 1196 |
| 476 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 477 | Ga0395898_0002422 | 3300037466 | Bacteria | 22069 |
| 478 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 479 | Ga0395905_0000762 | 3300037471 | Bacteria | 42402 |
| 480 | Ga0395905_0031744 | 3300037471 | Bacteria | 4969 |
| 481 | Ga0395905_0073303 | 3300037471 | Bacteria | 3209 |
| 482 | Ga0395905_0234336 | 3300037471 | Bacteria | 1716 |
| 483 | Ga0395905_0528582 | 3300037471 | Bacteria | 1080 |
| 484 | Ga0436364_0322209 | 3300037853 | Bacteria | 1693 |
| 485 | Ga0436364_0462751 | 3300037853 | Bacteria | 45616 |
| 486 | Ga0395901_0008794 | 3300038443 | Bacteria | 10217 |
| 487 | Ga0395901_0009640 | 3300038443 | Bacteria | 9795 |
| 488 | Ga0395901_0069324 | 3300038443 | Bacteria | 3673 |
| 489 | Ga0436365_0695304 | 3300039437 | Bacteria | 6007 |
| 490 | Ga0436365_1474733 | 3300039437 | Bacteria | 4043 |
| 491 | Ga0436363_0379517 | 3300039450 | Bacteria | 4119 |
| 492 | Ga0436363_1509936 | 3300039450 | Bacteria | 1603 |
| 493 | Ga0439436_0007826 | 3300041404 | Bacteria | 3285 |
| 494 | Ga0439461_0000239 | 3300041410 | Bacteria | 7764 |
| 495 | Ga0439461_0006785 | 3300041410 | Bacteria | 2002 |
| 496 | Ga0439465_0000177 | 3300041413 | Bacteria | 16347 |
| 497 | Ga0439465_0012688 | 3300041413 | Bacteria | 2635 |
| 498 | Ga0451806_431010 | 3300041462 | Bacteria | 9494 |
| 499 | Ga0451804_1038976 | 3300041463 | Bacteria | 1919 |
| 500 | Ga0451807_1283003 | 3300041486 | Bacteria | 5402 |
| 501 | Ga0439431_0000207 | 3300041997 | Bacteria | 11634 |
| 502 | Ga0439431_0006020 | 3300041997 | Bacteria | 2677 |
| 503 | Ga0439442_002361 | 3300042002 | Bacteria | 3702 |
| 504 | Ga0439445_0000060 | 3300042004 | Bacteria | 16616 |
| 505 | Ga0439448_0001841 | 3300042005 | Bacteria | 5615 |
| 506 | Ga0439432_017104 | 3300042006 | Bacteria | 2436 |
| 507 | Ga0439455_0007574 | 3300042012 | Bacteria | 2300 |
| 508 | Ga0439462_0000195 | 3300042015 | Bacteria | 10446 |
| 509 | Ga0439446_0074395 | 3300042156 | Bacteria | 1044 |
| 510 | Ga0439458_0000436 | 3300042157 | Bacteria | 10507 |
| 511 | Ga0439434_0003840 | 3300042435 | Bacteria | 4392 |
| 512 | Ga0439434_0007436 | 3300042435 | Bacteria | 3209 |
| 513 | Ga0439464_0044684 | 3300042439 | Bacteria | 1269 |
| 514 | Ga0466972_0010895 | 3300044658 | Bacteria | 4562 |
| 515 | Ga0466972_0068978 | 3300044658 | Bacteria | 1689 |
| 516 | Ga0466965_0084296 | 3300044683 | Bacteria | 1610 |
| 517 | Ga0466961_0221293 | 3300044693 | Bacteria | 1166 |
| 518 | Ga0466963_0005621 | 3300044694 | Bacteria | 7355 |
| 519 | Ga0466963_0014337 | 3300044694 | Bacteria | 4886 |
| 520 | Ga0466963_0087573 | 3300044694 | Bacteria | 2117 |
| 521 | Ga0466971_0013927 | 3300044719 | Bacteria | 3535 |
| 522 | Ga0466971_0131759 | 3300044719 | Bacteria | 1161 |
| 523 | Ga0466968_0042644 | 3300044735 | Bacteria | 1919 |
| 524 | Ga0466970_0050313 | 3300044765 | Bacteria | 2222 |
| 525 | Ga0466957_0016826 | 3300044842 | Bacteria | 4279 |
| 526 | Ga0466957_0206908 | 3300044842 | Bacteria | 1291 |
| 527 | Ga0466960_0003085 | 3300044901 | Bacteria | 6375 |
| 528 | Ga0466960_0035587 | 3300044901 | Bacteria | 2328 |
| 529 | Ga0466958_0012119 | 3300045836 | Bacteria | 4875 |
| 530 | Ga0466958_0187392 | 3300045836 | Bacteria | 1314 |
| 531 | Ga0466958_0301418 | 3300045836 | Bacteria | 1029 |
| 532 | Ga0466967_0007703 | 3300045976 | Bacteria | 7804 |
| 533 | Ga0466967_0050831 | 3300045976 | Bacteria | 3630 |
| 534 | Ga0495617_029351 | 3300046452 | Bacteria | 1849 |
| 535 | Ga0495627_006278 | 3300046453 | Bacteria | 4670 |
| 536 | Ga0495627_051928 | 3300046453 | Bacteria | 1231 |
| 537 | Ga0495583_0001401 | 3300046506 | Bacteria | 24579 |
| 538 | Ga0495606_0094008 | 3300046507 | Bacteria | 1838 |
| 539 | Ga0495610_0000206 | 3300046512 | Bacteria | 65469 |
| 540 | Ga0495610_0049660 | 3300046512 | Bacteria | 2053 |
| 541 | Ga0495616_0000189 | 3300046513 | Bacteria | 51610 |
| 542 | Ga0495632_0001899 | 3300046519 | Bacteria | 16723 |
| 543 | Ga0495637_0029360 | 3300046520 | Bacteria | 2448 |
| 544 | Ga0495643_0000162 | 3300046522 | Bacteria | 106672 |
| 545 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 546 | Ga0495663_0018160 | 3300046525 | Bacteria | 2001 |
| 547 | Ga0495663_0024238 | 3300046525 | Bacteria | 1762 |
| 548 | Ga0495654_0180699 | 3300046530 | Bacteria | 914 |
| 549 | Ga0495621_0007456 | 3300046539 | Bacteria | 3240 |
| 550 | Ga0495622_0093923 | 3300046557 | Bacteria | 1377 |
| 551 | Ga0495633_0130434 | 3300046558 | Bacteria | 1163 |
| 552 | Ga0495625_0257602 | 3300046660 | Bacteria | 1130 |
| 553 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 554 | Ga0495671_0000062 | 3300046692 | Bacteria | 106672 |
| 555 | Ga0495671_0003910 | 3300046692 | Bacteria | 9038 |
| 556 | Ga0495636_0163863 | 3300047318 | Bacteria | 1003 |
| 557 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 558 | Ga0495673_0084474 | 3300047469 | Bacteria | 1309 |
| 559 | Ga0495681_0000106 | 3300047470 | Bacteria | 72369 |
| 560 | Ga0495681_0008636 | 3300047470 | Bacteria | 6361 |
| 561 | Ga0495686_0000366 | 3300047472 | Bacteria | 73243 |
| 562 | Ga0495686_0000986 | 3300047472 | Bacteria | 34762 |
| 563 | Ga0495686_0071813 | 3300047472 | Bacteria | 2129 |
| 564 | Ga0496100_0001542 | 3300048903 | Bacteria | 11314 |
| 565 | Ga0496100_0029233 | 3300048903 | Bacteria | 3407 |
| 566 | Ga0496101_0003699 | 3300048904 | Bacteria | 9538 |
| 567 | Ga0496102_0067110 | 3300048905 | Bacteria | 3289 |
| 568 | Ga0496102_0088970 | 3300048905 | Bacteria | 2856 |
| 569 | Ga0496102_0156222 | 3300048905 | Bacteria | 2144 |
| 570 | Ga0496102_0270111 | 3300048905 | Bacteria | 1603 |
| 571 | Ga0496103_0003725 | 3300048906 | Bacteria | 9269 |
| 572 | Ga0496103_0041637 | 3300048906 | Bacteria | 2824 |
| 573 | Ga0496103_0140695 | 3300048906 | Bacteria | 1543 |
| 574 | Ga0496104_0137687 | 3300048907 | Bacteria | 2345 |
| 575 | Ga0496104_0853155 | 3300048907 | Unclassified | 816 |
| 576 | Ga0496105_0171707 | 3300048908 | Bacteria | 1777 |
| 577 | Ga0496106_0121516 | 3300048909 | Bacteria | 2042 |
| 578 | Ga0496106_0205599 | 3300048909 | Bacteria | 1568 |
| 579 | Ga0496107_0018156 | 3300048910 | Bacteria | 4949 |
| 580 | Ga0496107_0090106 | 3300048910 | Unclassified | 2240 |
| 581 | Ga0496108_0013686 | 3300048911 | Bacteria | 6623 |
| 582 | Ga0496108_0032889 | 3300048911 | Bacteria | 4308 |
| 583 | Ga0496108_0156763 | 3300048911 | Bacteria | 1966 |
| 584 | Ga0496109_0178660 | 3300048912 | Bacteria | 1993 |
| 585 | Ga0496109_0579378 | 3300048912 | Bacteria | 1058 |
| 586 | Ga0496110_0016041 | 3300048913 | Bacteria | 6247 |
| 587 | Ga0496110_0023804 | 3300048913 | Bacteria | 5212 |
| 588 | Ga0496110_0219553 | 3300048913 | Bacteria | 1728 |
| 589 | Ga0496111_0022461 | 3300048914 | Bacteria | 4418 |
| 590 | Ga0496111_0125943 | 3300048914 | Bacteria | 1893 |
| 591 | Ga0496112_0105543 | 3300048915 | Bacteria | 2787 |
| 592 | Ga0496113_0015706 | 3300048916 | Bacteria | 5214 |
| 593 | Ga0496114_0174873 | 3300048917 | Bacteria | 1873 |
| 594 | Ga0496115_0003674 | 3300048918 | Bacteria | 11044 |
| 595 | Ga0496116_0121765 | 3300048919 | Bacteria | 1508 |
| 596 | Ga0496117_0012393 | 3300048920 | Bacteria | 7520 |
| 597 | Ga0496117_0014638 | 3300048920 | Bacteria | 6746 |
| 598 | Ga0496117_0040062 | 3300048920 | Bacteria | 3451 |
| 599 | Ga0496117_0047279 | 3300048920 | Bacteria | 3087 |
| 600 | Ga0496117_0063203 | 3300048920 | Bacteria | 2532 |
| 601 | Ga0496118_0002436 | 3300048921 | Bacteria | 25049 |
| 602 | Ga0496118_0023982 | 3300048921 | Bacteria | 5279 |
| 603 | Ga0496118_0027239 | 3300048921 | Bacteria | 4843 |
| 604 | Ga0496118_0098454 | 3300048921 | Bacteria | 1986 |
| 605 | Ga0496118_0116649 | 3300048921 | Bacteria | 1754 |
| 606 | Ga0496118_0163339 | 3300048921 | Bacteria | 1373 |
| 607 | Ga0496119_0102222 | 3300048922 | Bacteria | 1607 |
| 608 | Ga0496120_0071098 | 3300048923 | Bacteria | 1911 |
| 609 | Ga0496120_0233981 | 3300048923 | Bacteria | 871 |
| 610 | Ga0496121_0000175 | 3300048924 | Bacteria | 142910 |
| 611 | Ga0496121_0000650 | 3300048924 | Bacteria | 65007 |
| 612 | Ga0496121_0040635 | 3300048924 | Bacteria | 4077 |
| 613 | Ga0496121_0048915 | 3300048924 | Bacteria | 3592 |
| 614 | Ga0496121_0050973 | 3300048924 | Bacteria | 3490 |
| 615 | Ga0496121_0099521 | 3300048924 | Bacteria | 2247 |
| 616 | Ga0496121_0126821 | 3300048924 | Bacteria | 1917 |
| 617 | Ga0496122_0026729 | 3300048925 | Bacteria | 4964 |
| 618 | Ga0496122_0028593 | 3300048925 | Bacteria | 4724 |
| 619 | Ga0496122_0135922 | 3300048925 | Bacteria | 1549 |
| 620 | Ga0496123_0050545 | 3300048926 | Bacteria | 2776 |
| 621 | Ga0496123_0081779 | 3300048926 | Bacteria | 1961 |
| 622 | Ga0496123_0163235 | 3300048926 | Bacteria | 1185 |
| 623 | Ga0496123_0175105 | 3300048926 | Bacteria | 1127 |
| 624 | Ga0496124_0000129 | 3300048927 | Bacteria | 156648 |
| 625 | Ga0496124_0006227 | 3300048927 | Bacteria | 13070 |
| 626 | Ga0496124_0007123 | 3300048927 | Bacteria | 11972 |
| 627 | Ga0496124_0089345 | 3300048927 | Bacteria | 2516 |
| 628 | Ga0496124_0113648 | 3300048927 | Bacteria | 2175 |
| 629 | Ga0496124_0166013 | 3300048927 | Bacteria | 1716 |
| 630 | Ga0496124_0214970 | 3300048927 | Bacteria | 1451 |
| 631 | Ga0496124_0239613 | 3300048927 | Bacteria | 1350 |
| 632 | Ga0496124_0363207 | 3300048927 | Bacteria | 1019 |
| 633 | Ga0496125_0000445 | 3300048928 | Bacteria | 75404 |
| 634 | Ga0496125_0007177 | 3300048928 | Bacteria | 11883 |
| 635 | Ga0496125_0017604 | 3300048928 | Bacteria | 6808 |
| 636 | Ga0496125_0105320 | 3300048928 | Bacteria | 2062 |
| 637 | Ga0496125_0113688 | 3300048928 | Bacteria | 1952 |
| 638 | Ga0496125_0142321 | 3300048928 | Bacteria | 1665 |
| 639 | Ga0496125_0277712 | 3300048928 | Bacteria | 1040 |
| 640 | Ga0496126_0046922 | 3300048929 | Bacteria | 3958 |
| 641 | Ga0496126_0077467 | 3300048929 | Bacteria | 2947 |
| 642 | Ga0496126_0149598 | 3300048929 | Bacteria | 2002 |
| 643 | Ga0496126_0202533 | 3300048929 | Bacteria | 1675 |
| 644 | Ga0501033_0140763 | 3300049570 | Bacteria | 1744 |
| 645 | Ga0501034_0069690 | 3300049571 | Bacteria | 3528 |
| 646 | Ga0501043_0108214 | 3300049579 | Bacteria | 2184 |
| 647 | Ga0501047_0147011 | 3300049581 | Bacteria | 2233 |
| 648 | Ga0501047_0191251 | 3300049581 | Bacteria | 1910 |
| 649 | Ga0501211_005276 | 3300049658 | Bacteria | 1296 |
| 650 | Ga0501223_000066 | 3300049663 | Bacteria | 33567 |
| 651 | Ga0501223_000317 | 3300049663 | Bacteria | 12000 |
| 652 | Ga0501224_000076 | 3300049664 | Bacteria | 10275 |
| 653 | Ga0501233_000558 | 3300049668 | Bacteria | 6046 |
| 654 | Ga0501233_011054 | 3300049668 | Bacteria | 1789 |
| 655 | Ga0501235_003738 | 3300049669 | Bacteria | 3285 |
| 656 | Ga0501235_041828 | 3300049669 | Bacteria | 1049 |
| 657 | Ga0501225_0000137 | 3300049705 | Bacteria | 22173 |
| 658 | Ga0501225_0000228 | 3300049705 | Bacteria | 17699 |
| 659 | Ga0501225_0008682 | 3300049705 | Bacteria | 2909 |
| 660 | Ga0501234_000767 | 3300049707 | Bacteria | 4989 |
| 661 | Ga0501035_0294576 | 3300049822 | Bacteria | 1369 |
| 662 | Ga0501044_0090163 | 3300049823 | Bacteria | 3094 |
| 663 | Ga0501226_000183 | 3300049853 | Bacteria | 10218 |
| 664 | nmdc:mga06z11_9_c1 | 3300050494 | Bacteria | 109982 |
| 665 | nmdc:mga04h51_12_c1 | 3300050495 | Bacteria | 83117 |
| 666 | nmdc:mga07m45_101835_c1 | 3300050496 | Bacteria | 1649 |
| 667 | nmdc:mga05p37_27409_c1 | 3300050507 | Bacteria | 6934 |
| 668 | nmdc:mga05p37_844348_c1 | 3300050507 | Bacteria | 995 |
| 669 | nmdc:mga09592_115513_c1 | 3300050508 | Bacteria | 2303 |
| 670 | nmdc:mga06r32_10890_c1 | 3300050510 | Bacteria | 8189 |
| 671 | Ga0500643_023449 | 3300053087 | Bacteria | 1971 |
| 672 | Ga0500643_070832 | 3300053087 | Bacteria | 967 |
| 673 | Ga0500566_0007362 | 3300053094 | Bacteria | 6519 |
| 674 | Ga0500562_029007 | 3300053108 | Bacteria | 1455 |
| 675 | Ga0500592_000050 | 3300053116 | Bacteria | 35179 |
| 676 | Ga0500594_0001614 | 3300053118 | Bacteria | 4902 |
| 677 | Ga0500595_015056 | 3300053119 | Bacteria | 2913 |
| 678 | Ga0500658_0048476 | 3300053134 | Bacteria | 1727 |
| 679 | Ga0500559_0144605 | 3300053136 | Bacteria | 1114 |
| 680 | Ga0500573_0000366 | 3300053140 | Bacteria | 19207 |
| 681 | Ga0500573_0170376 | 3300053140 | Bacteria | 1178 |
| 682 | Ga0500577_0061655 | 3300053142 | Bacteria | 1444 |
| 683 | Ga0500616_0105036 | 3300053153 | Bacteria | 1374 |
| 684 | Ga0500624_000084 | 3300053157 | Bacteria | 47961 |
| 685 | Ga0500627_0000452 | 3300053158 | Bacteria | 11132 |
| 686 | Ga0500627_0000938 | 3300053158 | Bacteria | 7861 |
| 687 | Ga0500645_005027 | 3300053730 | Bacteria | 4952 |
| 688 | Ga0466962_0005982 | 3300061719 | Bacteria | 5846 |
| 689 | 2512644916 | 2512564014 | Bacteria | 4639632 |
| 690 | 2600228822 | 2599185359 | Bacteria | 4772316 |
| 691 | 2644125801 | 2643221622 | Bacteria | 4212502 |
| 692 | 2778124399 | 2775507255 | Bacteria | 3945731 |
| 693 | 2809064386 | 2808606401 | Bacteria | 4586670 |
| 694 | 2809080449 | 2808606404 | Bacteria | 4652788 |
| 695 | 2809084718 | 2808606405 | Bacteria | 4586632 |
| 696 | 2819714649 | 2818991466 | Bacteria | 4748179 |
| 697 | 2879165271 | 2879163058 | Bacteria | 4223965 |
| 698 | 2880519159 | 2880518877 | Bacteria | 5012590 |
| 699 | 2885428503 | 2885427238 | Bacteria | 2291351 |
| 700 | 2928030398 | 2928027323 | Bacteria | 4382488 |
| 701 | 2928529152 | 2928526807 | Bacteria | 4760224 |
| 702 | 2928968696 | 2928968154 | Bacteria | 4633371 |
| 703 | 2984557324 | 2984555340 | Bacteria | 4247089 |
| 704 | 2984568279 | 2984564862 | Bacteria | 4339992 |
| 705 | Ga0495670_0000028 | |||
| 706 | SwRhRL2b_contig_1489105 | |||
| 707 | JGI24736J21556_1002251 | |||
| 708 | JGI24741J21665_1000549 | |||
| 709 | JGI24752J21851_1001710 | |||
| 710 | JGI24740J21852_10004963 | |||
| 711 | JGI24740J21852_10005015 | |||
| 712 | JGI24739J22299_10011325 | |||
| 713 | JGI24737J22298_10002940 | |||
| 714 | JGI24737J22298_10005153 | |||
| 715 | JGI24735J21928_10001689 | |||
| 716 | JGI24735J21928_10002252 | |||
| 717 | JGI24735J21928_10003032 | |||
| 718 | JGI24735J21928_10010004 | |||
| 719 | JGI24735J21928_10015767 | |||
| 720 | JGI24735J21928_10050673 | |||
| 721 | JGI24750J21931_1000042 | |||
| 722 | JGI24748J21848_1000063 | |||
| 723 | JGI24738J21930_10001001 | |||
| 724 | JGI24738J21930_10001487 | |||
| 725 | JGI24744J21845_10002202 | |||
| 726 | JGI24034J26672_10000007 | |||
| 727 | JGI25150J39212_1002132 | |||
| 728 | JGI25165J46597_1000145 | |||
| 729 | JGI25153J46596_10000028 | |||
| 730 | rootH2_10161563 | |||
| 731 | rootH2_10235635 | |||
| 732 | rootL2_10107312 | |||
| 733 | rootH1_10190613 | |||
| 734 | Ga0055526_1000478 | |||
| 735 | Ga0055537_1001154 | |||
| 736 | Ga0055524_1000457 | |||
| 737 | Ga0055530_10041505 | |||
| 738 | Ga0055540_1001446 | |||
| 739 | Ga0055540_1001525 | |||
| 740 | Ga0055531_10000384 | |||
| 741 | Ga0065165_1002862 | |||
| 742 | Ga0065165_1003940 | |||
| 743 | Ga0065165_1031534 | |||
| 744 | Ga0065165_1044517 | |||
| 745 | Ga0065704_10007250 | |||
| 746 | Ga0065704_10072419 | |||
| 747 | Ga0065707_10082875 | |||
| 748 | Ga0070658_10000033 | |||
| 749 | Ga0070658_10037857 | |||
| 750 | Ga0070658_10160501 | |||
| 751 | Ga0070676_10411414 | |||
| 752 | Ga0070676_10503058 | |||
| 753 | Ga0070690_100000110 | |||
| 754 | Ga0070690_100019099 | |||
| 755 | Ga0070670_100000075 | |||
| 756 | Ga0070670_100050727 | |||
| 757 | Ga0070670_100085590 | |||
| 758 | Ga0070670_100111155 | |||
| 759 | Ga0070670_100169856 | |||
| 760 | Ga0068869_100191317 | |||
| 761 | Ga0070666_10000417 | |||
| 762 | Ga0070666_10003441 | |||
| 763 | Ga0070660_100002857 | |||
| 764 | Ga0070660_100011482 | |||
| 765 | Ga0070660_100054688 | |||
| 766 | Ga0070660_100063008 | |||
| 767 | Ga0070660_100073995 | |||
| 768 | Ga0070660_100090135 | |||
| 769 | Ga0070660_100092582 | |||
| 770 | Ga0070660_100135012 | |||
| 771 | Ga0070660_100173181 | |||
| 772 | Ga0070661_100130953 | |||
| 773 | Ga0070661_100199930 | |||
| 774 | Ga0070661_100254965 | |||
| 775 | Ga0070661_100274167 | |||
| 776 | Ga0070692_10018735 | |||
| 777 | Ga0070668_100089004 | |||
| 778 | Ga0070669_100000332 | |||
| 779 | Ga0070669_100037676 | |||
| 780 | Ga0070675_100001516 | |||
| 781 | Ga0070675_100146846 | |||
| 782 | Ga0070671_100022882 | |||
| 783 | Ga0070671_100055455 | |||
| 784 | Ga0070671_100061130 | |||
| 785 | Ga0070671_100073726 | |||
| 786 | Ga0070671_100099761 | |||
| 787 | Ga0070674_100021920 | |||
| 788 | Ga0070674_100092379 | |||
| 789 | Ga0070673_100002629 | |||
| 790 | Ga0070659_100002258 | |||
| 791 | Ga0070659_100022028 | |||
| 792 | Ga0070659_100057141 | |||
| 793 | Ga0070659_100062359 | |||
| 794 | Ga0070659_100115132 | |||
| 795 | Ga0070659_100181006 | |||
| 796 | Ga0070659_100204838 | |||
| 797 | Ga0070659_100271573 | |||
| 798 | Ga0070659_100433901 | |||
| 799 | Ga0070659_100676045 | |||
| 800 | Ga0070667_100000039 | |||
| 801 | Ga0070667_100259304 | |||
| 802 | Ga0070663_100004890 | |||
| 803 | Ga0070663_100132933 | |||
| 804 | Ga0070663_100181416 | |||
| 805 | Ga0070678_100001866 | |||
| 806 | Ga0070678_100004810 | |||
| 807 | Ga0070662_100006444 | |||
| 808 | Ga0070662_100011803 | |||
| 809 | Ga0070662_100168906 | |||
| 810 | Ga0070681_10102501 | |||
| 811 | Ga0068867_100005781 | |||
| 812 | Ga0068867_100006557 | |||
| 813 | Ga0070685_10000036 | |||
| 814 | Ga0068853_100008364 | |||
| 815 | Ga0068853_100048683 | |||
| 816 | Ga0068853_100552448 | |||
| 817 | Ga0068853_100614750 | |||
| 818 | Ga0068853_100842060 | |||
| 819 | Ga0070672_100018490 | |||
| 820 | Ga0070672_100059421 | |||
| 821 | Ga0070672_100250539 | |||
| 822 | Ga0070686_100000045 | |||
| 823 | Ga0070693_100096773 | |||
| 824 | Ga0070665_100000042 | |||
| 825 | Ga0070665_100138494 | |||
| 826 | Ga0070665_100139592 | |||
| 827 | Ga0068855_100117343 | |||
| 828 | Ga0068855_100131931 | |||
| 829 | Ga0068855_100526948 | |||
| 830 | Ga0070664_100014603 | |||
| 831 | Ga0070664_100044891 | |||
| 832 | Ga0068857_100003501 | |||
| 833 | Ga0068857_100018632 | |||
| 834 | Ga0068857_100235716 | |||
| 835 | Ga0068857_100244914 | |||
| 836 | Ga0068857_100392160 | |||
| 837 | Ga0068854_100016231 | |||
| 838 | Ga0068854_100025435 | |||
| 839 | Ga0068854_100067438 | |||
| 840 | Ga0068856_100016269 | |||
| 841 | Ga0068856_100036758 | |||
| 842 | Ga0068856_100064590 | |||
| 843 | Ga0068856_100246893 | |||
| 844 | Ga0068852_100068729 | |||
| 845 | Ga0068852_100199080 | |||
| 846 | Ga0068852_100454952 | |||
| 847 | Ga0068852_101093151 | |||
| 848 | Ga0068859_100005488 | |||
| 849 | Ga0068859_100022537 | |||
| 850 | Ga0068864_100000016 | |||
| 851 | Ga0068864_100157801 | |||
| 852 | Ga0068864_100503707 | |||
| 853 | Ga0068861_100000321 | |||
| 854 | Ga0068861_100000965 | |||
| 855 | Ga0068851_10008938 | |||
| 856 | Ga0068851_10027735 | |||
| 857 | Ga0068851_10103684 | |||
| 858 | Ga0068863_100000033 | |||
| 859 | Ga0068863_100000280 | |||
| 860 | Ga0068863_100007192 | |||
| 861 | Ga0068863_100019160 | |||
| 862 | Ga0068858_100007900 | |||
| 863 | Ga0068858_100069059 | |||
| 864 | Ga0068858_100243409 | |||
| 865 | Ga0068860_100000182 | |||
| 866 | Ga0068860_100112898 | |||
| 867 | Ga0068862_100000040 | |||
| 868 | Ga0068862_100000308 | |||
| 869 | Ga0068862_100009087 | |||
| 870 | Ga0068862_100266217 | |||
| 871 | Ga0068862_100361141 | |||
| 872 | Ga0081455_10160295 | |||
| 873 | Ga0075368_10000033 | |||
| 874 | Ga0075367_10000481 | |||
| 875 | Ga0097621_100048516 | |||
| 876 | Ga0075370_10066614 | |||
| 877 | Ga0068871_100562537 | |||
| 878 | Ga0075430_100059109 | |||
| 879 | Ga0075431_100151201 | |||
| 880 | Ga0075431_100366551 | |||
| 881 | Ga0075429_100161451 | |||
| 882 | Ga0068865_100004177 | |||
| 883 | Ga0097620_100005488 | |||
| 884 | Ga0097620_100022537 | |||
| 885 | Ga0105251_10001444 | |||
| 886 | Ga0105251_10017044 | |||
| 887 | Ga0105240_10007666 | |||
| 888 | Ga0105240_10026155 | |||
| 889 | Ga0105240_10098942 | |||
| 890 | Ga0105240_10128458 | |||
| 891 | Ga0105240_10873625 | |||
| 892 | Ga0105245_10001867 | |||
| 893 | Ga0105247_10214021 | |||
| 894 | Ga0114129_10841433 | |||
| 895 | Ga0105243_10104131 | |||
| 896 | Ga0105241_10008072 | |||
| 897 | Ga0105241_10217538 | |||
| 898 | Ga0105242_10064796 | |||
| 899 | Ga0105248_10000021 | |||
| 900 | Ga0105248_10124883 | |||
| 901 | Ga0105248_10394403 | |||
| 902 | Ga0105248_10982508 | |||
| 903 | Ga0105237_10009418 | |||
| 904 | Ga0105237_10013028 | |||
| 905 | Ga0105237_10050016 | |||
| 906 | Ga0105237_10054292 | |||
| 907 | Ga0105238_10065766 | |||
| 908 | Ga0105238_10120716 | |||
| 909 | Ga0105238_10421674 | |||
| 910 | Ga0105249_10000012 | |||
| 911 | Ga0105249_10002603 | |||
| 912 | Ga0105249_10325529 | |||
| 913 | Ga0105249_10807819 | |||
| 914 | Ga0105148_100202 | |||
| 915 | Ga0105239_10000461 | |||
| 916 | Ga0105246_10176826 | |||
| 917 | Ga0157373_10121323 | |||
| 918 | Ga0157373_10389734 | |||
| 919 | Ga0157373_10492926 | |||
| 920 | Ga0157371_10085604 | |||
| 921 | Ga0157371_10149242 | |||
| 922 | Ga0157371_10169826 | |||
| 923 | Ga0157371_10177025 | |||
| 924 | Ga0157370_10000008 | |||
| 925 | Ga0157370_10002308 | |||
| 926 | Ga0157370_10024209 | |||
| 927 | Ga0157369_10031631 | |||
| 928 | Ga0157369_10112395 | |||
| 929 | Ga0157369_10816810 | |||
| 930 | Ga0157374_10004197 | |||
| 931 | Ga0157374_10067557 | |||
| 932 | Ga0157374_10372050 | |||
| 933 | Ga0163162_10096754 | |||
| 934 | Ga0163162_10202484 | |||
| 935 | Ga0163162_10204173 | |||
| 936 | Ga0157372_10018134 | |||
| 937 | Ga0157372_10404374 | |||
| 938 | Ga0163163_10081360 | |||
| 939 | Ga0163163_10120063 | |||
| 940 | Ga0163163_10159477 | |||
| 941 | Ga0157380_10000440 | |||
| 942 | Ga0157380_10034756 | |||
| 943 | Ga0157379_10003144 | |||
| 944 | Ga0157379_10036117 | |||
| 945 | Ga0157379_10121240 | |||
| 946 | Ga0157376_10130417 | |||
| 947 | Ga0163161_10000202 | |||
| 948 | Ga0163161_10017029 | |||
| 949 | Ga0163161_10355841 | |||
| 950 | Ga0163161_10406912 | |||
| 951 | Ga0206353_11760290 | |||
| 952 | Ga0213876_10033404 | |||
| 953 | Ga0213875_10000721 | |||
| 954 | Ga0207672_1001024 | |||
| 955 | Ga0207427_100545 | |||
| 956 | Ga0207425_1000005 | |||
| 957 | Ga0207425_1004365 | |||
| 958 | Ga0209026_1002632 | |||
| 959 | Ga0209148_1000338 | |||
| 960 | Ga0209129_1000825 | |||
| 961 | Ga0209233_1000207 | |||
| 962 | Ga0209565_1000007 | |||
| 963 | Ga0209565_1000056 | |||
| 964 | Ga0209455_1000480 | |||
| 965 | Ga0209455_1018960 | |||
| 966 | Ga0209673_1001497 | |||
| 967 | Ga0209025_1000296 | |||
| 968 | Ga0209758_1000002 | |||
| 969 | Ga0209758_1002418 | |||
| 970 | Ga0209758_1066833 | |||
| 971 | Ga0209050_1000005 | |||
| 972 | Ga0209050_1000196 | |||
| 973 | Ga0209050_1008839 | |||
| 974 | Ga0209050_1016183 | |||
| 975 | Ga0209256_1000009 | |||
| 976 | Ga0209051_1000153 | |||
| 977 | Ga0209257_1000228 | |||
| 978 | Ga0209257_1003469 | |||
| 979 | Ga0209257_1004247 | |||
| 980 | Ga0209257_1004769 | |||
| 981 | Ga0207697_10016147 | |||
| 982 | Ga0207656_10049933 | |||
| 983 | Ga0207713_1007763 | |||
| 984 | Ga0207710_10166100 | |||
| 985 | Ga0207688_10032718 | |||
| 986 | Ga0207680_10000012 | |||
| 987 | Ga0207647_10001622 | |||
| 988 | Ga0207647_10104017 | |||
| 989 | Ga0207647_10135199 | |||
| 990 | Ga0207705_10000002 | |||
| 991 | Ga0207705_10000027 | |||
| 992 | Ga0207705_10007714 | |||
| 993 | Ga0207705_10011424 | |||
| 994 | Ga0207705_10042116 | |||
| 995 | Ga0207705_10117758 | |||
| 996 | Ga0207705_10192064 | |||
| 997 | Ga0207705_10194448 | |||
| 998 | Ga0207654_10001661 | |||
| 999 | Ga0207654_10049270 | |||
| 1000 | Ga0207695_10000641 | |||
| 1001 | Ga0207695_10006576 | |||
| 1002 | Ga0207695_10024580 | |||
| 1003 | Ga0207695_10077765 | |||
| 1004 | Ga0207695_10098637 | |||
| 1005 | Ga0207695_10134453 | |||
| 1006 | Ga0207671_10002738 | |||
| 1007 | Ga0207671_10203960 | |||
| 1008 | Ga0207657_10008853 | |||
| 1009 | Ga0207657_10065116 | |||
| 1010 | Ga0207657_10065750 | |||
| 1011 | Ga0207657_10066709 | |||
| 1012 | Ga0207657_10103427 | |||
| 1013 | Ga0207657_10189101 | |||
| 1014 | Ga0207657_10227301 | |||
| 1015 | Ga0207657_10254383 | |||
| 1016 | Ga0207649_10010061 | |||
| 1017 | Ga0207649_10050916 | |||
| 1018 | Ga0207649_10126732 | |||
| 1019 | Ga0207649_10312385 | |||
| 1020 | Ga0207649_10325948 | |||
| 1021 | Ga0207649_10352238 | |||
| 1022 | Ga0207681_10000076 | |||
| 1023 | Ga0207694_10001461 | |||
| 1024 | Ga0207694_10028824 | |||
| 1025 | Ga0207694_10039527 | |||
| 1026 | Ga0207650_10000069 | |||
| 1027 | Ga0207650_10026743 | |||
| 1028 | Ga0207650_10033961 | |||
| 1029 | Ga0207650_10061262 | |||
| 1030 | Ga0207650_10157802 | |||
| 1031 | Ga0207659_10059191 | |||
| 1032 | Ga0207687_10003098 | |||
| 1033 | Ga0207644_10003422 | |||
| 1034 | Ga0207644_10067193 | |||
| 1035 | Ga0207644_10072418 | |||
| 1036 | Ga0207644_10073678 | |||
| 1037 | Ga0207644_10081104 | |||
| 1038 | Ga0207644_10225803 | |||
| 1039 | Ga0207690_10003689 | |||
| 1040 | Ga0207690_10007350 | |||
| 1041 | Ga0207690_10040990 | |||
| 1042 | Ga0207690_10043362 | |||
| 1043 | Ga0207690_10093263 | |||
| 1044 | Ga0207690_10099311 | |||
| 1045 | Ga0207690_10129291 | |||
| 1046 | Ga0207690_10161495 | |||
| 1047 | Ga0207690_10205312 | |||
| 1048 | Ga0207690_10314363 | |||
| 1049 | Ga0207706_10001442 | |||
| 1050 | Ga0207706_10018968 | |||
| 1051 | Ga0207706_10043654 | |||
| 1052 | Ga0207706_10160806 | |||
| 1053 | Ga0207706_10246139 | |||
| 1054 | Ga0207706_10511476 | |||
| 1055 | Ga0207706_10643802 | |||
| 1056 | Ga0207686_10028588 | |||
| 1057 | Ga0207709_10105314 | |||
| 1058 | Ga0207669_10055566 | |||
| 1059 | Ga0207669_10078646 | |||
| 1060 | Ga0207691_10000631 | |||
| 1061 | Ga0207691_10037826 | |||
| 1062 | Ga0207711_10000025 | |||
| 1063 | Ga0207711_10010871 | |||
| 1064 | Ga0207711_10016625 | |||
| 1065 | Ga0207689_10087928 | |||
| 1066 | Ga0207689_10100100 | |||
| 1067 | Ga0207679_10005299 | |||
| 1068 | Ga0207679_10016820 | |||
| 1069 | Ga0207679_10196654 | |||
| 1070 | Ga0207667_10004663 | |||
| 1071 | Ga0207667_10044332 | |||
| 1072 | Ga0207667_10219943 | |||
| 1073 | Ga0207667_10277086 | |||
| 1074 | Ga0207651_10008206 | |||
| 1075 | Ga0207712_10000021 | |||
| 1076 | Ga0207712_10002020 | |||
| 1077 | Ga0207712_10134447 | |||
| 1078 | Ga0207668_10135614 | |||
| 1079 | Ga0207640_10018490 | |||
| 1080 | Ga0207640_10158364 | |||
| 1081 | Ga0207640_10228286 | |||
| 1082 | Ga0207658_10000652 | |||
| 1083 | Ga0207658_10003067 | |||
| 1084 | Ga0207658_10202436 | |||
| 1085 | Ga0207677_10087570 | |||
| 1086 | Ga0207703_10010176 | |||
| 1087 | Ga0207703_10054384 | |||
| 1088 | Ga0207639_10071982 | |||
| 1089 | Ga0207639_10315558 | |||
| 1090 | Ga0207639_10401778 | |||
| 1091 | Ga0207639_10787962 | |||
| 1092 | Ga0207678_10001799 | |||
| 1093 | Ga0207678_10004357 | |||
| 1094 | Ga0207678_10045975 | |||
| 1095 | Ga0207678_10241115 | |||
| 1096 | Ga0207702_10002022 | |||
| 1097 | Ga0207702_10008254 | |||
| 1098 | Ga0207641_10000002 | |||
| 1099 | Ga0207641_10000414 | |||
| 1100 | Ga0207641_10005204 | |||
| 1101 | Ga0207648_10001344 | |||
| 1102 | Ga0207648_10062609 | |||
| 1103 | Ga0207676_10000353 | |||
| 1104 | Ga0207676_10009609 | |||
| 1105 | Ga0207676_10077831 | |||
| 1106 | Ga0207676_10646159 | |||
| 1107 | Ga0207674_10000291 | |||
| 1108 | Ga0207674_10010820 | |||
| 1109 | Ga0207674_10042500 | |||
| 1110 | Ga0207674_10114135 | |||
| 1111 | Ga0207674_10246853 | |||
| 1112 | Ga0207674_10251420 | |||
| 1113 | Ga0207675_100000227 | |||
| 1114 | Ga0207675_100000998 | |||
| 1115 | Ga0207683_10004993 | |||
| 1116 | Ga0207683_10010089 | |||
| 1117 | Ga0207698_10001499 | |||
| 1118 | Ga0207698_10038110 | |||
| 1119 | Ga0207698_10079015 | |||
| 1120 | Ga0207698_10095930 | |||
| 1121 | Ga0207698_10130366 | |||
| 1122 | Ga0207698_10304513 | |||
| 1123 | Ga0209813_10000041 | |||
| 1124 | Ga0268266_10000054 | |||
| 1125 | Ga0268266_10116025 | |||
| 1126 | Ga0268266_10194973 | |||
| 1127 | Ga0268266_10376461 | |||
| 1128 | Ga0268265_10000003 | |||
| 1129 | Ga0268265_10002814 | |||
| 1130 | Ga0268265_10239805 | |||
| 1131 | Ga0268265_10315647 | |||
| 1132 | Ga0268264_10000074 | |||
| 1133 | Ga0268264_10754480 | |||
| 1134 | Ga0307408_100036711 | |||
| 1135 | Ga0307408_100453026 | |||
| 1136 | Ga0307405_10038560 | |||
| 1137 | Ga0307413_10004075 | |||
| 1138 | Ga0307413_10028063 | |||
| 1139 | Ga0307413_10119107 | |||
| 1140 | Ga0307410_10000281 | |||
| 1141 | Ga0307410_10019341 | |||
| 1142 | Ga0307410_10035705 | |||
| 1143 | Ga0307406_10020481 | |||
| 1144 | Ga0307406_10149122 | |||
| 1145 | Ga0307406_10229868 | |||
| 1146 | Ga0307407_10001856 | |||
| 1147 | Ga0307407_10004947 | |||
| 1148 | Ga0307407_10209618 | |||
| 1149 | Ga0307412_10000453 | |||
| 1150 | Ga0307412_10005872 | |||
| 1151 | Ga0307412_10132167 | |||
| 1152 | Ga0307409_100013771 | |||
| 1153 | Ga0307409_100065828 | |||
| 1154 | Ga0307409_100277011 | |||
| 1155 | Ga0307416_100009701 | |||
| 1156 | Ga0307416_100033727 | |||
| 1157 | Ga0307416_100069334 | |||
| 1158 | Ga0307416_100225252 | |||
| 1159 | Ga0307414_10000248 | |||
| 1160 | Ga0307414_10004115 | |||
| 1161 | Ga0307414_10008487 | |||
| 1162 | Ga0307414_10018719 | |||
| 1163 | Ga0307414_10373356 | |||
| 1164 | Ga0307411_10004182 | |||
| 1165 | Ga0307411_10012924 | |||
| 1166 | Ga0307411_10021318 | |||
| 1167 | Ga0307411_10076900 | |||
| 1168 | Ga0307411_10079644 | |||
| 1169 | Ga0307411_10106071 | |||
| 1170 | Ga0307415_100272494 | |||
| 1171 | Ga0373932_0041935 | |||
| 1172 | Ga0373932_0045385 | |||
| 1173 | Ga0395899_0000251 | |||
| 1174 | Ga0395899_0001062 | |||
| 1175 | Ga0395899_0001983 | |||
| 1176 | Ga0395900_0000084 | |||
| 1177 | Ga0395900_0022623 | |||
| 1178 | Ga0395900_0025014 | |||
| 1179 | Ga0395900_0479610 | |||
| 1180 | Ga0395898_0000021 | |||
| 1181 | Ga0395898_0002422 | |||
| 1182 | Ga0395905_0000006 | |||
| 1183 | Ga0395905_0000762 | |||
| 1184 | Ga0395905_0031744 | |||
| 1185 | Ga0395905_0073303 | |||
| 1186 | Ga0395905_0234336 | |||
| 1187 | Ga0395905_0528582 | |||
| 1188 | Ga0436364_0322209 | |||
| 1189 | Ga0436364_0462751 | |||
| 1190 | Ga0395901_0008794 | |||
| 1191 | Ga0395901_0009640 | |||
| 1192 | Ga0395901_0069324 | |||
| 1193 | Ga0436365_0695304 | |||
| 1194 | Ga0436365_1474733 | |||
| 1195 | Ga0436363_0379517 | |||
| 1196 | Ga0436363_1509936 | |||
| 1197 | Ga0439436_0007826 | |||
| 1198 | Ga0439461_0000239 | |||
| 1199 | Ga0439461_0006785 | |||
| 1200 | Ga0439465_0000177 | |||
| 1201 | Ga0439465_0012688 | |||
| 1202 | Ga0451806_431010 | |||
| 1203 | Ga0451804_1038976 | |||
| 1204 | Ga0451807_1283003 | |||
| 1205 | Ga0439431_0000207 | |||
| 1206 | Ga0439431_0006020 | |||
| 1207 | Ga0439442_002361 | |||
| 1208 | Ga0439445_0000060 | |||
| 1209 | Ga0439448_0001841 | |||
| 1210 | Ga0439432_017104 | |||
| 1211 | Ga0439455_0007574 | |||
| 1212 | Ga0439462_0000195 | |||
| 1213 | Ga0439446_0074395 | |||
| 1214 | Ga0439458_0000436 | |||
| 1215 | Ga0439434_0003840 | |||
| 1216 | Ga0439434_0007436 | |||
| 1217 | Ga0439464_0044684 | |||
| 1218 | Ga0466972_0010895 | |||
| 1219 | Ga0466972_0068978 | |||
| 1220 | Ga0466965_0084296 | |||
| 1221 | Ga0466961_0221293 | |||
| 1222 | Ga0466963_0005621 | |||
| 1223 | Ga0466963_0014337 | |||
| 1224 | Ga0466963_0087573 | |||
| 1225 | Ga0466971_0013927 | |||
| 1226 | Ga0466971_0131759 | |||
| 1227 | Ga0466968_0042644 | |||
| 1228 | Ga0466970_0050313 | |||
| 1229 | Ga0466957_0016826 | |||
| 1230 | Ga0466957_0206908 | |||
| 1231 | Ga0466960_0003085 | |||
| 1232 | Ga0466960_0035587 | |||
| 1233 | Ga0466958_0012119 | |||
| 1234 | Ga0466958_0187392 | |||
| 1235 | Ga0466958_0301418 | |||
| 1236 | Ga0466967_0007703 | |||
| 1237 | Ga0466967_0050831 | |||
| 1238 | Ga0495617_029351 | |||
| 1239 | Ga0495627_006278 | |||
| 1240 | Ga0495627_051928 | |||
| 1241 | Ga0495583_0001401 | |||
| 1242 | Ga0495606_0094008 | |||
| 1243 | Ga0495610_0000206 | |||
| 1244 | Ga0495610_0049660 | |||
| 1245 | Ga0495616_0000189 | |||
| 1246 | Ga0495632_0001899 | |||
| 1247 | Ga0495637_0029360 | |||
| 1248 | Ga0495643_0000162 | |||
| 1249 | Ga0495648_0000038 | |||
| 1250 | Ga0495663_0018160 | |||
| 1251 | Ga0495663_0024238 | |||
| 1252 | Ga0495654_0180699 | |||
| 1253 | Ga0495621_0007456 | |||
| 1254 | Ga0495622_0093923 | |||
| 1255 | Ga0495633_0130434 | |||
| 1256 | Ga0495625_0257602 | |||
| 1257 | Ga0495671_0000034 | |||
| 1258 | Ga0495671_0000062 | |||
| 1259 | Ga0495671_0003910 | |||
| 1260 | Ga0495636_0163863 | |||
| 1261 | Ga0495673_0000013 | |||
| 1262 | Ga0495673_0084474 | |||
| 1263 | Ga0495681_0000106 | |||
| 1264 | Ga0495681_0008636 | |||
| 1265 | Ga0495686_0000366 | |||
| 1266 | Ga0495686_0000986 | |||
| 1267 | Ga0495686_0071813 | |||
| 1268 | Ga0496100_0001542 | |||
| 1269 | Ga0496100_0029233 | |||
| 1270 | Ga0496101_0003699 | |||
| 1271 | Ga0496102_0067110 | |||
| 1272 | Ga0496102_0088970 | |||
| 1273 | Ga0496102_0156222 | |||
| 1274 | Ga0496102_0270111 | |||
| 1275 | Ga0496103_0003725 | |||
| 1276 | Ga0496103_0041637 | |||
| 1277 | Ga0496103_0140695 | |||
| 1278 | Ga0496104_0137687 | |||
| 1279 | Ga0496104_0853155 | |||
| 1280 | Ga0496105_0171707 | |||
| 1281 | Ga0496106_0121516 | |||
| 1282 | Ga0496106_0205599 | |||
| 1283 | Ga0496107_0018156 | |||
| 1284 | Ga0496107_0090106 | |||
| 1285 | Ga0496108_0013686 | |||
| 1286 | Ga0496108_0032889 | |||
| 1287 | Ga0496108_0156763 | |||
| 1288 | Ga0496109_0178660 | |||
| 1289 | Ga0496109_0579378 | |||
| 1290 | Ga0496110_0016041 | |||
| 1291 | Ga0496110_0023804 | |||
| 1292 | Ga0496110_0219553 | |||
| 1293 | Ga0496111_0022461 | |||
| 1294 | Ga0496111_0125943 | |||
| 1295 | Ga0496112_0105543 | |||
| 1296 | Ga0496113_0015706 | |||
| 1297 | Ga0496114_0174873 | |||
| 1298 | Ga0496115_0003674 | |||
| 1299 | Ga0496116_0121765 | |||
| 1300 | Ga0496117_0012393 | |||
| 1301 | Ga0496117_0014638 | |||
| 1302 | Ga0496117_0040062 | |||
| 1303 | Ga0496117_0047279 | |||
| 1304 | Ga0496117_0063203 | |||
| 1305 | Ga0496118_0002436 | |||
| 1306 | Ga0496118_0023982 | |||
| 1307 | Ga0496118_0027239 | |||
| 1308 | Ga0496118_0098454 | |||
| 1309 | Ga0496118_0116649 | |||
| 1310 | Ga0496118_0163339 | |||
| 1311 | Ga0496119_0102222 | |||
| 1312 | Ga0496120_0071098 | |||
| 1313 | Ga0496120_0233981 | |||
| 1314 | Ga0496121_0000175 | |||
| 1315 | Ga0496121_0000650 | |||
| 1316 | Ga0496121_0040635 | |||
| 1317 | Ga0496121_0048915 | |||
| 1318 | Ga0496121_0050973 | |||
| 1319 | Ga0496121_0099521 | |||
| 1320 | Ga0496121_0126821 | |||
| 1321 | Ga0496122_0026729 | |||
| 1322 | Ga0496122_0028593 | |||
| 1323 | Ga0496122_0135922 | |||
| 1324 | Ga0496123_0050545 | |||
| 1325 | Ga0496123_0081779 | |||
| 1326 | Ga0496123_0163235 | |||
| 1327 | Ga0496123_0175105 | |||
| 1328 | Ga0496124_0000129 | |||
| 1329 | Ga0496124_0006227 | |||
| 1330 | Ga0496124_0007123 | |||
| 1331 | Ga0496124_0089345 | |||
| 1332 | Ga0496124_0113648 | |||
| 1333 | Ga0496124_0166013 | |||
| 1334 | Ga0496124_0214970 | |||
| 1335 | Ga0496124_0239613 | |||
| 1336 | Ga0496124_0363207 | |||
| 1337 | Ga0496125_0000445 | |||
| 1338 | Ga0496125_0007177 | |||
| 1339 | Ga0496125_0017604 | |||
| 1340 | Ga0496125_0105320 | |||
| 1341 | Ga0496125_0113688 | |||
| 1342 | Ga0496125_0142321 | |||
| 1343 | Ga0496125_0277712 | |||
| 1344 | Ga0496126_0046922 | |||
| 1345 | Ga0496126_0077467 | |||
| 1346 | Ga0496126_0149598 | |||
| 1347 | Ga0496126_0202533 | |||
| 1348 | Ga0501033_0140763 | |||
| 1349 | Ga0501034_0069690 | |||
| 1350 | Ga0501043_0108214 | |||
| 1351 | Ga0501047_0147011 | |||
| 1352 | Ga0501047_0191251 | |||
| 1353 | Ga0501211_005276 | |||
| 1354 | Ga0501223_000066 | |||
| 1355 | Ga0501223_000317 | |||
| 1356 | Ga0501224_000076 | |||
| 1357 | Ga0501233_000558 | |||
| 1358 | Ga0501233_011054 | |||
| 1359 | Ga0501235_003738 | |||
| 1360 | Ga0501235_041828 | |||
| 1361 | Ga0501225_0000137 | |||
| 1362 | Ga0501225_0000228 | |||
| 1363 | Ga0501225_0008682 | |||
| 1364 | Ga0501234_000767 | |||
| 1365 | Ga0501035_0294576 | |||
| 1366 | Ga0501044_0090163 | |||
| 1367 | Ga0501226_000183 | |||
| 1368 | nmdc:mga06z11_9_c1 | |||
| 1369 | nmdc:mga04h51_12_c1 | |||
| 1370 | nmdc:mga07m45_101835_c1 | |||
| 1371 | nmdc:mga05p37_27409_c1 | |||
| 1372 | nmdc:mga05p37_844348_c1 | |||
| 1373 | nmdc:mga09592_115513_c1 | |||
| 1374 | nmdc:mga06r32_10890_c1 | |||
| 1375 | Ga0500643_023449 | |||
| 1376 | Ga0500643_070832 | |||
| 1377 | Ga0500566_0007362 | |||
| 1378 | Ga0500562_029007 | |||
| 1379 | Ga0500592_000050 | |||
| 1380 | Ga0500594_0001614 | |||
| 1381 | Ga0500595_015056 | |||
| 1382 | Ga0500658_0048476 | |||
| 1383 | Ga0500559_0144605 | |||
| 1384 | Ga0500573_0000366 | |||
| 1385 | Ga0500573_0170376 | |||
| 1386 | Ga0500577_0061655 | |||
| 1387 | Ga0500616_0105036 | |||
| 1388 | Ga0500624_000084 | |||
| 1389 | Ga0500627_0000452 | |||
| 1390 | Ga0500627_0000938 | |||
| 1391 | Ga0500645_005027 | |||
| 1392 | Ga0466962_0005982 | |||
| 1393 | 2512644916 | |||
| 1394 | 2600228822 | |||
| 1395 | 2644125801 | |||
| 1396 | 2778124399 | |||
| 1397 | 2809064386 | |||
| 1398 | 2809080449 | |||
| 1399 | 2809084718 | |||
| 1400 | 2819714649 | |||
| 1401 | 2879165271 | |||
| 1402 | 2880519159 | |||
| 1403 | 2885428503 | |||
| 1404 | 2928030398 | |||
| 1405 | 2928529152 | |||
| 1406 | 2928968696 | |||
| 1407 | 2984557324 | |||
| 1408 | 2984568279 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q8d-assembly1.cif.gz_A | e. coli reco complex with ssb c-terminus | 0.8049 | 5 | 238 |
| 6cqm-assembly2.cif.gz_H-3 | crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) | 0.7947 | 3 | 77 |
| 3q8d-assembly1.cif.gz_A | e. coli reco complex with ssb c-terminus | 0.789 | 5 | 238 |
| 1h9m-assembly1.cif.gz_A | two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound | 0.7709 | 4 | 61 |
| 3m4q-assembly1.cif.gz_B | entamoeba histolytica asparaginyl-trna synthetase (asnrs) | 0.7581 | 2 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q8dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8446 | 5 | 74 | 2.40.50.140 |
| 4jcvF01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8363 | 4 | 81 | 2.40.50.140 |
| af_P9WHI5_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8349 | 1 | 80 | 2.40.50.140 |
| af_P9WHI5_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8074 | 1 | 80 | 2.40.50.140 |
| 4jcvF01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8057 | 4 | 81 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A6D315-F1-model_v4 | DNA recombination protein RecO | 0.9881 | 93 | 244 |
GO:0006281
GO:0006310 |
| AF-A5VEW5-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9838 | 2 | 241 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A5A7N7C2-F1-model_v4 | DNA replication/recombination mediator RecO N-terminal domain-containing protein | 0.9793 | 2 | 123 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A355BZV3-F1-model_v4 | DNA repair protein RecO | 0.9737 | 2 | 124 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-J3A9D5-F1-model_v4 | Recombinational DNA repair protein (RecF pathway) | 0.9725 | 2 | 85 |
|