F476374

General Info

Members Datasets Scaffolds Average Seq Length
704 326 1408 244

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0000028|Ga0495670_0000028_19659_20504
Length 281
Sequence MLSASCDAHWSDVCCLTGFPQAGKAPVAFRGAIPYIGAMHLRAEAIILSVRAHGEHGAVVRALTESDGLQPGYVRGGRSRALRPVLQPANLVLGEWRSRTEDQLAGLTVELIHSRAPMFGEPLPAAAFEWATALTAATLPDAQPYPRLYSALDGVLAAIEAAPAARGWAVALVRYELLLLAELGFGLDLEHCAATGRNDDLAFVSPKSGIAVSRLGAEGYEKRLLALPRFLFEGGEADWDDILAGLKLTGHFLERDLLIGKGADTLAARARLVDRLLRAVA

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
204 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
208 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
281 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
282 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
283 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
284 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
300 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
308 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
312 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
313 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
314 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
315 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
316 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
317 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
318 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
319 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
320 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
321 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
322 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
323 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
324 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
325 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
326 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0.14
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 8.95
Nodule 0
Rhizoplane 4.97
Rhizosphere 76.28
Stem 0
Stem Tuber 0.14
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0000028 3300046691 Bacteria 90085
2 SwRhRL2b_contig_1489105 2162886007 Bacteria 7422
3 JGI24736J21556_1002251 3300001904 Bacteria 3412
4 JGI24741J21665_1000549 3300001915 Bacteria 11447
5 JGI24752J21851_1001710 3300001976 Bacteria 2943
6 JGI24740J21852_10004963 3300001979 Bacteria 5657
7 JGI24740J21852_10005015 3300001979 Bacteria 5624
8 JGI24739J22299_10011325 3300001989 Bacteria 3294
9 JGI24737J22298_10002940 3300001990 Bacteria 6039
10 JGI24737J22298_10005153 3300001990 Bacteria 4525
11 JGI24735J21928_10001689 3300002067 Bacteria 7795
12 JGI24735J21928_10002252 3300002067 Bacteria 6743
13 JGI24735J21928_10003032 3300002067 Bacteria 5764
14 JGI24735J21928_10010004 3300002067 Bacteria 3035
15 JGI24735J21928_10015767 3300002067 Bacteria 2352
16 JGI24735J21928_10050673 3300002067 Bacteria 1199
17 JGI24750J21931_1000042 3300002070 Bacteria 16868
18 JGI24748J21848_1000063 3300002074 Bacteria 40664
19 JGI24738J21930_10001001 3300002075 Bacteria 8087
20 JGI24738J21930_10001487 3300002075 Bacteria 6511
21 JGI24744J21845_10002202 3300002077 Bacteria 3961
22 JGI24034J26672_10000007 3300002239 Bacteria 224370
23 JGI25150J39212_1002132 3300002774 Bacteria 5113
24 JGI25165J46597_1000145 3300003214 Bacteria 116948
25 JGI25153J46596_10000028 3300003215 Bacteria 209842
26 rootH2_10161563 3300003320 Bacteria 1182
27 rootH2_10235635 3300003320 Bacteria 2669
28 rootL2_10107312 3300003322 Bacteria 1065
29 rootH1_10190613 3300003323 Bacteria 1084
30 Ga0055526_1000478 3300003771 Bacteria 31736
31 Ga0055537_1001154 3300003773 Bacteria 11291
32 Ga0055524_1000457 3300003775 Bacteria 33415
33 Ga0055530_10041505 3300003791 Bacteria 1122
34 Ga0055540_1001446 3300003792 Bacteria 14141
35 Ga0055540_1001525 3300003792 Bacteria 13634
36 Ga0055531_10000384 3300003794 Bacteria 42713
37 Ga0065165_1002862 3300005262 Bacteria 13339
38 Ga0065165_1003940 3300005262 Bacteria 9774
39 Ga0065165_1031534 3300005262 Bacteria 1674
40 Ga0065165_1044517 3300005262 Bacteria 1298
41 Ga0065704_10007250 3300005289 Bacteria 4185
42 Ga0065704_10072419 3300005289 Bacteria 8555
43 Ga0065707_10082875 3300005295 Bacteria 11637
44 Ga0070658_10000033 3300005327 Bacteria 147380
45 Ga0070658_10037857 3300005327 Bacteria 3889
46 Ga0070658_10160501 3300005327 Bacteria 1886
47 Ga0070676_10411414 3300005328 Bacteria 943
48 Ga0070676_10503058 3300005328 Bacteria 860
49 Ga0070690_100000110 3300005330 Bacteria 42574
50 Ga0070690_100019099 3300005330 Bacteria 4153
51 Ga0070670_100000075 3300005331 Bacteria 97494
52 Ga0070670_100050727 3300005331 Bacteria 3565
53 Ga0070670_100085590 3300005331 Bacteria 2708
54 Ga0070670_100111155 3300005331 Bacteria 2361
55 Ga0070670_100169856 3300005331 Bacteria 1891
56 Ga0068869_100191317 3300005334 Bacteria 1609
57 Ga0070666_10000417 3300005335 Bacteria 26409
58 Ga0070666_10003441 3300005335 Bacteria 9590
59 Ga0070660_100002857 3300005339 Bacteria 11892
60 Ga0070660_100011482 3300005339 Bacteria 6296
61 Ga0070660_100054688 3300005339 Bacteria 3083
62 Ga0070660_100063008 3300005339 Bacteria 2882
63 Ga0070660_100073995 3300005339 Bacteria 2665
64 Ga0070660_100090135 3300005339 Bacteria 2417
65 Ga0070660_100092582 3300005339 Bacteria 2386
66 Ga0070660_100135012 3300005339 Bacteria 1977
67 Ga0070660_100173181 3300005339 Bacteria 1744
68 Ga0070661_100130953 3300005344 Bacteria 1884
69 Ga0070661_100199930 3300005344 Bacteria 1527
70 Ga0070661_100254965 3300005344 Bacteria 1355
71 Ga0070661_100274167 3300005344 Bacteria 1307
72 Ga0070692_10018735 3300005345 Bacteria 3333
73 Ga0070668_100089004 3300005347 Bacteria 2431
74 Ga0070669_100000332 3300005353 Bacteria 36750
75 Ga0070669_100037676 3300005353 Bacteria 3508
76 Ga0070675_100001516 3300005354 Bacteria 17164
77 Ga0070675_100146846 3300005354 Bacteria 2020
78 Ga0070671_100022882 3300005355 Bacteria 5107
79 Ga0070671_100055455 3300005355 Bacteria 3297
80 Ga0070671_100061130 3300005355 Bacteria 3137
81 Ga0070671_100073726 3300005355 Bacteria 2851
82 Ga0070671_100099761 3300005355 Bacteria 2436
83 Ga0070674_100021920 3300005356 Bacteria 4112
84 Ga0070674_100092379 3300005356 Bacteria 2187
85 Ga0070673_100002629 3300005364 Bacteria 10985
86 Ga0070659_100002258 3300005366 Bacteria 13727
87 Ga0070659_100022028 3300005366 Bacteria 4862
88 Ga0070659_100057141 3300005366 Bacteria 3076
89 Ga0070659_100062359 3300005366 Bacteria 2947
90 Ga0070659_100115132 3300005366 Bacteria 2173
91 Ga0070659_100181006 3300005366 Bacteria 1730
92 Ga0070659_100204838 3300005366 Bacteria 1625
93 Ga0070659_100271573 3300005366 Bacteria 1409
94 Ga0070659_100433901 3300005366 Bacteria 1112
95 Ga0070659_100676045 3300005366 Bacteria 891
96 Ga0070667_100000039 3300005367 Bacteria 170228
97 Ga0070667_100259304 3300005367 Bacteria 1556
98 Ga0070663_100004890 3300005455 Bacteria 7910
99 Ga0070663_100132933 3300005455 Bacteria 1891
100 Ga0070663_100181416 3300005455 Bacteria 1633
101 Ga0070678_100001866 3300005456 Bacteria 11366
102 Ga0070678_100004810 3300005456 Bacteria 7707
103 Ga0070662_100006444 3300005457 Bacteria 7564
104 Ga0070662_100011803 3300005457 Bacteria 5773
105 Ga0070662_100168906 3300005457 Bacteria 1716
106 Ga0070681_10102501 3300005458 Bacteria 2807
107 Ga0068867_100005781 3300005459 Bacteria 8775
108 Ga0068867_100006557 3300005459 Bacteria 8220
109 Ga0070685_10000036 3300005466 Bacteria 80641
110 Ga0068853_100008364 3300005539 Bacteria 8308
111 Ga0068853_100048683 3300005539 Bacteria 3642
112 Ga0068853_100552448 3300005539 Bacteria 1091
113 Ga0068853_100614750 3300005539 Bacteria 1033
114 Ga0068853_100842060 3300005539 Unclassified 879
115 Ga0070672_100018490 3300005543 Bacteria 5039
116 Ga0070672_100059421 3300005543 Bacteria 3008
117 Ga0070672_100250539 3300005543 Bacteria 1491
118 Ga0070686_100000045 3300005544 Bacteria 101988
119 Ga0070693_100096773 3300005547 Bacteria 1790
120 Ga0070665_100000042 3300005548 Bacteria 292582
121 Ga0070665_100138494 3300005548 Bacteria 2437
122 Ga0070665_100139592 3300005548 Bacteria 2427
123 Ga0068855_100117343 3300005563 Bacteria 3049
124 Ga0068855_100131931 3300005563 Bacteria 2853
125 Ga0068855_100526948 3300005563 Bacteria 1281
126 Ga0070664_100014603 3300005564 Bacteria 6408
127 Ga0070664_100044891 3300005564 Bacteria 3732
128 Ga0068857_100003501 3300005577 Bacteria 13108
129 Ga0068857_100018632 3300005577 Bacteria 6092
130 Ga0068857_100235716 3300005577 Bacteria 1674
131 Ga0068857_100244914 3300005577 Bacteria 1642
132 Ga0068857_100392160 3300005577 Bacteria 1291
133 Ga0068854_100016231 3300005578 Bacteria 4959
134 Ga0068854_100025435 3300005578 Bacteria 4062
135 Ga0068854_100067438 3300005578 Bacteria 2607
136 Ga0068856_100016269 3300005614 Bacteria 7197
137 Ga0068856_100036758 3300005614 Bacteria 4802
138 Ga0068856_100064590 3300005614 Bacteria 3617
139 Ga0068856_100246893 3300005614 Bacteria 1800
140 Ga0068852_100068729 3300005616 Bacteria 3102
141 Ga0068852_100199080 3300005616 Bacteria 1895
142 Ga0068852_100454952 3300005616 Bacteria 1268
143 Ga0068852_101093151 3300005616 Bacteria 817
144 Ga0068859_100005488 3300005617 Bacteria 12913
145 Ga0068859_100022537 3300005617 Bacteria 6316
146 Ga0068864_100000016 3300005618 Bacteria 292454
147 Ga0068864_100157801 3300005618 Bacteria 2060
148 Ga0068864_100503707 3300005618 Bacteria 1165
149 Ga0068861_100000321 3300005719 Bacteria 26985
150 Ga0068861_100000965 3300005719 Bacteria 17524
151 Ga0068851_10008938 3300005834 Bacteria 4646
152 Ga0068851_10027735 3300005834 Bacteria 2792
153 Ga0068851_10103684 3300005834 Bacteria 1511
154 Ga0068863_100000033 3300005841 Bacteria 170238
155 Ga0068863_100000280 3300005841 Bacteria 52729
156 Ga0068863_100007192 3300005841 Bacteria 10917
157 Ga0068863_100019160 3300005841 Bacteria 6550
158 Ga0068858_100007900 3300005842 Bacteria 10254
159 Ga0068858_100069059 3300005842 Bacteria 3275
160 Ga0068858_100243409 3300005842 Bacteria 1707
161 Ga0068860_100000182 3300005843 Bacteria 100888
162 Ga0068860_100112898 3300005843 Bacteria 2598
163 Ga0068862_100000040 3300005844 Bacteria 167832
164 Ga0068862_100000308 3300005844 Bacteria 53687
165 Ga0068862_100009087 3300005844 Bacteria 8225
166 Ga0068862_100266217 3300005844 Bacteria 1566
167 Ga0068862_100361141 3300005844 Bacteria 1350
168 Ga0081455_10160295 3300005937 Bacteria 1725
169 Ga0075368_10000033 3300006042 Bacteria 32184
170 Ga0075367_10000481 3300006178 Bacteria 14919
171 Ga0097621_100048516 3300006237 Bacteria 3445
172 Ga0075370_10066614 3300006353 Bacteria 2055
173 Ga0068871_100562537 3300006358 Bacteria 1034
174 Ga0075430_100059109 3300006846 Bacteria 3222
175 Ga0075431_100151201 3300006847 Bacteria 2390
176 Ga0075431_100366551 3300006847 Bacteria 1446
177 Ga0075429_100161451 3300006880 Bacteria 1963
178 Ga0068865_100004177 3300006881 Bacteria 8697
179 Ga0097620_100005488 3300006931 Bacteria 12913
180 Ga0097620_100022537 3300006931 Bacteria 6316
181 Ga0105251_10001444 3300009011 Bacteria 20434
182 Ga0105251_10017044 3300009011 Bacteria 3903
183 Ga0105240_10007666 3300009093 Bacteria 15628
184 Ga0105240_10026155 3300009093 Bacteria 7658
185 Ga0105240_10098942 3300009093 Bacteria 3551
186 Ga0105240_10128458 3300009093 Bacteria 3043
187 Ga0105240_10873625 3300009093 Bacteria 969
188 Ga0105245_10001867 3300009098 Bacteria 19148
189 Ga0105247_10214021 3300009101 Bacteria 1301
190 Ga0114129_10841433 3300009147 Bacteria 1167
191 Ga0105243_10104131 3300009148 Bacteria 2361
192 Ga0105241_10008072 3300009174 Bacteria 7745
193 Ga0105241_10217538 3300009174 Bacteria 1604
194 Ga0105242_10064796 3300009176 Bacteria 3013
195 Ga0105248_10000021 3300009177 Bacteria 276159
196 Ga0105248_10124883 3300009177 Bacteria 2903
197 Ga0105248_10394403 3300009177 Bacteria 1558
198 Ga0105248_10982508 3300009177 Bacteria 954
199 Ga0105237_10009418 3300009545 Bacteria 10463
200 Ga0105237_10013028 3300009545 Bacteria 8731
201 Ga0105237_10050016 3300009545 Bacteria 4201
202 Ga0105237_10054292 3300009545 Bacteria 4015
203 Ga0105238_10065766 3300009551 Bacteria 3627
204 Ga0105238_10120716 3300009551 Bacteria 2600
205 Ga0105238_10421674 3300009551 Bacteria 1329
206 Ga0105249_10000012 3300009553 Bacteria 292640
207 Ga0105249_10002603 3300009553 Bacteria 15632
208 Ga0105249_10325529 3300009553 Bacteria 1549
209 Ga0105249_10807819 3300009553 Bacteria 1002
210 Ga0105148_100202 3300009978 Bacteria 8692
211 Ga0105239_10000461 3300010375 Bacteria 59449
212 Ga0105246_10176826 3300011119 Bacteria 1640
213 Ga0157373_10121323 3300013100 Bacteria 1837
214 Ga0157373_10389734 3300013100 Bacteria 997
215 Ga0157373_10492926 3300013100 Bacteria 884
216 Ga0157371_10085604 3300013102 Bacteria 2233
217 Ga0157371_10149242 3300013102 Unclassified 1667
218 Ga0157371_10169826 3300013102 Bacteria 1558
219 Ga0157371_10177025 3300013102 Bacteria 1525
220 Ga0157370_10000008 3300013104 Bacteria 240668
221 Ga0157370_10002308 3300013104 Bacteria 23086
222 Ga0157370_10024209 3300013104 Bacteria 6016
223 Ga0157369_10031631 3300013105 Bacteria 5825
224 Ga0157369_10112395 3300013105 Bacteria 2893
225 Ga0157369_10816810 3300013105 Bacteria 957
226 Ga0157374_10004197 3300013296 Bacteria 12105
227 Ga0157374_10067557 3300013296 Bacteria 3361
228 Ga0157374_10372050 3300013296 Bacteria 1422
229 Ga0163162_10096754 3300013306 Bacteria 3040
230 Ga0163162_10202484 3300013306 Bacteria 2114
231 Ga0163162_10204173 3300013306 Bacteria 2105
232 Ga0157372_10018134 3300013307 Bacteria 7567
233 Ga0157372_10404374 3300013307 Bacteria 1591
234 Ga0163163_10081360 3300014325 Bacteria 3241
235 Ga0163163_10120063 3300014325 Bacteria 2662
236 Ga0163163_10159477 3300014325 Bacteria 2301
237 Ga0157380_10000440 3300014326 Bacteria 25347
238 Ga0157380_10034756 3300014326 Bacteria 3890
239 Ga0157379_10003144 3300014968 Bacteria 13972
240 Ga0157379_10036117 3300014968 Bacteria 4407
241 Ga0157379_10121240 3300014968 Bacteria 2352
242 Ga0157376_10130417 3300014969 Bacteria 2242
243 Ga0163161_10000202 3300017792 Bacteria 54518
244 Ga0163161_10017029 3300017792 Bacteria 5082
245 Ga0163161_10355841 3300017792 Bacteria 1165
246 Ga0163161_10406912 3300017792 Unclassified 1092
247 Ga0206353_11760290 3300020082 Bacteria 11326
248 Ga0213876_10033404 3300021384 Bacteria 2713
249 Ga0213875_10000721 3300021388 Bacteria 25266
250 Ga0207672_1001024 3300025223 Bacteria 2658
251 Ga0207427_100545 3300025231 Bacteria 19253
252 Ga0207425_1000005 3300025245 Bacteria 900502
253 Ga0207425_1004365 3300025245 Bacteria 4275
254 Ga0209026_1002632 3300025250 Bacteria 6543
255 Ga0209148_1000338 3300025254 Bacteria 62960
256 Ga0209129_1000825 3300025258 Bacteria 19506
257 Ga0209233_1000207 3300025261 Bacteria 117152
258 Ga0209565_1000007 3300025263 Bacteria 784361
259 Ga0209565_1000056 3300025263 Bacteria 200189
260 Ga0209455_1000480 3300025272 Bacteria 29756
261 Ga0209455_1018960 3300025272 Bacteria 1401
262 Ga0209673_1001497 3300025273 Bacteria 21703
263 Ga0209025_1000296 3300025294 Bacteria 111440
264 Ga0209758_1000002 3300025297 Bacteria 1400310
265 Ga0209758_1002418 3300025297 Bacteria 19122
266 Ga0209758_1066833 3300025297 Bacteria 1153
267 Ga0209050_1000005 3300025298 Bacteria 1557793
268 Ga0209050_1000196 3300025298 Bacteria 135678
269 Ga0209050_1008839 3300025298 Bacteria 5283
270 Ga0209050_1016183 3300025298 Bacteria 3071
271 Ga0209256_1000009 3300025299 Bacteria 922071
272 Ga0209051_1000153 3300025303 Bacteria 131166
273 Ga0209257_1000228 3300025304 Bacteria 133390
274 Ga0209257_1003469 3300025304 Bacteria 13472
275 Ga0209257_1004247 3300025304 Bacteria 11310
276 Ga0209257_1004769 3300025304 Bacteria 10121
277 Ga0207697_10016147 3300025315 Bacteria 3079
278 Ga0207656_10049933 3300025321 Bacteria 1805
279 Ga0207713_1007763 3300025735 Bacteria 6265
280 Ga0207710_10166100 3300025900 Unclassified 1077
281 Ga0207688_10032718 3300025901 Bacteria 2875
282 Ga0207680_10000012 3300025903 Bacteria 293810
283 Ga0207647_10001622 3300025904 Bacteria 17295
284 Ga0207647_10104017 3300025904 Bacteria 1683
285 Ga0207647_10135199 3300025904 Bacteria 1447
286 Ga0207705_10000002 3300025909 Bacteria 2046852
287 Ga0207705_10000027 3300025909 Bacteria 248863
288 Ga0207705_10007714 3300025909 Bacteria 7913
289 Ga0207705_10011424 3300025909 Bacteria 6428
290 Ga0207705_10042116 3300025909 Bacteria 3278
291 Ga0207705_10117758 3300025909 Bacteria 1968
292 Ga0207705_10192064 3300025909 Bacteria 1545
293 Ga0207705_10194448 3300025909 Bacteria 1535
294 Ga0207654_10001661 3300025911 Bacteria 11622
295 Ga0207654_10049270 3300025911 Bacteria 2415
296 Ga0207695_10000641 3300025913 Bacteria 69705
297 Ga0207695_10006576 3300025913 Bacteria 15034
298 Ga0207695_10024580 3300025913 Bacteria 6771
299 Ga0207695_10077765 3300025913 Bacteria 3369
300 Ga0207695_10098637 3300025913 Bacteria 2921
301 Ga0207695_10134453 3300025913 Bacteria 2427
302 Ga0207671_10002738 3300025914 Bacteria 18433
303 Ga0207671_10203960 3300025914 Bacteria 1545
304 Ga0207657_10008853 3300025919 Bacteria 10181
305 Ga0207657_10065116 3300025919 Bacteria 3108
306 Ga0207657_10065750 3300025919 Bacteria 3090
307 Ga0207657_10066709 3300025919 Bacteria 3062
308 Ga0207657_10103427 3300025919 Bacteria 2361
309 Ga0207657_10189101 3300025919 Bacteria 1662
310 Ga0207657_10227301 3300025919 Bacteria 1493
311 Ga0207657_10254383 3300025919 Bacteria 1399
312 Ga0207649_10010061 3300025920 Bacteria 5189
313 Ga0207649_10050916 3300025920 Bacteria 2563
314 Ga0207649_10126732 3300025920 Bacteria 1729
315 Ga0207649_10312385 3300025920 Bacteria 1152
316 Ga0207649_10325948 3300025920 Bacteria 1130
317 Ga0207649_10352238 3300025920 Bacteria 1090
318 Ga0207681_10000076 3300025923 Bacteria 89353
319 Ga0207694_10001461 3300025924 Bacteria 20212
320 Ga0207694_10028824 3300025924 Bacteria 4234
321 Ga0207694_10039527 3300025924 Bacteria 3630
322 Ga0207650_10000069 3300025925 Bacteria 138442
323 Ga0207650_10026743 3300025925 Bacteria 4120
324 Ga0207650_10033961 3300025925 Bacteria 3698
325 Ga0207650_10061262 3300025925 Bacteria 2809
326 Ga0207650_10157802 3300025925 Bacteria 1795
327 Ga0207659_10059191 3300025926 Bacteria 2753
328 Ga0207687_10003098 3300025927 Bacteria 11274
329 Ga0207644_10003422 3300025931 Bacteria 10247
330 Ga0207644_10067193 3300025931 Bacteria 2612
331 Ga0207644_10072418 3300025931 Bacteria 2523
332 Ga0207644_10073678 3300025931 Bacteria 2504
333 Ga0207644_10081104 3300025931 Bacteria 2396
334 Ga0207644_10225803 3300025931 Bacteria 1486
335 Ga0207690_10003689 3300025932 Bacteria 9111
336 Ga0207690_10007350 3300025932 Bacteria 6539
337 Ga0207690_10040990 3300025932 Bacteria 3031
338 Ga0207690_10043362 3300025932 Bacteria 2960
339 Ga0207690_10093263 3300025932 Bacteria 2133
340 Ga0207690_10099311 3300025932 Bacteria 2075
341 Ga0207690_10129291 3300025932 Bacteria 1846
342 Ga0207690_10161495 3300025932 Bacteria 1671
343 Ga0207690_10205312 3300025932 Bacteria 1499
344 Ga0207690_10314363 3300025932 Bacteria 1229
345 Ga0207706_10001442 3300025933 Bacteria 23791
346 Ga0207706_10018968 3300025933 Bacteria 6185
347 Ga0207706_10043654 3300025933 Bacteria 3972
348 Ga0207706_10160806 3300025933 Bacteria 1974
349 Ga0207706_10246139 3300025933 Bacteria 1562
350 Ga0207706_10511476 3300025933 Bacteria 1036
351 Ga0207706_10643802 3300025933 Bacteria 908
352 Ga0207686_10028588 3300025934 Bacteria 3279
353 Ga0207709_10105314 3300025935 Bacteria 1874
354 Ga0207669_10055566 3300025937 Bacteria 2398
355 Ga0207669_10078646 3300025937 Bacteria 2102
356 Ga0207691_10000631 3300025940 Bacteria 34819
357 Ga0207691_10037826 3300025940 Bacteria 4466
358 Ga0207711_10000025 3300025941 Bacteria 289972
359 Ga0207711_10010871 3300025941 Bacteria 7565
360 Ga0207711_10016625 3300025941 Bacteria 6110
361 Ga0207689_10087928 3300025942 Bacteria 2553
362 Ga0207689_10100100 3300025942 Bacteria 2381
363 Ga0207679_10005299 3300025945 Bacteria 8090
364 Ga0207679_10016820 3300025945 Bacteria 4862
365 Ga0207679_10196654 3300025945 Bacteria 1681
366 Ga0207667_10004663 3300025949 Bacteria 16793
367 Ga0207667_10044332 3300025949 Bacteria 4714
368 Ga0207667_10219943 3300025949 Bacteria 1946
369 Ga0207667_10277086 3300025949 Bacteria 1714
370 Ga0207651_10008206 3300025960 Bacteria 5624
371 Ga0207712_10000021 3300025961 Bacteria 292649
372 Ga0207712_10002020 3300025961 Bacteria 13317
373 Ga0207712_10134447 3300025961 Bacteria 1889
374 Ga0207668_10135614 3300025972 Bacteria 1885
375 Ga0207640_10018490 3300025981 Bacteria 4097
376 Ga0207640_10158364 3300025981 Bacteria 1672
377 Ga0207640_10228286 3300025981 Bacteria 1430
378 Ga0207658_10000652 3300025986 Bacteria 30347
379 Ga0207658_10003067 3300025986 Bacteria 11944
380 Ga0207658_10202436 3300025986 Bacteria 1658
381 Ga0207677_10087570 3300026023 Bacteria 2255
382 Ga0207703_10010176 3300026035 Bacteria 7372
383 Ga0207703_10054384 3300026035 Bacteria 3255
384 Ga0207639_10071982 3300026041 Bacteria 2706
385 Ga0207639_10315558 3300026041 Unclassified 1386
386 Ga0207639_10401778 3300026041 Bacteria 1234
387 Ga0207639_10787962 3300026041 Bacteria 885
388 Ga0207678_10001799 3300026067 Bacteria 19627
389 Ga0207678_10004357 3300026067 Bacteria 12713
390 Ga0207678_10045975 3300026067 Bacteria 3775
391 Ga0207678_10241115 3300026067 Bacteria 1548
392 Ga0207702_10002022 3300026078 Bacteria 19645
393 Ga0207702_10008254 3300026078 Bacteria 8801
394 Ga0207641_10000002 3300026088 Bacteria 981004
395 Ga0207641_10000414 3300026088 Bacteria 49835
396 Ga0207641_10005204 3300026088 Bacteria 11123
397 Ga0207648_10001344 3300026089 Bacteria 27279
398 Ga0207648_10062609 3300026089 Bacteria 3243
399 Ga0207676_10000353 3300026095 Bacteria 39309
400 Ga0207676_10009609 3300026095 Bacteria 6885
401 Ga0207676_10077831 3300026095 Bacteria 2684
402 Ga0207676_10646159 3300026095 Bacteria 1020
403 Ga0207674_10000291 3300026116 Bacteria 63446
404 Ga0207674_10010820 3300026116 Bacteria 10286
405 Ga0207674_10042500 3300026116 Bacteria 4694
406 Ga0207674_10114135 3300026116 Unclassified 2674
407 Ga0207674_10246853 3300026116 Bacteria 1732
408 Ga0207674_10251420 3300026116 Bacteria 1715
409 Ga0207675_100000227 3300026118 Bacteria 53090
410 Ga0207675_100000998 3300026118 Bacteria 28040
411 Ga0207683_10004993 3300026121 Bacteria 11396
412 Ga0207683_10010089 3300026121 Bacteria 8060
413 Ga0207698_10001499 3300026142 Bacteria 13593
414 Ga0207698_10038110 3300026142 Bacteria 3548
415 Ga0207698_10079015 3300026142 Bacteria 2644
416 Ga0207698_10095930 3300026142 Bacteria 2443
417 Ga0207698_10130366 3300026142 Bacteria 2147
418 Ga0207698_10304513 3300026142 Bacteria 1485
419 Ga0209813_10000041 3300027866 Bacteria 53753
420 Ga0268266_10000054 3300028379 Bacteria 292717
421 Ga0268266_10116025 3300028379 Bacteria 2378
422 Ga0268266_10194973 3300028379 Bacteria 1851
423 Ga0268266_10376461 3300028379 Bacteria 1338
424 Ga0268265_10000003 3300028380 Bacteria 949201
425 Ga0268265_10002814 3300028380 Bacteria 12797
426 Ga0268265_10239805 3300028380 Bacteria 1599
427 Ga0268265_10315647 3300028380 Bacteria 1413
428 Ga0268264_10000074 3300028381 Bacteria 259555
429 Ga0268264_10754480 3300028381 Bacteria 970
430 Ga0307408_100036711 3300031548 Bacteria 3446
431 Ga0307408_100453026 3300031548 Bacteria 1113
432 Ga0307405_10038560 3300031731 Bacteria 2881
433 Ga0307413_10004075 3300031824 Bacteria 6286
434 Ga0307413_10028063 3300031824 Bacteria 3128
435 Ga0307413_10119107 3300031824 Bacteria 1784
436 Ga0307410_10000281 3300031852 Bacteria 19663
437 Ga0307410_10019341 3300031852 Bacteria 4141
438 Ga0307410_10035705 3300031852 Bacteria 3231
439 Ga0307406_10020481 3300031901 Bacteria 3895
440 Ga0307406_10149122 3300031901 Bacteria 1666
441 Ga0307406_10229868 3300031901 Bacteria 1384
442 Ga0307407_10001856 3300031903 Bacteria 7945
443 Ga0307407_10004947 3300031903 Bacteria 5730
444 Ga0307407_10209618 3300031903 Bacteria 1311
445 Ga0307412_10000453 3300031911 Bacteria 24741
446 Ga0307412_10005872 3300031911 Bacteria 6914
447 Ga0307412_10132167 3300031911 Bacteria 1814
448 Ga0307409_100013771 3300031995 Bacteria 5225
449 Ga0307409_100065828 3300031995 Bacteria 2854
450 Ga0307409_100277011 3300031995 Bacteria 1548
451 Ga0307416_100009701 3300032002 Bacteria 6321
452 Ga0307416_100033727 3300032002 Bacteria 3885
453 Ga0307416_100069334 3300032002 Bacteria 2917
454 Ga0307416_100225252 3300032002 Bacteria 1802
455 Ga0307414_10000248 3300032004 Bacteria 33977
456 Ga0307414_10004115 3300032004 Bacteria 7856
457 Ga0307414_10008487 3300032004 Bacteria 5829
458 Ga0307414_10018719 3300032004 Bacteria 4272
459 Ga0307414_10373356 3300032004 Bacteria 1231
460 Ga0307411_10004182 3300032005 Bacteria 6861
461 Ga0307411_10012924 3300032005 Bacteria 4580
462 Ga0307411_10021318 3300032005 Bacteria 3789
463 Ga0307411_10076900 3300032005 Bacteria 2283
464 Ga0307411_10079644 3300032005 Bacteria 2250
465 Ga0307411_10106071 3300032005 Bacteria 1999
466 Ga0307415_100272494 3300032126 Bacteria 1387
467 Ga0373932_0041935 3300035112 Bacteria 1325
468 Ga0373932_0045385 3300035112 Bacteria 1285
469 Ga0395899_0000251 3300037312 Bacteria 71228
470 Ga0395899_0001062 3300037312 Bacteria 24783
471 Ga0395899_0001983 3300037312 Bacteria 16840
472 Ga0395900_0000084 3300037418 Bacteria 172593
473 Ga0395900_0022623 3300037418 Bacteria 6433
474 Ga0395900_0025014 3300037418 Bacteria 6110
475 Ga0395900_0479610 3300037418 Bacteria 1196
476 Ga0395898_0000021 3300037466 Bacteria 393971
477 Ga0395898_0002422 3300037466 Bacteria 22069
478 Ga0395905_0000006 3300037471 Bacteria 549428
479 Ga0395905_0000762 3300037471 Bacteria 42402
480 Ga0395905_0031744 3300037471 Bacteria 4969
481 Ga0395905_0073303 3300037471 Bacteria 3209
482 Ga0395905_0234336 3300037471 Bacteria 1716
483 Ga0395905_0528582 3300037471 Bacteria 1080
484 Ga0436364_0322209 3300037853 Bacteria 1693
485 Ga0436364_0462751 3300037853 Bacteria 45616
486 Ga0395901_0008794 3300038443 Bacteria 10217
487 Ga0395901_0009640 3300038443 Bacteria 9795
488 Ga0395901_0069324 3300038443 Bacteria 3673
489 Ga0436365_0695304 3300039437 Bacteria 6007
490 Ga0436365_1474733 3300039437 Bacteria 4043
491 Ga0436363_0379517 3300039450 Bacteria 4119
492 Ga0436363_1509936 3300039450 Bacteria 1603
493 Ga0439436_0007826 3300041404 Bacteria 3285
494 Ga0439461_0000239 3300041410 Bacteria 7764
495 Ga0439461_0006785 3300041410 Bacteria 2002
496 Ga0439465_0000177 3300041413 Bacteria 16347
497 Ga0439465_0012688 3300041413 Bacteria 2635
498 Ga0451806_431010 3300041462 Bacteria 9494
499 Ga0451804_1038976 3300041463 Bacteria 1919
500 Ga0451807_1283003 3300041486 Bacteria 5402
501 Ga0439431_0000207 3300041997 Bacteria 11634
502 Ga0439431_0006020 3300041997 Bacteria 2677
503 Ga0439442_002361 3300042002 Bacteria 3702
504 Ga0439445_0000060 3300042004 Bacteria 16616
505 Ga0439448_0001841 3300042005 Bacteria 5615
506 Ga0439432_017104 3300042006 Bacteria 2436
507 Ga0439455_0007574 3300042012 Bacteria 2300
508 Ga0439462_0000195 3300042015 Bacteria 10446
509 Ga0439446_0074395 3300042156 Bacteria 1044
510 Ga0439458_0000436 3300042157 Bacteria 10507
511 Ga0439434_0003840 3300042435 Bacteria 4392
512 Ga0439434_0007436 3300042435 Bacteria 3209
513 Ga0439464_0044684 3300042439 Bacteria 1269
514 Ga0466972_0010895 3300044658 Bacteria 4562
515 Ga0466972_0068978 3300044658 Bacteria 1689
516 Ga0466965_0084296 3300044683 Bacteria 1610
517 Ga0466961_0221293 3300044693 Bacteria 1166
518 Ga0466963_0005621 3300044694 Bacteria 7355
519 Ga0466963_0014337 3300044694 Bacteria 4886
520 Ga0466963_0087573 3300044694 Bacteria 2117
521 Ga0466971_0013927 3300044719 Bacteria 3535
522 Ga0466971_0131759 3300044719 Bacteria 1161
523 Ga0466968_0042644 3300044735 Bacteria 1919
524 Ga0466970_0050313 3300044765 Bacteria 2222
525 Ga0466957_0016826 3300044842 Bacteria 4279
526 Ga0466957_0206908 3300044842 Bacteria 1291
527 Ga0466960_0003085 3300044901 Bacteria 6375
528 Ga0466960_0035587 3300044901 Bacteria 2328
529 Ga0466958_0012119 3300045836 Bacteria 4875
530 Ga0466958_0187392 3300045836 Bacteria 1314
531 Ga0466958_0301418 3300045836 Bacteria 1029
532 Ga0466967_0007703 3300045976 Bacteria 7804
533 Ga0466967_0050831 3300045976 Bacteria 3630
534 Ga0495617_029351 3300046452 Bacteria 1849
535 Ga0495627_006278 3300046453 Bacteria 4670
536 Ga0495627_051928 3300046453 Bacteria 1231
537 Ga0495583_0001401 3300046506 Bacteria 24579
538 Ga0495606_0094008 3300046507 Bacteria 1838
539 Ga0495610_0000206 3300046512 Bacteria 65469
540 Ga0495610_0049660 3300046512 Bacteria 2053
541 Ga0495616_0000189 3300046513 Bacteria 51610
542 Ga0495632_0001899 3300046519 Bacteria 16723
543 Ga0495637_0029360 3300046520 Bacteria 2448
544 Ga0495643_0000162 3300046522 Bacteria 106672
545 Ga0495648_0000038 3300046524 Bacteria 191612
546 Ga0495663_0018160 3300046525 Bacteria 2001
547 Ga0495663_0024238 3300046525 Bacteria 1762
548 Ga0495654_0180699 3300046530 Bacteria 914
549 Ga0495621_0007456 3300046539 Bacteria 3240
550 Ga0495622_0093923 3300046557 Bacteria 1377
551 Ga0495633_0130434 3300046558 Bacteria 1163
552 Ga0495625_0257602 3300046660 Bacteria 1130
553 Ga0495671_0000034 3300046692 Bacteria 195385
554 Ga0495671_0000062 3300046692 Bacteria 106672
555 Ga0495671_0003910 3300046692 Bacteria 9038
556 Ga0495636_0163863 3300047318 Bacteria 1003
557 Ga0495673_0000013 3300047469 Bacteria 612902
558 Ga0495673_0084474 3300047469 Bacteria 1309
559 Ga0495681_0000106 3300047470 Bacteria 72369
560 Ga0495681_0008636 3300047470 Bacteria 6361
561 Ga0495686_0000366 3300047472 Bacteria 73243
562 Ga0495686_0000986 3300047472 Bacteria 34762
563 Ga0495686_0071813 3300047472 Bacteria 2129
564 Ga0496100_0001542 3300048903 Bacteria 11314
565 Ga0496100_0029233 3300048903 Bacteria 3407
566 Ga0496101_0003699 3300048904 Bacteria 9538
567 Ga0496102_0067110 3300048905 Bacteria 3289
568 Ga0496102_0088970 3300048905 Bacteria 2856
569 Ga0496102_0156222 3300048905 Bacteria 2144
570 Ga0496102_0270111 3300048905 Bacteria 1603
571 Ga0496103_0003725 3300048906 Bacteria 9269
572 Ga0496103_0041637 3300048906 Bacteria 2824
573 Ga0496103_0140695 3300048906 Bacteria 1543
574 Ga0496104_0137687 3300048907 Bacteria 2345
575 Ga0496104_0853155 3300048907 Unclassified 816
576 Ga0496105_0171707 3300048908 Bacteria 1777
577 Ga0496106_0121516 3300048909 Bacteria 2042
578 Ga0496106_0205599 3300048909 Bacteria 1568
579 Ga0496107_0018156 3300048910 Bacteria 4949
580 Ga0496107_0090106 3300048910 Unclassified 2240
581 Ga0496108_0013686 3300048911 Bacteria 6623
582 Ga0496108_0032889 3300048911 Bacteria 4308
583 Ga0496108_0156763 3300048911 Bacteria 1966
584 Ga0496109_0178660 3300048912 Bacteria 1993
585 Ga0496109_0579378 3300048912 Bacteria 1058
586 Ga0496110_0016041 3300048913 Bacteria 6247
587 Ga0496110_0023804 3300048913 Bacteria 5212
588 Ga0496110_0219553 3300048913 Bacteria 1728
589 Ga0496111_0022461 3300048914 Bacteria 4418
590 Ga0496111_0125943 3300048914 Bacteria 1893
591 Ga0496112_0105543 3300048915 Bacteria 2787
592 Ga0496113_0015706 3300048916 Bacteria 5214
593 Ga0496114_0174873 3300048917 Bacteria 1873
594 Ga0496115_0003674 3300048918 Bacteria 11044
595 Ga0496116_0121765 3300048919 Bacteria 1508
596 Ga0496117_0012393 3300048920 Bacteria 7520
597 Ga0496117_0014638 3300048920 Bacteria 6746
598 Ga0496117_0040062 3300048920 Bacteria 3451
599 Ga0496117_0047279 3300048920 Bacteria 3087
600 Ga0496117_0063203 3300048920 Bacteria 2532
601 Ga0496118_0002436 3300048921 Bacteria 25049
602 Ga0496118_0023982 3300048921 Bacteria 5279
603 Ga0496118_0027239 3300048921 Bacteria 4843
604 Ga0496118_0098454 3300048921 Bacteria 1986
605 Ga0496118_0116649 3300048921 Bacteria 1754
606 Ga0496118_0163339 3300048921 Bacteria 1373
607 Ga0496119_0102222 3300048922 Bacteria 1607
608 Ga0496120_0071098 3300048923 Bacteria 1911
609 Ga0496120_0233981 3300048923 Bacteria 871
610 Ga0496121_0000175 3300048924 Bacteria 142910
611 Ga0496121_0000650 3300048924 Bacteria 65007
612 Ga0496121_0040635 3300048924 Bacteria 4077
613 Ga0496121_0048915 3300048924 Bacteria 3592
614 Ga0496121_0050973 3300048924 Bacteria 3490
615 Ga0496121_0099521 3300048924 Bacteria 2247
616 Ga0496121_0126821 3300048924 Bacteria 1917
617 Ga0496122_0026729 3300048925 Bacteria 4964
618 Ga0496122_0028593 3300048925 Bacteria 4724
619 Ga0496122_0135922 3300048925 Bacteria 1549
620 Ga0496123_0050545 3300048926 Bacteria 2776
621 Ga0496123_0081779 3300048926 Bacteria 1961
622 Ga0496123_0163235 3300048926 Bacteria 1185
623 Ga0496123_0175105 3300048926 Bacteria 1127
624 Ga0496124_0000129 3300048927 Bacteria 156648
625 Ga0496124_0006227 3300048927 Bacteria 13070
626 Ga0496124_0007123 3300048927 Bacteria 11972
627 Ga0496124_0089345 3300048927 Bacteria 2516
628 Ga0496124_0113648 3300048927 Bacteria 2175
629 Ga0496124_0166013 3300048927 Bacteria 1716
630 Ga0496124_0214970 3300048927 Bacteria 1451
631 Ga0496124_0239613 3300048927 Bacteria 1350
632 Ga0496124_0363207 3300048927 Bacteria 1019
633 Ga0496125_0000445 3300048928 Bacteria 75404
634 Ga0496125_0007177 3300048928 Bacteria 11883
635 Ga0496125_0017604 3300048928 Bacteria 6808
636 Ga0496125_0105320 3300048928 Bacteria 2062
637 Ga0496125_0113688 3300048928 Bacteria 1952
638 Ga0496125_0142321 3300048928 Bacteria 1665
639 Ga0496125_0277712 3300048928 Bacteria 1040
640 Ga0496126_0046922 3300048929 Bacteria 3958
641 Ga0496126_0077467 3300048929 Bacteria 2947
642 Ga0496126_0149598 3300048929 Bacteria 2002
643 Ga0496126_0202533 3300048929 Bacteria 1675
644 Ga0501033_0140763 3300049570 Bacteria 1744
645 Ga0501034_0069690 3300049571 Bacteria 3528
646 Ga0501043_0108214 3300049579 Bacteria 2184
647 Ga0501047_0147011 3300049581 Bacteria 2233
648 Ga0501047_0191251 3300049581 Bacteria 1910
649 Ga0501211_005276 3300049658 Bacteria 1296
650 Ga0501223_000066 3300049663 Bacteria 33567
651 Ga0501223_000317 3300049663 Bacteria 12000
652 Ga0501224_000076 3300049664 Bacteria 10275
653 Ga0501233_000558 3300049668 Bacteria 6046
654 Ga0501233_011054 3300049668 Bacteria 1789
655 Ga0501235_003738 3300049669 Bacteria 3285
656 Ga0501235_041828 3300049669 Bacteria 1049
657 Ga0501225_0000137 3300049705 Bacteria 22173
658 Ga0501225_0000228 3300049705 Bacteria 17699
659 Ga0501225_0008682 3300049705 Bacteria 2909
660 Ga0501234_000767 3300049707 Bacteria 4989
661 Ga0501035_0294576 3300049822 Bacteria 1369
662 Ga0501044_0090163 3300049823 Bacteria 3094
663 Ga0501226_000183 3300049853 Bacteria 10218
664 nmdc:mga06z11_9_c1 3300050494 Bacteria 109982
665 nmdc:mga04h51_12_c1 3300050495 Bacteria 83117
666 nmdc:mga07m45_101835_c1 3300050496 Bacteria 1649
667 nmdc:mga05p37_27409_c1 3300050507 Bacteria 6934
668 nmdc:mga05p37_844348_c1 3300050507 Bacteria 995
669 nmdc:mga09592_115513_c1 3300050508 Bacteria 2303
670 nmdc:mga06r32_10890_c1 3300050510 Bacteria 8189
671 Ga0500643_023449 3300053087 Bacteria 1971
672 Ga0500643_070832 3300053087 Bacteria 967
673 Ga0500566_0007362 3300053094 Bacteria 6519
674 Ga0500562_029007 3300053108 Bacteria 1455
675 Ga0500592_000050 3300053116 Bacteria 35179
676 Ga0500594_0001614 3300053118 Bacteria 4902
677 Ga0500595_015056 3300053119 Bacteria 2913
678 Ga0500658_0048476 3300053134 Bacteria 1727
679 Ga0500559_0144605 3300053136 Bacteria 1114
680 Ga0500573_0000366 3300053140 Bacteria 19207
681 Ga0500573_0170376 3300053140 Bacteria 1178
682 Ga0500577_0061655 3300053142 Bacteria 1444
683 Ga0500616_0105036 3300053153 Bacteria 1374
684 Ga0500624_000084 3300053157 Bacteria 47961
685 Ga0500627_0000452 3300053158 Bacteria 11132
686 Ga0500627_0000938 3300053158 Bacteria 7861
687 Ga0500645_005027 3300053730 Bacteria 4952
688 Ga0466962_0005982 3300061719 Bacteria 5846
689 2512644916 2512564014 Bacteria 4639632
690 2600228822 2599185359 Bacteria 4772316
691 2644125801 2643221622 Bacteria 4212502
692 2778124399 2775507255 Bacteria 3945731
693 2809064386 2808606401 Bacteria 4586670
694 2809080449 2808606404 Bacteria 4652788
695 2809084718 2808606405 Bacteria 4586632
696 2819714649 2818991466 Bacteria 4748179
697 2879165271 2879163058 Bacteria 4223965
698 2880519159 2880518877 Bacteria 5012590
699 2885428503 2885427238 Bacteria 2291351
700 2928030398 2928027323 Bacteria 4382488
701 2928529152 2928526807 Bacteria 4760224
702 2928968696 2928968154 Bacteria 4633371
703 2984557324 2984555340 Bacteria 4247089
704 2984568279 2984564862 Bacteria 4339992
705 Ga0495670_0000028
706 SwRhRL2b_contig_1489105
707 JGI24736J21556_1002251
708 JGI24741J21665_1000549
709 JGI24752J21851_1001710
710 JGI24740J21852_10004963
711 JGI24740J21852_10005015
712 JGI24739J22299_10011325
713 JGI24737J22298_10002940
714 JGI24737J22298_10005153
715 JGI24735J21928_10001689
716 JGI24735J21928_10002252
717 JGI24735J21928_10003032
718 JGI24735J21928_10010004
719 JGI24735J21928_10015767
720 JGI24735J21928_10050673
721 JGI24750J21931_1000042
722 JGI24748J21848_1000063
723 JGI24738J21930_10001001
724 JGI24738J21930_10001487
725 JGI24744J21845_10002202
726 JGI24034J26672_10000007
727 JGI25150J39212_1002132
728 JGI25165J46597_1000145
729 JGI25153J46596_10000028
730 rootH2_10161563
731 rootH2_10235635
732 rootL2_10107312
733 rootH1_10190613
734 Ga0055526_1000478
735 Ga0055537_1001154
736 Ga0055524_1000457
737 Ga0055530_10041505
738 Ga0055540_1001446
739 Ga0055540_1001525
740 Ga0055531_10000384
741 Ga0065165_1002862
742 Ga0065165_1003940
743 Ga0065165_1031534
744 Ga0065165_1044517
745 Ga0065704_10007250
746 Ga0065704_10072419
747 Ga0065707_10082875
748 Ga0070658_10000033
749 Ga0070658_10037857
750 Ga0070658_10160501
751 Ga0070676_10411414
752 Ga0070676_10503058
753 Ga0070690_100000110
754 Ga0070690_100019099
755 Ga0070670_100000075
756 Ga0070670_100050727
757 Ga0070670_100085590
758 Ga0070670_100111155
759 Ga0070670_100169856
760 Ga0068869_100191317
761 Ga0070666_10000417
762 Ga0070666_10003441
763 Ga0070660_100002857
764 Ga0070660_100011482
765 Ga0070660_100054688
766 Ga0070660_100063008
767 Ga0070660_100073995
768 Ga0070660_100090135
769 Ga0070660_100092582
770 Ga0070660_100135012
771 Ga0070660_100173181
772 Ga0070661_100130953
773 Ga0070661_100199930
774 Ga0070661_100254965
775 Ga0070661_100274167
776 Ga0070692_10018735
777 Ga0070668_100089004
778 Ga0070669_100000332
779 Ga0070669_100037676
780 Ga0070675_100001516
781 Ga0070675_100146846
782 Ga0070671_100022882
783 Ga0070671_100055455
784 Ga0070671_100061130
785 Ga0070671_100073726
786 Ga0070671_100099761
787 Ga0070674_100021920
788 Ga0070674_100092379
789 Ga0070673_100002629
790 Ga0070659_100002258
791 Ga0070659_100022028
792 Ga0070659_100057141
793 Ga0070659_100062359
794 Ga0070659_100115132
795 Ga0070659_100181006
796 Ga0070659_100204838
797 Ga0070659_100271573
798 Ga0070659_100433901
799 Ga0070659_100676045
800 Ga0070667_100000039
801 Ga0070667_100259304
802 Ga0070663_100004890
803 Ga0070663_100132933
804 Ga0070663_100181416
805 Ga0070678_100001866
806 Ga0070678_100004810
807 Ga0070662_100006444
808 Ga0070662_100011803
809 Ga0070662_100168906
810 Ga0070681_10102501
811 Ga0068867_100005781
812 Ga0068867_100006557
813 Ga0070685_10000036
814 Ga0068853_100008364
815 Ga0068853_100048683
816 Ga0068853_100552448
817 Ga0068853_100614750
818 Ga0068853_100842060
819 Ga0070672_100018490
820 Ga0070672_100059421
821 Ga0070672_100250539
822 Ga0070686_100000045
823 Ga0070693_100096773
824 Ga0070665_100000042
825 Ga0070665_100138494
826 Ga0070665_100139592
827 Ga0068855_100117343
828 Ga0068855_100131931
829 Ga0068855_100526948
830 Ga0070664_100014603
831 Ga0070664_100044891
832 Ga0068857_100003501
833 Ga0068857_100018632
834 Ga0068857_100235716
835 Ga0068857_100244914
836 Ga0068857_100392160
837 Ga0068854_100016231
838 Ga0068854_100025435
839 Ga0068854_100067438
840 Ga0068856_100016269
841 Ga0068856_100036758
842 Ga0068856_100064590
843 Ga0068856_100246893
844 Ga0068852_100068729
845 Ga0068852_100199080
846 Ga0068852_100454952
847 Ga0068852_101093151
848 Ga0068859_100005488
849 Ga0068859_100022537
850 Ga0068864_100000016
851 Ga0068864_100157801
852 Ga0068864_100503707
853 Ga0068861_100000321
854 Ga0068861_100000965
855 Ga0068851_10008938
856 Ga0068851_10027735
857 Ga0068851_10103684
858 Ga0068863_100000033
859 Ga0068863_100000280
860 Ga0068863_100007192
861 Ga0068863_100019160
862 Ga0068858_100007900
863 Ga0068858_100069059
864 Ga0068858_100243409
865 Ga0068860_100000182
866 Ga0068860_100112898
867 Ga0068862_100000040
868 Ga0068862_100000308
869 Ga0068862_100009087
870 Ga0068862_100266217
871 Ga0068862_100361141
872 Ga0081455_10160295
873 Ga0075368_10000033
874 Ga0075367_10000481
875 Ga0097621_100048516
876 Ga0075370_10066614
877 Ga0068871_100562537
878 Ga0075430_100059109
879 Ga0075431_100151201
880 Ga0075431_100366551
881 Ga0075429_100161451
882 Ga0068865_100004177
883 Ga0097620_100005488
884 Ga0097620_100022537
885 Ga0105251_10001444
886 Ga0105251_10017044
887 Ga0105240_10007666
888 Ga0105240_10026155
889 Ga0105240_10098942
890 Ga0105240_10128458
891 Ga0105240_10873625
892 Ga0105245_10001867
893 Ga0105247_10214021
894 Ga0114129_10841433
895 Ga0105243_10104131
896 Ga0105241_10008072
897 Ga0105241_10217538
898 Ga0105242_10064796
899 Ga0105248_10000021
900 Ga0105248_10124883
901 Ga0105248_10394403
902 Ga0105248_10982508
903 Ga0105237_10009418
904 Ga0105237_10013028
905 Ga0105237_10050016
906 Ga0105237_10054292
907 Ga0105238_10065766
908 Ga0105238_10120716
909 Ga0105238_10421674
910 Ga0105249_10000012
911 Ga0105249_10002603
912 Ga0105249_10325529
913 Ga0105249_10807819
914 Ga0105148_100202
915 Ga0105239_10000461
916 Ga0105246_10176826
917 Ga0157373_10121323
918 Ga0157373_10389734
919 Ga0157373_10492926
920 Ga0157371_10085604
921 Ga0157371_10149242
922 Ga0157371_10169826
923 Ga0157371_10177025
924 Ga0157370_10000008
925 Ga0157370_10002308
926 Ga0157370_10024209
927 Ga0157369_10031631
928 Ga0157369_10112395
929 Ga0157369_10816810
930 Ga0157374_10004197
931 Ga0157374_10067557
932 Ga0157374_10372050
933 Ga0163162_10096754
934 Ga0163162_10202484
935 Ga0163162_10204173
936 Ga0157372_10018134
937 Ga0157372_10404374
938 Ga0163163_10081360
939 Ga0163163_10120063
940 Ga0163163_10159477
941 Ga0157380_10000440
942 Ga0157380_10034756
943 Ga0157379_10003144
944 Ga0157379_10036117
945 Ga0157379_10121240
946 Ga0157376_10130417
947 Ga0163161_10000202
948 Ga0163161_10017029
949 Ga0163161_10355841
950 Ga0163161_10406912
951 Ga0206353_11760290
952 Ga0213876_10033404
953 Ga0213875_10000721
954 Ga0207672_1001024
955 Ga0207427_100545
956 Ga0207425_1000005
957 Ga0207425_1004365
958 Ga0209026_1002632
959 Ga0209148_1000338
960 Ga0209129_1000825
961 Ga0209233_1000207
962 Ga0209565_1000007
963 Ga0209565_1000056
964 Ga0209455_1000480
965 Ga0209455_1018960
966 Ga0209673_1001497
967 Ga0209025_1000296
968 Ga0209758_1000002
969 Ga0209758_1002418
970 Ga0209758_1066833
971 Ga0209050_1000005
972 Ga0209050_1000196
973 Ga0209050_1008839
974 Ga0209050_1016183
975 Ga0209256_1000009
976 Ga0209051_1000153
977 Ga0209257_1000228
978 Ga0209257_1003469
979 Ga0209257_1004247
980 Ga0209257_1004769
981 Ga0207697_10016147
982 Ga0207656_10049933
983 Ga0207713_1007763
984 Ga0207710_10166100
985 Ga0207688_10032718
986 Ga0207680_10000012
987 Ga0207647_10001622
988 Ga0207647_10104017
989 Ga0207647_10135199
990 Ga0207705_10000002
991 Ga0207705_10000027
992 Ga0207705_10007714
993 Ga0207705_10011424
994 Ga0207705_10042116
995 Ga0207705_10117758
996 Ga0207705_10192064
997 Ga0207705_10194448
998 Ga0207654_10001661
999 Ga0207654_10049270
1000 Ga0207695_10000641
1001 Ga0207695_10006576
1002 Ga0207695_10024580
1003 Ga0207695_10077765
1004 Ga0207695_10098637
1005 Ga0207695_10134453
1006 Ga0207671_10002738
1007 Ga0207671_10203960
1008 Ga0207657_10008853
1009 Ga0207657_10065116
1010 Ga0207657_10065750
1011 Ga0207657_10066709
1012 Ga0207657_10103427
1013 Ga0207657_10189101
1014 Ga0207657_10227301
1015 Ga0207657_10254383
1016 Ga0207649_10010061
1017 Ga0207649_10050916
1018 Ga0207649_10126732
1019 Ga0207649_10312385
1020 Ga0207649_10325948
1021 Ga0207649_10352238
1022 Ga0207681_10000076
1023 Ga0207694_10001461
1024 Ga0207694_10028824
1025 Ga0207694_10039527
1026 Ga0207650_10000069
1027 Ga0207650_10026743
1028 Ga0207650_10033961
1029 Ga0207650_10061262
1030 Ga0207650_10157802
1031 Ga0207659_10059191
1032 Ga0207687_10003098
1033 Ga0207644_10003422
1034 Ga0207644_10067193
1035 Ga0207644_10072418
1036 Ga0207644_10073678
1037 Ga0207644_10081104
1038 Ga0207644_10225803
1039 Ga0207690_10003689
1040 Ga0207690_10007350
1041 Ga0207690_10040990
1042 Ga0207690_10043362
1043 Ga0207690_10093263
1044 Ga0207690_10099311
1045 Ga0207690_10129291
1046 Ga0207690_10161495
1047 Ga0207690_10205312
1048 Ga0207690_10314363
1049 Ga0207706_10001442
1050 Ga0207706_10018968
1051 Ga0207706_10043654
1052 Ga0207706_10160806
1053 Ga0207706_10246139
1054 Ga0207706_10511476
1055 Ga0207706_10643802
1056 Ga0207686_10028588
1057 Ga0207709_10105314
1058 Ga0207669_10055566
1059 Ga0207669_10078646
1060 Ga0207691_10000631
1061 Ga0207691_10037826
1062 Ga0207711_10000025
1063 Ga0207711_10010871
1064 Ga0207711_10016625
1065 Ga0207689_10087928
1066 Ga0207689_10100100
1067 Ga0207679_10005299
1068 Ga0207679_10016820
1069 Ga0207679_10196654
1070 Ga0207667_10004663
1071 Ga0207667_10044332
1072 Ga0207667_10219943
1073 Ga0207667_10277086
1074 Ga0207651_10008206
1075 Ga0207712_10000021
1076 Ga0207712_10002020
1077 Ga0207712_10134447
1078 Ga0207668_10135614
1079 Ga0207640_10018490
1080 Ga0207640_10158364
1081 Ga0207640_10228286
1082 Ga0207658_10000652
1083 Ga0207658_10003067
1084 Ga0207658_10202436
1085 Ga0207677_10087570
1086 Ga0207703_10010176
1087 Ga0207703_10054384
1088 Ga0207639_10071982
1089 Ga0207639_10315558
1090 Ga0207639_10401778
1091 Ga0207639_10787962
1092 Ga0207678_10001799
1093 Ga0207678_10004357
1094 Ga0207678_10045975
1095 Ga0207678_10241115
1096 Ga0207702_10002022
1097 Ga0207702_10008254
1098 Ga0207641_10000002
1099 Ga0207641_10000414
1100 Ga0207641_10005204
1101 Ga0207648_10001344
1102 Ga0207648_10062609
1103 Ga0207676_10000353
1104 Ga0207676_10009609
1105 Ga0207676_10077831
1106 Ga0207676_10646159
1107 Ga0207674_10000291
1108 Ga0207674_10010820
1109 Ga0207674_10042500
1110 Ga0207674_10114135
1111 Ga0207674_10246853
1112 Ga0207674_10251420
1113 Ga0207675_100000227
1114 Ga0207675_100000998
1115 Ga0207683_10004993
1116 Ga0207683_10010089
1117 Ga0207698_10001499
1118 Ga0207698_10038110
1119 Ga0207698_10079015
1120 Ga0207698_10095930
1121 Ga0207698_10130366
1122 Ga0207698_10304513
1123 Ga0209813_10000041
1124 Ga0268266_10000054
1125 Ga0268266_10116025
1126 Ga0268266_10194973
1127 Ga0268266_10376461
1128 Ga0268265_10000003
1129 Ga0268265_10002814
1130 Ga0268265_10239805
1131 Ga0268265_10315647
1132 Ga0268264_10000074
1133 Ga0268264_10754480
1134 Ga0307408_100036711
1135 Ga0307408_100453026
1136 Ga0307405_10038560
1137 Ga0307413_10004075
1138 Ga0307413_10028063
1139 Ga0307413_10119107
1140 Ga0307410_10000281
1141 Ga0307410_10019341
1142 Ga0307410_10035705
1143 Ga0307406_10020481
1144 Ga0307406_10149122
1145 Ga0307406_10229868
1146 Ga0307407_10001856
1147 Ga0307407_10004947
1148 Ga0307407_10209618
1149 Ga0307412_10000453
1150 Ga0307412_10005872
1151 Ga0307412_10132167
1152 Ga0307409_100013771
1153 Ga0307409_100065828
1154 Ga0307409_100277011
1155 Ga0307416_100009701
1156 Ga0307416_100033727
1157 Ga0307416_100069334
1158 Ga0307416_100225252
1159 Ga0307414_10000248
1160 Ga0307414_10004115
1161 Ga0307414_10008487
1162 Ga0307414_10018719
1163 Ga0307414_10373356
1164 Ga0307411_10004182
1165 Ga0307411_10012924
1166 Ga0307411_10021318
1167 Ga0307411_10076900
1168 Ga0307411_10079644
1169 Ga0307411_10106071
1170 Ga0307415_100272494
1171 Ga0373932_0041935
1172 Ga0373932_0045385
1173 Ga0395899_0000251
1174 Ga0395899_0001062
1175 Ga0395899_0001983
1176 Ga0395900_0000084
1177 Ga0395900_0022623
1178 Ga0395900_0025014
1179 Ga0395900_0479610
1180 Ga0395898_0000021
1181 Ga0395898_0002422
1182 Ga0395905_0000006
1183 Ga0395905_0000762
1184 Ga0395905_0031744
1185 Ga0395905_0073303
1186 Ga0395905_0234336
1187 Ga0395905_0528582
1188 Ga0436364_0322209
1189 Ga0436364_0462751
1190 Ga0395901_0008794
1191 Ga0395901_0009640
1192 Ga0395901_0069324
1193 Ga0436365_0695304
1194 Ga0436365_1474733
1195 Ga0436363_0379517
1196 Ga0436363_1509936
1197 Ga0439436_0007826
1198 Ga0439461_0000239
1199 Ga0439461_0006785
1200 Ga0439465_0000177
1201 Ga0439465_0012688
1202 Ga0451806_431010
1203 Ga0451804_1038976
1204 Ga0451807_1283003
1205 Ga0439431_0000207
1206 Ga0439431_0006020
1207 Ga0439442_002361
1208 Ga0439445_0000060
1209 Ga0439448_0001841
1210 Ga0439432_017104
1211 Ga0439455_0007574
1212 Ga0439462_0000195
1213 Ga0439446_0074395
1214 Ga0439458_0000436
1215 Ga0439434_0003840
1216 Ga0439434_0007436
1217 Ga0439464_0044684
1218 Ga0466972_0010895
1219 Ga0466972_0068978
1220 Ga0466965_0084296
1221 Ga0466961_0221293
1222 Ga0466963_0005621
1223 Ga0466963_0014337
1224 Ga0466963_0087573
1225 Ga0466971_0013927
1226 Ga0466971_0131759
1227 Ga0466968_0042644
1228 Ga0466970_0050313
1229 Ga0466957_0016826
1230 Ga0466957_0206908
1231 Ga0466960_0003085
1232 Ga0466960_0035587
1233 Ga0466958_0012119
1234 Ga0466958_0187392
1235 Ga0466958_0301418
1236 Ga0466967_0007703
1237 Ga0466967_0050831
1238 Ga0495617_029351
1239 Ga0495627_006278
1240 Ga0495627_051928
1241 Ga0495583_0001401
1242 Ga0495606_0094008
1243 Ga0495610_0000206
1244 Ga0495610_0049660
1245 Ga0495616_0000189
1246 Ga0495632_0001899
1247 Ga0495637_0029360
1248 Ga0495643_0000162
1249 Ga0495648_0000038
1250 Ga0495663_0018160
1251 Ga0495663_0024238
1252 Ga0495654_0180699
1253 Ga0495621_0007456
1254 Ga0495622_0093923
1255 Ga0495633_0130434
1256 Ga0495625_0257602
1257 Ga0495671_0000034
1258 Ga0495671_0000062
1259 Ga0495671_0003910
1260 Ga0495636_0163863
1261 Ga0495673_0000013
1262 Ga0495673_0084474
1263 Ga0495681_0000106
1264 Ga0495681_0008636
1265 Ga0495686_0000366
1266 Ga0495686_0000986
1267 Ga0495686_0071813
1268 Ga0496100_0001542
1269 Ga0496100_0029233
1270 Ga0496101_0003699
1271 Ga0496102_0067110
1272 Ga0496102_0088970
1273 Ga0496102_0156222
1274 Ga0496102_0270111
1275 Ga0496103_0003725
1276 Ga0496103_0041637
1277 Ga0496103_0140695
1278 Ga0496104_0137687
1279 Ga0496104_0853155
1280 Ga0496105_0171707
1281 Ga0496106_0121516
1282 Ga0496106_0205599
1283 Ga0496107_0018156
1284 Ga0496107_0090106
1285 Ga0496108_0013686
1286 Ga0496108_0032889
1287 Ga0496108_0156763
1288 Ga0496109_0178660
1289 Ga0496109_0579378
1290 Ga0496110_0016041
1291 Ga0496110_0023804
1292 Ga0496110_0219553
1293 Ga0496111_0022461
1294 Ga0496111_0125943
1295 Ga0496112_0105543
1296 Ga0496113_0015706
1297 Ga0496114_0174873
1298 Ga0496115_0003674
1299 Ga0496116_0121765
1300 Ga0496117_0012393
1301 Ga0496117_0014638
1302 Ga0496117_0040062
1303 Ga0496117_0047279
1304 Ga0496117_0063203
1305 Ga0496118_0002436
1306 Ga0496118_0023982
1307 Ga0496118_0027239
1308 Ga0496118_0098454
1309 Ga0496118_0116649
1310 Ga0496118_0163339
1311 Ga0496119_0102222
1312 Ga0496120_0071098
1313 Ga0496120_0233981
1314 Ga0496121_0000175
1315 Ga0496121_0000650
1316 Ga0496121_0040635
1317 Ga0496121_0048915
1318 Ga0496121_0050973
1319 Ga0496121_0099521
1320 Ga0496121_0126821
1321 Ga0496122_0026729
1322 Ga0496122_0028593
1323 Ga0496122_0135922
1324 Ga0496123_0050545
1325 Ga0496123_0081779
1326 Ga0496123_0163235
1327 Ga0496123_0175105
1328 Ga0496124_0000129
1329 Ga0496124_0006227
1330 Ga0496124_0007123
1331 Ga0496124_0089345
1332 Ga0496124_0113648
1333 Ga0496124_0166013
1334 Ga0496124_0214970
1335 Ga0496124_0239613
1336 Ga0496124_0363207
1337 Ga0496125_0000445
1338 Ga0496125_0007177
1339 Ga0496125_0017604
1340 Ga0496125_0105320
1341 Ga0496125_0113688
1342 Ga0496125_0142321
1343 Ga0496125_0277712
1344 Ga0496126_0046922
1345 Ga0496126_0077467
1346 Ga0496126_0149598
1347 Ga0496126_0202533
1348 Ga0501033_0140763
1349 Ga0501034_0069690
1350 Ga0501043_0108214
1351 Ga0501047_0147011
1352 Ga0501047_0191251
1353 Ga0501211_005276
1354 Ga0501223_000066
1355 Ga0501223_000317
1356 Ga0501224_000076
1357 Ga0501233_000558
1358 Ga0501233_011054
1359 Ga0501235_003738
1360 Ga0501235_041828
1361 Ga0501225_0000137
1362 Ga0501225_0000228
1363 Ga0501225_0008682
1364 Ga0501234_000767
1365 Ga0501035_0294576
1366 Ga0501044_0090163
1367 Ga0501226_000183
1368 nmdc:mga06z11_9_c1
1369 nmdc:mga04h51_12_c1
1370 nmdc:mga07m45_101835_c1
1371 nmdc:mga05p37_27409_c1
1372 nmdc:mga05p37_844348_c1
1373 nmdc:mga09592_115513_c1
1374 nmdc:mga06r32_10890_c1
1375 Ga0500643_023449
1376 Ga0500643_070832
1377 Ga0500566_0007362
1378 Ga0500562_029007
1379 Ga0500592_000050
1380 Ga0500594_0001614
1381 Ga0500595_015056
1382 Ga0500658_0048476
1383 Ga0500559_0144605
1384 Ga0500573_0000366
1385 Ga0500573_0170376
1386 Ga0500577_0061655
1387 Ga0500616_0105036
1388 Ga0500624_000084
1389 Ga0500627_0000452
1390 Ga0500627_0000938
1391 Ga0500645_005027
1392 Ga0466962_0005982
1393 2512644916
1394 2600228822
1395 2644125801
1396 2778124399
1397 2809064386
1398 2809080449
1399 2809084718
1400 2819714649
1401 2879165271
1402 2880519159
1403 2885428503
1404 2928030398
1405 2928529152
1406 2928968696
1407 2984557324
1408 2984568279

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02565

RecO_C

Recombination protein O C terminal

124

263

0.93

PF11967

RecO_N

Recombination protein O N terminal

39

115

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.8049 5 238
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7947 3 77
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.789 5 238
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.7709 4 61
3m4q-assembly1.cif.gz_B entamoeba histolytica asparaginyl-trna synthetase (asnrs) 0.7581 2 77
ID Description Score Start End Superfamily
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8446 5 74 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8363 4 81 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8349 1 80 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8074 1 80 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8057 4 81 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0A6D315-F1-model_v4 DNA recombination protein RecO 0.9881 93 244 GO:0006281
GO:0006310
AF-A5VEW5-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9838 2 241 GO:0006302
GO:0006310
GO:0043590
AF-A0A5A7N7C2-F1-model_v4 DNA replication/recombination mediator RecO N-terminal domain-containing protein 0.9793 2 123 GO:0006302
GO:0006310
GO:0043590
AF-A0A355BZV3-F1-model_v4 DNA repair protein RecO 0.9737 2 124 GO:0006302
GO:0006310
GO:0043590
AF-J3A9D5-F1-model_v4 Recombinational DNA repair protein (RecF pathway) 0.9725 2 85

Map